Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.86801581578371e-117
ACR112C1541336442e-87
KLLA0D07161g1801426401e-86
Sklu_2012.41501486215e-84
YPL135W (ISU1)1651426192e-83
YOR226C (ISU2)1561336182e-83
CAGL0M02629g2131536206e-83
Scas_640.221601295949e-80
Scas_700.391611295931e-79
CAGL0J04048g1451315807e-78
YNL169C (PSD1)50070710.17
YOL076W (MDM20)79662690.37
Scas_707.3691583670.63
Sklu_1641.1462160660.76
Sklu_1724.190841651.2
CAGL0J06226g50870622.6
AAR167C35998613.2
Scas_625.476136604.6
Scas_657.385649597.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.8680
         (157 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.8680                                                          327   e-117
ACR112C [1159] [Homologous to ScYPL135W (ISU1) - SH; ScYOR226C (...   252   2e-87
KLLA0D07161g complement(612348..612890) some similarities with s...   251   1e-86
Sklu_2012.4 YPL135W, Contig c2012 4922-5374 reverse complement        243   5e-84
YPL135W (ISU1) [5310] chr16 (297552..298049) Protein with simila...   243   2e-83
YOR226C (ISU2) [5017] chr15 complement(761614..762084) Protein w...   242   2e-83
CAGL0M02629g 303016..303657 some similarities with tr|Q03020 Sac...   243   6e-83
Scas_640.22                                                           233   9e-80
Scas_700.39                                                           233   1e-79
CAGL0J04048g 381327..381764 highly similar to tr|Q12056 Saccharo...   228   7e-78
YNL169C (PSD1) [4427] chr14 complement(316169..317671) Phosphati...    32   0.17 
YOL076W (MDM20) [4744] chr15 (187023..189413) Protein required f...    31   0.37 
Scas_707.36                                                            30   0.63 
Sklu_1641.1 YBL098W, Contig c1641 1163-2551                            30   0.76 
Sklu_1724.1 YLR148W, Contig c1724 365-3091 reverse complement          30   1.2  
CAGL0J06226g 587164..588690 highly similar to sp|P39006 Saccharo...    28   2.6  
AAR167C [355] [Homologous to ScYBR221C (PDB1) - SH] (642620..643...    28   3.2  
Scas_625.4                                                             28   4.6  
Scas_657.3                                                             27   7.0  

>Kwal_26.8680
          Length = 158

 Score =  327 bits (837), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 157/157 (100%), Positives = 157/157 (100%)

Query: 1   MFRTLISQKWPVAARGGMGSMASVARRAYHPKVIDHYTNPRNVGSLDKKLENVGTGLVGA 60
           MFRTLISQKWPVAARGGMGSMASVARRAYHPKVIDHYTNPRNVGSLDKKLENVGTGLVGA
Sbjct: 1   MFRTLISQKWPVAARGGMGSMASVARRAYHPKVIDHYTNPRNVGSLDKKLENVGTGLVGA 60

Query: 61  PACGDVMKLQIQVNDETGVIENVKFKTFGCGSAIASSSYMTELVRGKTLDVASQIKNTEI 120
           PACGDVMKLQIQVNDETGVIENVKFKTFGCGSAIASSSYMTELVRGKTLDVASQIKNTEI
Sbjct: 61  PACGDVMKLQIQVNDETGVIENVKFKTFGCGSAIASSSYMTELVRGKTLDVASQIKNTEI 120

Query: 121 AKELSLPPVKLHCSMLAEDAIKAAIKDYRSKRKATVL 157
           AKELSLPPVKLHCSMLAEDAIKAAIKDYRSKRKATVL
Sbjct: 121 AKELSLPPVKLHCSMLAEDAIKAAIKDYRSKRKATVL 157

>ACR112C [1159] [Homologous to ScYPL135W (ISU1) - SH; ScYOR226C
           (ISU2) - SH] (549554..550018) [465 bp, 154 aa]
          Length = 154

 Score =  252 bits (644), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 121/133 (90%), Positives = 126/133 (94%)

Query: 25  ARRAYHPKVIDHYTNPRNVGSLDKKLENVGTGLVGAPACGDVMKLQIQVNDETGVIENVK 84
           ARR YHPKVIDHYTNPRNVG+LDKKL NVGTGLVGAPACGDVM+LQIQV+D TGVIENVK
Sbjct: 21  ARRCYHPKVIDHYTNPRNVGTLDKKLTNVGTGLVGAPACGDVMRLQIQVDDSTGVIENVK 80

Query: 85  FKTFGCGSAIASSSYMTELVRGKTLDVASQIKNTEIAKELSLPPVKLHCSMLAEDAIKAA 144
           FKTFGCGSAIASSSYMTELVRGKTL  A +IKNTEIA+ELSLPPVKLHCSMLAEDAIKAA
Sbjct: 81  FKTFGCGSAIASSSYMTELVRGKTLADAEKIKNTEIARELSLPPVKLHCSMLAEDAIKAA 140

Query: 145 IKDYRSKRKATVL 157
           IKDYRSKRKAT L
Sbjct: 141 IKDYRSKRKATEL 153

>KLLA0D07161g complement(612348..612890) some similarities with
           sgd|S0006056 Saccharomyces cerevisiae YPL135w ISU1,
           hypothetical start
          Length = 180

 Score =  251 bits (640), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 123/142 (86%), Positives = 129/142 (90%), Gaps = 2/142 (1%)

Query: 16  GGMGSMASVARRAYHPKVIDHYTNPRNVGSLDKKLENVGTGLVGAPACGDVMKLQIQVND 75
           G   SMAS   R YHPKVIDHYTNPRNVGSLDK L NVGTGLVGAPACGDVMKLQIQVND
Sbjct: 40  GSSPSMASA--RFYHPKVIDHYTNPRNVGSLDKNLPNVGTGLVGAPACGDVMKLQIQVND 97

Query: 76  ETGVIENVKFKTFGCGSAIASSSYMTELVRGKTLDVASQIKNTEIAKELSLPPVKLHCSM 135
           ETGVIENVKFKTFGCGSAIASSSYMTELVRGKTL+ A++IKNTEIA+ELSLPPVKLHCSM
Sbjct: 98  ETGVIENVKFKTFGCGSAIASSSYMTELVRGKTLEDAAKIKNTEIARELSLPPVKLHCSM 157

Query: 136 LAEDAIKAAIKDYRSKRKATVL 157
           LAEDAIKAAIKDY++KR  T L
Sbjct: 158 LAEDAIKAAIKDYQAKRPTTQL 179

>Sklu_2012.4 YPL135W, Contig c2012 4922-5374 reverse complement
          Length = 150

 Score =  243 bits (621), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 125/148 (84%), Gaps = 8/148 (5%)

Query: 1   MFRTLISQKWPVAARGGMGSMASVARRAYHPKVIDHYTNPRNVGSLDKKLENVGTGLVGA 60
           MFR       PV           + RR YHPKVIDHYTNPRNVGSLDK L NVGTGLVGA
Sbjct: 1   MFRNTFRFSAPVTR--------PLTRRLYHPKVIDHYTNPRNVGSLDKNLTNVGTGLVGA 52

Query: 61  PACGDVMKLQIQVNDETGVIENVKFKTFGCGSAIASSSYMTELVRGKTLDVASQIKNTEI 120
           PACGDVMKLQIQVND+TGVIENVKFKTFGCGSAIASSSYMTELVRGKTLD A++I+NTEI
Sbjct: 53  PACGDVMKLQIQVNDDTGVIENVKFKTFGCGSAIASSSYMTELVRGKTLDDAAKIRNTEI 112

Query: 121 AKELSLPPVKLHCSMLAEDAIKAAIKDY 148
           A+ELSLPPVKLHCSMLAEDAIKAAIKDY
Sbjct: 113 ARELSLPPVKLHCSMLAEDAIKAAIKDY 140

>YPL135W (ISU1) [5310] chr16 (297552..298049) Protein with
           similarity to iron-sulfur cluster nitrogen fixation
           proteins [498 bp, 165 aa]
          Length = 165

 Score =  243 bits (619), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 131/142 (92%), Gaps = 1/142 (0%)

Query: 11  PVAARGGMGSMASVARRAYHPKVIDHYTNPRNVGSLDKKLENVGTGLVGAPACGDVMKLQ 70
           PV A G + + +S+ +R YHPKVI+HYT+PRNVGSLDKKL NVGTGLVGAPACGDVM+LQ
Sbjct: 18  PVNAMGVLRA-SSITKRLYHPKVIEHYTHPRNVGSLDKKLPNVGTGLVGAPACGDVMRLQ 76

Query: 71  IQVNDETGVIENVKFKTFGCGSAIASSSYMTELVRGKTLDVASQIKNTEIAKELSLPPVK 130
           I+VND TGVIE+VKFKTFGCGSAIASSSYMTELV+G TLD A++IKNTEIAKELSLPPVK
Sbjct: 77  IKVNDSTGVIEDVKFKTFGCGSAIASSSYMTELVQGMTLDDAAKIKNTEIAKELSLPPVK 136

Query: 131 LHCSMLAEDAIKAAIKDYRSKR 152
           LHCSMLAEDAIKAAIKDY+SKR
Sbjct: 137 LHCSMLAEDAIKAAIKDYKSKR 158

>YOR226C (ISU2) [5017] chr15 complement(761614..762084) Protein with
           similarity to iron-sulfur cluster nitrogen fixation
           proteins [471 bp, 156 aa]
          Length = 156

 Score =  242 bits (618), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 113/133 (84%), Positives = 125/133 (93%)

Query: 25  ARRAYHPKVIDHYTNPRNVGSLDKKLENVGTGLVGAPACGDVMKLQIQVNDETGVIENVK 84
           A+R YHPKVIDHYTNPRNVGS+DK L NVGTG+VGAPACGDV+KLQIQVND++G+IENVK
Sbjct: 23  AKRLYHPKVIDHYTNPRNVGSMDKSLANVGTGIVGAPACGDVIKLQIQVNDKSGIIENVK 82

Query: 85  FKTFGCGSAIASSSYMTELVRGKTLDVASQIKNTEIAKELSLPPVKLHCSMLAEDAIKAA 144
           FKTFGCGSAIASSSYMTELVRG +LD A +IKNTEIAKELSLPPVKLHCSMLAEDAIKAA
Sbjct: 83  FKTFGCGSAIASSSYMTELVRGMSLDEAVKIKNTEIAKELSLPPVKLHCSMLAEDAIKAA 142

Query: 145 IKDYRSKRKATVL 157
           IKDY++KR  +VL
Sbjct: 143 IKDYKTKRNPSVL 155

>CAGL0M02629g 303016..303657 some similarities with tr|Q03020
           Saccharomyces cerevisiae YPL135w ISU1 or tr|Q12056
           Saccharomyces cerevisiae YOR226c ISU2, hypothetical
           start
          Length = 213

 Score =  243 bits (620), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 116/153 (75%), Positives = 133/153 (86%)

Query: 3   RTLISQKWPVAARGGMGSMASVARRAYHPKVIDHYTNPRNVGSLDKKLENVGTGLVGAPA 62
           R+ +     + A G  G+M ++ RR YHPKVI+HYT+PRNVGS+DK L NVGTGLVGAPA
Sbjct: 57  RSTMGAMGAIGAIGAKGTMNNIGRRMYHPKVIEHYTHPRNVGSMDKTLPNVGTGLVGAPA 116

Query: 63  CGDVMKLQIQVNDETGVIENVKFKTFGCGSAIASSSYMTELVRGKTLDVASQIKNTEIAK 122
           CGDVM+LQI+VND+TGVIE+VKFKTFGCGSAIASSSYMTELV G TLD A++IKNT IAK
Sbjct: 117 CGDVMRLQIKVNDKTGVIEDVKFKTFGCGSAIASSSYMTELVHGMTLDDAAKIKNTTIAK 176

Query: 123 ELSLPPVKLHCSMLAEDAIKAAIKDYRSKRKAT 155
           ELSLPPVKLHCSMLAEDAIKAAIKDY+SKR +T
Sbjct: 177 ELSLPPVKLHCSMLAEDAIKAAIKDYKSKRTST 209

>Scas_640.22
          Length = 160

 Score =  233 bits (594), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 107/129 (82%), Positives = 120/129 (93%)

Query: 24  VARRAYHPKVIDHYTNPRNVGSLDKKLENVGTGLVGAPACGDVMKLQIQVNDETGVIENV 83
           + +R YH KVI+HYTNPRNVGSLDK L NVGTG+VGAPACGDV+KLQIQVND+TG+IENV
Sbjct: 25  LTKRLYHAKVIEHYTNPRNVGSLDKSLSNVGTGIVGAPACGDVIKLQIQVNDDTGIIENV 84

Query: 84  KFKTFGCGSAIASSSYMTELVRGKTLDVASQIKNTEIAKELSLPPVKLHCSMLAEDAIKA 143
           KFKTFGCGSAIASSSYMTELV G ++D A++IKN EIAKELSLPPVKLHCSMLAEDAIKA
Sbjct: 85  KFKTFGCGSAIASSSYMTELVNGMSVDDAAKIKNIEIAKELSLPPVKLHCSMLAEDAIKA 144

Query: 144 AIKDYRSKR 152
           AIKDY++KR
Sbjct: 145 AIKDYKTKR 153

>Scas_700.39
          Length = 161

 Score =  233 bits (593), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 108/129 (83%), Positives = 120/129 (93%)

Query: 24  VARRAYHPKVIDHYTNPRNVGSLDKKLENVGTGLVGAPACGDVMKLQIQVNDETGVIENV 83
           + RR YHPKVIDHYT+PRNVGSLDKK  NVGTGLVGAPACGDVM+LQIQVND+TG+IENV
Sbjct: 26  IQRRLYHPKVIDHYTHPRNVGSLDKKALNVGTGLVGAPACGDVMRLQIQVNDDTGIIENV 85

Query: 84  KFKTFGCGSAIASSSYMTELVRGKTLDVASQIKNTEIAKELSLPPVKLHCSMLAEDAIKA 143
           KFKTFGCGSAIASSSYMTE+V+G +++ A  IKNT+IAKELSLPPVKLHCSMLAEDAIKA
Sbjct: 86  KFKTFGCGSAIASSSYMTEMVKGMSVNDAFLIKNTQIAKELSLPPVKLHCSMLAEDAIKA 145

Query: 144 AIKDYRSKR 152
           AI DY+SKR
Sbjct: 146 AINDYKSKR 154

>CAGL0J04048g 381327..381764 highly similar to tr|Q12056
           Saccharomyces cerevisiae YOR226c ISU2 or tr|Q03020
           Saccharomyces cerevisiae YPL135w ISU1, hypothetical
           start
          Length = 145

 Score =  228 bits (580), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 119/131 (90%)

Query: 27  RAYHPKVIDHYTNPRNVGSLDKKLENVGTGLVGAPACGDVMKLQIQVNDETGVIENVKFK 86
           R YHPKVI+HYTNPRNVGS+DK L NVGTG+VGAPACGDV+KLQIQVND TGVIE  KFK
Sbjct: 14  RMYHPKVIEHYTNPRNVGSMDKTLRNVGTGVVGAPACGDVIKLQIQVNDNTGVIEEAKFK 73

Query: 87  TFGCGSAIASSSYMTELVRGKTLDVASQIKNTEIAKELSLPPVKLHCSMLAEDAIKAAIK 146
           TFGCGSAIASSSY+TELV+G T++ A +IKN EIAKELSLPPVKLHCSMLAEDAIKAA++
Sbjct: 74  TFGCGSAIASSSYLTELVQGITIEDAEKIKNIEIAKELSLPPVKLHCSMLAEDAIKAAVR 133

Query: 147 DYRSKRKATVL 157
           DY++KR +T L
Sbjct: 134 DYKTKRSSTTL 144

>YNL169C (PSD1) [4427] chr14 complement(316169..317671)
           Phosphatidylserine decarboxylase, mitochondrial isozyme,
           converts phosphatidyl-L-serine to
           phosphatidylethanolamine [1503 bp, 500 aa]
          Length = 500

 Score = 32.0 bits (71), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 38/70 (54%), Gaps = 2/70 (2%)

Query: 54  GTGLVGAPACGDVMKLQIQVNDETGVIENVKFKTFGCGSAIASSSYMTELVRGKTLDVAS 113
           G  ++ +P+ G ++++ I +N ETG IE VK  T+     + + S+        +LD+ S
Sbjct: 201 GEDVIASPSDGKILQVGI-INSETGEIEQVKGMTYSIKEFLGTHSHPLMSKSASSLDLTS 259

Query: 114 -QIKNTEIAK 122
            + K+ E A+
Sbjct: 260 DEEKHREFAR 269

>YOL076W (MDM20) [4744] chr15 (187023..189413) Protein required for
           transport of mitochondria into growing buds and for
           organization of actin cables, interacts genetically with
           Cin8p [2391 bp, 796 aa]
          Length = 796

 Score = 31.2 bits (69), Expect = 0.37,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 2/62 (3%)

Query: 94  IASSSYMTELVRGKTLDVASQIKNTEIAKEL--SLPPVKLHCSMLAEDAIKAAIKDYRSK 151
           + S +Y+T++   KTLD   +IK+ EI K +  SL  ++  C  + +   KA ++ Y   
Sbjct: 701 MVSHTYLTKMATLKTLDSLKRIKDKEIQKLIKNSLKELRSCCDDVFKGYSKALVQAYEEL 760

Query: 152 RK 153
           +K
Sbjct: 761 KK 762

>Scas_707.36
          Length = 915

 Score = 30.4 bits (67), Expect = 0.63,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 43/83 (51%), Gaps = 13/83 (15%)

Query: 76  ETGVIENVKFKTFGC--GSAIASSSYMTELVRGKTLDVASQIKNTEIAKELSLPPVKL-- 131
           E  V E ++F TF     + I+  S++ E V  K  D+ +++     AK +S+P +K+  
Sbjct: 340 EKIVNEKLRFPTFETLQDNHISEISHIREFVHAK--DLLNKLLEKNPAKRISIPDIKVHP 397

Query: 132 -------HCSMLAEDAIKAAIKD 147
                  H  +L+ED +++ +K+
Sbjct: 398 FVCWDFKHTKLLSEDQLESKLKE 420

>Sklu_1641.1 YBL098W, Contig c1641 1163-2551
          Length = 462

 Score = 30.0 bits (66), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 31/160 (19%), Positives = 66/160 (41%), Gaps = 28/160 (17%)

Query: 12  VAARGGMGSMASVA--RRAYHPKVIDHYTNPRNVGSLDKKLENVGTGL------------ 57
           V   G +G +AS+A  +R Y   + D+  +PR   + D+ L ++   +            
Sbjct: 7   VVGAGLVGCLASIALAKRGYQVSLFDYREDPRKASTTDRNLRSINLAISDRGITSLKYID 66

Query: 58  --VGAPACGDVMKLQIQ-VNDETGVIENVKFKTFG-CGSAIASSSYMTELVRGKTLDVAS 113
             +G     D++ ++ + ++D  G  E+  +  FG C ++I  +     ++    L    
Sbjct: 67  EEIGERVLKDIIPMKGRMIHDLQGNQESQIYGLFGECINSIDRA-----VLNNSLLGEVD 121

Query: 114 QIKNTEIAKELSLPPVKLH-----CSMLAEDAIKAAIKDY 148
           ++KN ++     L  +K       C    ED ++    D+
Sbjct: 122 KLKNVQVEYAHKLVRIKFSDSVQTCLFSTEDGVRELGFDF 161

>Sklu_1724.1 YLR148W, Contig c1724 365-3091 reverse complement
          Length = 908

 Score = 29.6 bits (65), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 11/41 (26%), Positives = 23/41 (56%)

Query: 79  VIENVKFKTFGCGSAIASSSYMTELVRGKTLDVASQIKNTE 119
           V++  KF  F CG +  +   + E++R    ++ S+I+N +
Sbjct: 818 VLQTRKFYVFPCGHSFHTDCLIKEILRSTDFNLKSKIENFQ 858

>CAGL0J06226g 587164..588690 highly similar to sp|P39006
           Saccharomyces cerevisiae YNL169c PSD1, start by
           similarity
          Length = 508

 Score = 28.5 bits (62), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 37/70 (52%), Gaps = 2/70 (2%)

Query: 54  GTGLVGAPACGDVMKLQIQVNDETGVIENVKFKTFGCGSAIASSSYMTELVRGKTLDVA- 112
           G  ++  P+ G V+++ I +N ETG +E VK  T+     + + S+        TLD++ 
Sbjct: 204 GDEVIVCPSDGKVLQIGI-INSETGEVEQVKGLTYSIKEFLGTHSHPLLCKSESTLDLSG 262

Query: 113 SQIKNTEIAK 122
            + ++ E A+
Sbjct: 263 HEERHQEFAR 272

>AAR167C [355] [Homologous to ScYBR221C (PDB1) - SH]
           (642620..643699) [1080 bp, 359 aa]
          Length = 359

 Score = 28.1 bits (61), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 41/98 (41%), Gaps = 4/98 (4%)

Query: 53  VGTGLVGAPACGDVMKLQIQVNDETGVIENVKFKTFGCGSAIASSSYMTELVRGKTLDVA 112
           VG  L G     + M     +     V+ N   KT+     + +   +     G  + VA
Sbjct: 96  VGAALKGLKPIVEFMSFNFSMQAIDHVV-NSAAKTYYMSGGVQTCQIVFRGPNGAAVGVA 154

Query: 113 SQIKNTEIAKELSLPPVKLHCSMLAEDA---IKAAIKD 147
           +Q      A   S+P +K+ C   AEDA   +KAAI+D
Sbjct: 155 AQHSQDYTAWYGSIPGLKVLCPYSAEDARGLLKAAIRD 192

>Scas_625.4
          Length = 761

 Score = 27.7 bits (60), Expect = 4.6,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 23/36 (63%), Gaps = 4/36 (11%)

Query: 52  NVGTGLVGAPACGDVMKLQIQVNDETGVIENVKFKT 87
           ++ +GL+ +P CG    +++Q ND +GV   +K KT
Sbjct: 368 SIQSGLLYSPDCG----VELQFNDASGVRYELKVKT 399

>Scas_657.3
          Length = 856

 Score = 27.3 bits (59), Expect = 7.0,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 5/49 (10%)

Query: 37  YTNPRNVGSLDKKLENVGTGLVGAPACGDVMKLQIQVNDETGVIENVKF 85
           YT P +VGS +       T ++ AP   D+M      + E+ ++E VK+
Sbjct: 87  YTGPHSVGSSNSSHGTESTTMMQAPPPNDLM-----YDSESELVERVKY 130

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.131    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,534,351
Number of extensions: 170498
Number of successful extensions: 445
Number of sequences better than 10.0: 24
Number of HSP's gapped: 445
Number of HSP's successfully gapped: 24
Length of query: 157
Length of database: 16,596,109
Length adjustment: 93
Effective length of query: 64
Effective length of database: 13,376,635
Effective search space: 856104640
Effective search space used: 856104640
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 57 (26.6 bits)