Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.867327627313250.0
Sklu_2012.22532486862e-90
ACR110W2522286166e-80
YOR223W2922865981e-76
KLLA0D07095g2462435662e-72
Scas_640.24*2892805598e-71
CAGL0J04092g3012925416e-68
Scas_716.33573201671.9
Sklu_2281.1879132662.5
Scas_449.163694644.2
Scas_693.22114550636.0
YKL201C (MNN4)117836618.8
AGR133C65362619.3
YOR180C (DCI1)27176609.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.8673
         (273 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.8673                                                          514   0.0  
Sklu_2012.2 YOR223W, Contig c2012 1288-2049                           268   2e-90
ACR110W [1157] [Homologous to ScYOR223W - SH] complement(548056....   241   6e-80
YOR223W (YOR223W) [5015] chr15 (759782..760660) Protein of unkno...   234   1e-76
KLLA0D07095g 608975..609715 similar to sgd|S0005749 Saccharomyce...   222   2e-72
Scas_640.24*                                                          219   8e-71
CAGL0J04092g complement(382821..383726) similar to tr|Q12015 Sac...   213   6e-68
Scas_716.33                                                            30   1.9  
Sklu_2281.1 YHR154W, Contig c2281 1332-3971                            30   2.5  
Scas_449.1                                                             29   4.2  
Scas_693.22                                                            29   6.0  
YKL201C (MNN4) [3073] chr11 complement(63931..67467) Protein req...    28   8.8  
AGR133C [4444] [Homologous to ScYER147C (SCC4) - SH] (1000583..1...    28   9.3  
YOR180C (DCI1) [4977] chr15 complement(674352..675167) Peroxisom...    28   9.9  

>Kwal_26.8673
          Length = 276

 Score =  514 bits (1325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/273 (93%), Positives = 255/273 (93%)

Query: 1   MSPFRIRACQSDGRKDKSDNSHNRMDQGGLASTSASGKLVVVRFSDEQLEDLPLNVSNVP 60
           MSPFRIRACQSDGRKDKSDNSHNRMDQGGLASTSASGKLVVVRFSDEQLEDLPLNVSNVP
Sbjct: 1   MSPFRIRACQSDGRKDKSDNSHNRMDQGGLASTSASGKLVVVRFSDEQLEDLPLNVSNVP 60

Query: 61  LNEINTRWLRRMCRQLRGRFTGNKRLRFIRNGRFLDINSDLQLQQYFEGSNDKFYVHCIV 120
           LNEINTRWLRRMCRQLRGRFTGNKRLRFIRNGRFLDINSDLQLQQYFEGSNDKFYVHCIV
Sbjct: 61  LNEINTRWLRRMCRQLRGRFTGNKRLRFIRNGRFLDINSDLQLQQYFEGSNDKFYVHCIV 120

Query: 121 GQELTPEELENEDVLDEAQQNTEGTTAQAIGFDRLRSVGFSEEEIELLRQRFRSTYGDLE 180
           GQELTPEELENEDVLDEAQQNTEGTTAQAIGFDRLRSVGFSEEEIELLRQRFRSTYGDLE
Sbjct: 121 GQELTPEELENEDVLDEAQQNTEGTTAQAIGFDRLRSVGFSEEEIELLRQRFRSTYGDLE 180

Query: 181 ELSRGNDEARDIRQLEEQWMETGANEENDQLGSVGIANYKHNTDXXXXXXXXXXXXXXXX 240
           ELSRGNDEARDIRQLEEQWMETGANEENDQLGSVGIANYKHNTD                
Sbjct: 181 ELSRGNDEARDIRQLEEQWMETGANEENDQLGSVGIANYKHNTDLLVGLVVGCVLGVFSL 240

Query: 241 XXMKQDGLFNKRQKMAMVGGLLMNLCFGLTLGF 273
             MKQDGLFNKRQKMAMVGGLLMNLCFGLTLGF
Sbjct: 241 LLMKQDGLFNKRQKMAMVGGLLMNLCFGLTLGF 273

>Sklu_2012.2 YOR223W, Contig c2012 1288-2049
          Length = 253

 Score =  268 bits (686), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 142/248 (57%), Positives = 178/248 (71%), Gaps = 5/248 (2%)

Query: 30  LASTSASGKLVVVRFSDEQLEDLPLNVSNVPLNEINTRWLRRMCRQLRGRFTGNKRLRFI 89
           + S+  S   +VVRFSD  + DL L++SN+P + INT WLRRMCRQLR   T NKRL+FI
Sbjct: 7   IPSSQQSQLSIVVRFSDVAIHDLTLDISNLPWDSINTNWLRRMCRQLRKEATTNKRLKFI 66

Query: 90  RNGRFLDINSDL--QLQQYFE--GSNDKFYVHCIVGQELTPEELENEDVLDEAQQNTEGT 145
           R+GR L+ N++   +LQQ+F+    N K+YVHCIVGQ+LT EEL NEDVLD+   + EGT
Sbjct: 67  RSGRPLNSNTNFASELQQFFQQDTENTKYYVHCIVGQDLTEEELANEDVLDDIGPSNEGT 126

Query: 146 TAQAIGFDRLRSVGFSEEEIELLRQRFRSTYGDLEELSRGNDEARDIRQLEEQWMETGAN 205
           T QA+GFDRLRSVGFS+EEIELLR++FRSTYGDLE + + +   RDIRQLEEQWME+G +
Sbjct: 127 TTQAVGFDRLRSVGFSDEEIELLREQFRSTYGDLENVVQESQGGRDIRQLEEQWMESGVS 186

Query: 206 EENDQLGSVGIANYKHNTDXXXXXXXXXXXXXXXXXXMKQDGLFNKRQKMAMVGGLLMNL 265
           +E DQ  SV IA+YK N D                  +KQ+GLF+KRQKMA+V GLL+NL
Sbjct: 187 DE-DQFNSVPIADYKRNRDLLIGLIIGCLLGIFSLLLLKQEGLFSKRQKMAVVAGLLVNL 245

Query: 266 CFGLTLGF 273
            FGL   F
Sbjct: 246 FFGLIRQF 253

>ACR110W [1157] [Homologous to ScYOR223W - SH]
           complement(548056..548814) [759 bp, 252 aa]
          Length = 252

 Score =  241 bits (616), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 119/228 (52%), Positives = 158/228 (69%), Gaps = 2/228 (0%)

Query: 45  SDEQLEDLPLNVSNVPLNEINTRWLRRMCRQLRGRFTGNKRLRFIRNGRFLDINSDLQLQ 104
           SD  L+DL L VS++P  ++ TRWLR M RQ+R   T   RL+FIRNG+ L+  S+L+L+
Sbjct: 23  SDPTLQDLTLEVSSIPYADVTTRWLRAMVRQIRPAKTVRHRLKFIRNGQPLNAMSNLRLE 82

Query: 105 QYFEGS--NDKFYVHCIVGQELTPEELENEDVLDEAQQNTEGTTAQAIGFDRLRSVGFSE 162
           Q+FE +  NDK+Y+HCIVG ELT E+L++ED LD   Q  +GTT + IGFDRLRSVGFS+
Sbjct: 83  QFFESAEENDKYYIHCIVGPELTTEQLQDEDALDNVGQQVDGTTPEVIGFDRLRSVGFSD 142

Query: 163 EEIELLRQRFRSTYGDLEELSRGNDEARDIRQLEEQWMETGANEENDQLGSVGIANYKHN 222
           EEIELLRQ+FR+TYGDL+   + + E  D+RQLEEQW+ETGA E+  QL S+  ANY++N
Sbjct: 143 EEIELLRQQFRATYGDLDTSQQPDGERADLRQLEEQWIETGATEQGAQLSSIPTANYRYN 202

Query: 223 TDXXXXXXXXXXXXXXXXXXMKQDGLFNKRQKMAMVGGLLMNLCFGLT 270
            D                  +KQ  LF KRQKMA+  G++ N+ FG+T
Sbjct: 203 MDLLIGLMVGCLFGVFSILLLKQGELFTKRQKMAVFAGIVANVIFGMT 250

>YOR223W (YOR223W) [5015] chr15 (759782..760660) Protein of unknown
           function, has low similarity to uncharacterized C.
           albicans Orf6.1950p [879 bp, 292 aa]
          Length = 292

 Score =  234 bits (598), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 136/286 (47%), Positives = 174/286 (60%), Gaps = 35/286 (12%)

Query: 21  SHNRMDQGGLASTSASGKLVVVRFSDEQLEDLPLNVSNVPLNEINTRWLRRMCRQLRGRF 80
           +HN   QGG    S   K +V+RFSD  + DL LN+SNVP + INT WLRRMCR+LR + 
Sbjct: 9   THNG-SQGG-EVRSPDQKFIVIRFSDVSVRDLQLNISNVPFSNINTHWLRRMCRELRPQQ 66

Query: 81  TGNKRLRFIRNGRFLDINSDL--QLQQYFEGSNDK--------------FYVHCIVG-QE 123
           T  +RL+FIRNG  L+ +S +  +L  YF+ +N+               +Y+HCI+G +E
Sbjct: 67  TQKRRLKFIRNGSILNTHSKIAEELTHYFDTANNSNVATGTSVAPEQNNYYIHCIIGTEE 126

Query: 124 LTPEELENEDVLDEAQQNTEGTTAQAIGFDRLRSVGFSEEEIELLRQRFRSTYGDLEE-- 181
           LT  EL NED+ D+A  + +  T QAIGFDRLRSVGF+E+EIELLRQ+FR+TYGDLEE  
Sbjct: 127 LTQAELANEDLKDDATPSNDSMTTQAIGFDRLRSVGFTEQEIELLRQQFRATYGDLEEEE 186

Query: 182 ---LSRGN--DEARDIRQLEEQWMETGA---------NEENDQLGSVGIANYKHNTDXXX 227
                 GN  DE  DIRQLEEQWME+G+             D+  SV IAN KHN D   
Sbjct: 187 ERLAQNGNRDDEGHDIRQLEEQWMESGSGTAQGNGAGGGNEDRFNSVPIANIKHNKDLLL 246

Query: 228 XXXXXXXXXXXXXXXMKQDGLFNKRQKMAMVGGLLMNLCFGLTLGF 273
                          MK DGLFN+RQKMA+  G+++N+ F L  GF
Sbjct: 247 GICVGFFFGVFGILLMKFDGLFNRRQKMAIFAGVIVNVMFCLVRGF 292

>KLLA0D07095g 608975..609715 similar to sgd|S0005749 Saccharomyces
           cerevisiae YOR223w hypothetical protein, start by
           similarity
          Length = 246

 Score =  222 bits (566), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 120/243 (49%), Positives = 162/243 (66%), Gaps = 5/243 (2%)

Query: 30  LASTSASGKLVVVRFSDEQLEDLPLNVSNVPLNEINTRWLRRMCRQLRGRFTGNKRLRFI 89
           L+ T    K VV+RF+++ + DL L+++N+    + T WLRRMCRQL+   T  KRLRFI
Sbjct: 3   LSETGHGRKAVVIRFANDTIADLQLDITNIDPTLVTTSWLRRMCRQLKPTETRGKRLRFI 62

Query: 90  RNGRFLDINSDLQLQQYFEGSN-DKFYVHCIVGQELTPEELENEDVLDEAQQNT-EGTTA 147
           +NGR L+ +SDL ++ + +  N  + Y+H I+G  LT EEL NED LD+   NT E  T 
Sbjct: 63  KNGRPLNSHSDLGIESFKDNPNITEMYIHGIIGAGLTAEELINEDNLDDDFSNTNENGTT 122

Query: 148 QAIGFDRLRSVGFSEEEIELLRQRFRSTYGDLEELSRGNDEARDIRQLEEQWMETGANE- 206
           QAIGFDRLRSVGFSE+EI+LLRQ+F +TYGDLE +   N + RDIRQLEEQWMETG N+ 
Sbjct: 123 QAIGFDRLRSVGFSEQEIDLLRQQFLATYGDLETMP--NQQQRDIRQLEEQWMETGVNDP 180

Query: 207 ENDQLGSVGIANYKHNTDXXXXXXXXXXXXXXXXXXMKQDGLFNKRQKMAMVGGLLMNLC 266
           +  Q  S+GIAN+K N D                  +KQ GLF++RQKM++V GL+ N+ 
Sbjct: 181 QGQQFNSIGIANWKSNMDLLIGLSIGSLLGVFSLLLLKQQGLFSQRQKMSIVAGLIFNIA 240

Query: 267 FGL 269
           + +
Sbjct: 241 WWI 243

>Scas_640.24*
          Length = 289

 Score =  219 bits (559), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 127/280 (45%), Positives = 163/280 (58%), Gaps = 40/280 (14%)

Query: 34  SASGKLVVVRFSDEQLEDLPLNVSNVPLNEINTRWLRRMCRQLRGRFTGNKRLRFIRNGR 93
           + + K +V+RFSD  + DL +N++ VP++ INT WLR+MCR LR R T + RL+FIR+G 
Sbjct: 10  TPTQKFIVIRFSDVTIADLQINITQVPISNINTHWLRQMCRDLRPRETQSHRLKFIRSGA 69

Query: 94  FLDINSDL--QLQQYFEGSN--------------DKFYVHCIVGQELTPE-ELENEDVLD 136
            L+  S L  Q+Q YF  S               +KFY+HCI+G +L  E EL  ED +D
Sbjct: 70  LLNSRSSLALQIQDYFRTSASDHTPQQEEEEEEANKFYIHCIIGSDLLSEDELAREDAMD 129

Query: 137 EAQQNTEGTTAQAIGFDRLRSVGFSEEEIELLRQRFRSTYGDLEELSRGNDE-------- 188
           +   N EG T QAIGFDRLR+VGFSE EIELLRQ+FRSTYGDLEE  +GNDE        
Sbjct: 130 DLGPNEEGRTTQAIGFDRLRAVGFSEREIELLRQQFRSTYGDLEERLQGNDEFEEEGNNN 189

Query: 189 -ARDIRQLEEQWM---ETGANE-----------ENDQLGSVGIANYKHNTDXXXXXXXXX 233
              DIRQLEEQWM    T  +E           ++D+  S+ I N KHN D         
Sbjct: 190 STTDIRQLEEQWMGKWWTWTHEMKMGWLIIMSFDDDRFNSIPITNLKHNKDLLIGIFIGF 249

Query: 234 XXXXXXXXXMKQDGLFNKRQKMAMVGGLLMNLCFGLTLGF 273
                    M  DGL NKRQ+M+M  G+++N+ F L  GF
Sbjct: 250 CFGIFAFILMNIDGLLNKRQRMSMFAGIIVNILFCLFRGF 289

>CAGL0J04092g complement(382821..383726) similar to tr|Q12015
           Saccharomyces cerevisiae YOR223w, hypothetical start
          Length = 301

 Score =  213 bits (541), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 126/292 (43%), Positives = 172/292 (58%), Gaps = 50/292 (17%)

Query: 26  DQGGLASTSASGKLVVVRFSDEQLEDLPLNVSNVPLNEINTRWLRRMCRQLRGRFTGNKR 85
           D GG++      + +VVRF+D+ + DL LN+++V ++ INT+WLRR+CR+LRG  T  +R
Sbjct: 16  DNGGIS------RFIVVRFNDDTIPDLKLNITHVSMDTINTQWLRRLCRELRGEQTHRRR 69

Query: 86  LRFIRNGRFLDINSDL--QLQQYFE--------GSNDK--FYVHCIVGQE-LTPEELENE 132
           LRFIRNG  L+  ++L  ++ QYFE        G+ ++  FYVHCI+G E LT E+L +E
Sbjct: 70  LRFIRNGNILNSRANLGSEILQYFERLQAENTEGTLNELLFYVHCIIGTEDLTDEQLASE 129

Query: 133 DVLDEAQQNTEGTTAQAIGFDRLRSVGFSEEEIELLRQRFRSTYGDLEEL---------- 182
           DV+D    + +  T QAIGFDRL SVGFSEEEIELLRQ+FRSTYGD EE           
Sbjct: 130 DVMDTMGPSADSVTTQAIGFDRLASVGFSEEEIELLRQQFRSTYGDPEEEDDLLNGDESQ 189

Query: 183 ----SRGNDEARDIRQLEEQWMETGAN-----------------EENDQLGSVGIANYKH 221
               SRG +  RDIRQLEE WME+G +                 E  D+  S+ + + +H
Sbjct: 190 SNIGSRGGNARRDIRQLEEMWMESGNDPMATAGDGLQPGRDRNGEVEDRFNSIPVTDIRH 249

Query: 222 NTDXXXXXXXXXXXXXXXXXXMKQDGLFNKRQKMAMVGGLLMNLCFGLTLGF 273
           N D                  MK +GLFNKRQ+M+++ G+  N+ F L  GF
Sbjct: 250 NKDLLIGITTGFCLGIFALLLMKNEGLFNKRQRMSIIVGVATNVLFCLVRGF 301

>Scas_716.33
          Length = 573

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 87/201 (43%), Gaps = 41/201 (20%)

Query: 17  KSDNSHNRMDQGGLASTSASGKLVVVRFSDEQLEDLPLNVSNVPLNEINTRWLRRMCRQL 76
           K + +++ + +  + +T+ S  LV + ++ +  ++L L +  VP  +  T  +       
Sbjct: 216 KLNETNHVLTERDILTTTRSQWLVKLLYAFQDTQNLYLAMEFVPGGDFRTLLIN------ 269

Query: 77  RGRFTGNKRLRFIRNGRFLDINSDLQLQQYFEGSNDKFYVHCIVGQELTPEELENEDVLD 136
             RF  +   RF  +  FL +N+           +D  Y H          +L+ E+ L 
Sbjct: 270 -TRFLKSTHARFYISEMFLAVNA----------LHDLGYTH---------RDLKPENFLI 309

Query: 137 EAQQNTE----GTTAQAIGFDRLRSVGFSEEEIELLRQRFRSTYGDLEELSRGNDEARDI 192
           +A+ + +    G  A  I  DR++S+    EE++ L         +  E S  + E R  
Sbjct: 310 DAKGHIKLTDFGLAAGTISNDRIQSMKVRLEEVKNL---------EFPEFSDKSIEDR-- 358

Query: 193 RQLEEQWMETGANEENDQLGS 213
           RQ+ +++ ET  N  N  +GS
Sbjct: 359 RQMYQKYRETEVNYANSMVGS 379

>Sklu_2281.1 YHR154W, Contig c2281 1332-3971
          Length = 879

 Score = 30.0 bits (66), Expect = 2.5,   Method: Composition-based stats.
 Identities = 32/132 (24%), Positives = 54/132 (40%), Gaps = 15/132 (11%)

Query: 64  INTRWLRRMCRQLRGRFTGNKRLRFIR-NGRFLDINSDLQLQQYFEGSNDKFYVHCIVGQ 122
           +N  WL    +  +   T   R R I   G   ++   L L+ Y E +          G+
Sbjct: 406 VNHLWLEECYKFAKKLDTDTTRYREIPVRGGLKNVLGQLSLEDYEENT----------GK 455

Query: 123 ELTPEELENEDVLDEAQQNTEGTTAQAIGFDRLRSVGFSEEEIELLRQRFRSTYGDLEEL 182
           +   EE E    + + Q+N +  T+ A+     + V  SE+E+    Q   S+ G L E 
Sbjct: 456 QELHEEKEQLSTITDTQENFDTVTSNAVSDMEKKEVAISEKEV----QSGISSVGHLFEG 511

Query: 183 SRGNDEARDIRQ 194
              N+++R   Q
Sbjct: 512 LSDNEQSRSEDQ 523

>Scas_449.1
          Length = 636

 Score = 29.3 bits (64), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 38/94 (40%), Gaps = 18/94 (19%)

Query: 87  RFIRNGRFLDINSDLQLQQYFEGSNDKF-----------YVHCIVGQELTPEELENEDVL 135
           +F+  G F+ ++ +  L  +F  S + +           Y  C VG  LTPE  +  ++ 
Sbjct: 208 KFLYPGHFIFVHRESFLYGFFNHSENNYKDSHYCSEELIYAMCAVGSRLTPELQDMSEIY 267

Query: 136 DEAQQNT-------EGTTAQAIGFDRLRSVGFSE 162
            E  ++T       E + A+      L  + F E
Sbjct: 268 YEKSKSTLLELVFDENSVAKITTVQALLCLAFYE 301

>Scas_693.22
          Length = 1145

 Score = 28.9 bits (63), Expect = 6.0,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 5/50 (10%)

Query: 119 IVGQELTPEELENEDVLDEAQQNTEGTTAQAIGFDRLRSVGFSEEEIELL 168
           ++G++++ E+LE E+   E   N E   A  I FD L S+G SE + ELL
Sbjct: 540 LLGEDVSIEDLEGEE---EPLLNFE--IADHIDFDNLSSLGSSEVDSELL 584

>YKL201C (MNN4) [3073] chr11 complement(63931..67467) Protein
           required for transfer of mannosylphosphate to core and
           outer chain portions of N-linked oligosaccharides [3537
           bp, 1178 aa]
          Length = 1178

 Score = 28.1 bits (61), Expect = 8.8,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 25/36 (69%)

Query: 25  MDQGGLASTSASGKLVVVRFSDEQLEDLPLNVSNVP 60
           +D  GLASTSA  +  +  + +E+L++  L+++N+P
Sbjct: 585 IDITGLASTSAPSRDYLNSYIEERLQEEHLDINNIP 620

>AGR133C [4444] [Homologous to ScYER147C (SCC4) - SH]
           (1000583..1002544) [1962 bp, 653 aa]
          Length = 653

 Score = 28.1 bits (61), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 27/62 (43%)

Query: 148 QAIGFDRLRSVGFSEEEIELLRQRFRSTYGDLEELSRGNDEARDIRQLEEQWMETGANEE 207
            A+ F  L  V  ++E+   LRQ  R T G LEEL+  +  A   R      +E G    
Sbjct: 142 HAVEFQLLYDVPLAKEDRAELRQVVRHTTGLLEELADSDAWAWLFRYCRIIGLEAGGARS 201

Query: 208 ND 209
           N 
Sbjct: 202 NS 203

>YOR180C (DCI1) [4977] chr15 complement(674352..675167) Peroxisomal
           dienoyl-CoA isomerase [816 bp, 271 aa]
          Length = 271

 Score = 27.7 bits (60), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 123 ELTPEELENEDVLDEAQQNTEGTTAQAI-GFDRLRSVGFSEEEIELLRQRFRSTYGDLEE 181
           +LT  E  NE VL + +QN EG   +++ G   L     SE + +L++ +   T G L  
Sbjct: 193 QLTNTETFNEKVLQDIKQNLEGLYPKSVLGMKELLH---SEMKQKLIKAQAMETNGTLPF 249

Query: 182 LSRGNDEARDIRQLEE 197
            + G    R  +QL+E
Sbjct: 250 WASGEPFKR-FKQLQE 264

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,810,302
Number of extensions: 386806
Number of successful extensions: 1318
Number of sequences better than 10.0: 30
Number of HSP's gapped: 1292
Number of HSP's successfully gapped: 30
Length of query: 273
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 173
Effective length of database: 13,134,309
Effective search space: 2272235457
Effective search space used: 2272235457
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)