Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.866929629315400.0
KLLA0D07073g29729313110.0
ACR109W29929212541e-176
Scas_640.2530629110751e-148
YOR222W (ODC2)30729910661e-147
YPL134C (ODC1)31030110431e-143
CAGL0J04114g30329610271e-141
Scas_589.103163018011e-107
YPR021C (AGC1)9022854107e-45
ADL049W9122903931e-42
Sklu_2359.69022943852e-41
Scas_602.88852903632e-38
Kwal_47.173218812903622e-38
CAGL0K02365g9192843542e-37
Sklu_2334.23192993359e-37
KLLA0E13453g9062893491e-36
Scas_691.43343213175e-34
AGL311C3622863116e-33
YJR095W (SFC1)3223063071e-32
Kwal_47.182163333142888e-30
Kwal_33.154463052812869e-30
CAGL0M09020g3483182889e-30
Sklu_2398.43092882744e-28
Scas_718.53242852702e-27
Scas_667.223062892588e-26
Sklu_1275.13112962571e-25
Sklu_2075.33452702581e-25
KLLA0F03212g3052852543e-25
KLLA0E09680g3072712543e-25
Kwal_23.43543433332545e-25
CAGL0K12210g3112922535e-25
CAGL0B03883g3062822525e-25
Sklu_1926.23052882501e-24
YBR104W (YMC2)3293052511e-24
CAGL0D01606g3052922483e-24
YEL006W3353002493e-24
YPR058W (YMC1)3072882465e-24
Scas_709.93652972478e-24
AER184W3052932431e-23
Scas_582.73292962432e-23
KLLA0F17864g3072962412e-23
YIL006W3732952433e-23
Kwal_56.230113033002361e-22
CAGL0L02079g2973052351e-22
KLLA0B12826g3192882352e-22
Kwal_55.208683802972372e-22
Sklu_2127.52782782332e-22
CAGL0J02002g3612952345e-22
AFR131C3443192335e-22
Kwal_26.76533252022317e-22
CAGL0J01661g3273062301e-21
KLLA0E02772g2842902281e-21
YJL133W (MRS3)3142942272e-21
Kwal_55.213353172772272e-21
Scas_632.92922792262e-21
KLLA0B08503g3032742253e-21
CAGL0K08250g2972832253e-21
YNL003C (PET8)2842872244e-21
Kwal_27.125993042892245e-21
Scas_489.42973012236e-21
YBR291C (CTP1)2992952221e-20
KLLA0E18810g3772872241e-20
KLLA0A09383g3662652241e-20
YBL030C (PET9)3182852212e-20
AFR146W2812762192e-20
YOR130C (ORT1)2922822192e-20
CAGL0F04213g3062852193e-20
Sklu_2363.23233022193e-20
Kwal_27.124813042942184e-20
ADL009W3792972204e-20
Sklu_1149.22962962174e-20
Kwal_33.129883032912184e-20
Kwal_26.79672972962175e-20
KLLA0E12353g3052922175e-20
CAGL0F08305g3742592196e-20
Kwal_14.22103153002151e-19
YBR085W (AAC3)3072942141e-19
Kwal_33.140503142852132e-19
KLLA0D15015g3172972122e-19
Sklu_2430.103242772114e-19
Scas_718.243372942114e-19
Scas_667.43082872105e-19
Sklu_2431.53703032117e-19
Scas_645.93912572118e-19
CAGL0F00231g3072702088e-19
KLLA0E23705g3683022109e-19
Scas_669.63732922109e-19
Scas_379.23012922052e-18
YKL120W (OAC1)3242882053e-18
CAGL0L05742g3052802043e-18
YPR011C3263052053e-18
YGR257C (MTM1)3662542063e-18
CAGL0K11616g3202862035e-18
KLLA0D14036g4313232057e-18
YMR056C (AAC1)3092662001e-17
Scas_715.453052591992e-17
CAGL0F07711g3682442002e-17
Sklu_1119.13072461982e-17
Sklu_2432.52882861972e-17
ACR260W3112861964e-17
AFL196W3612911975e-17
YJR077C (MIR1)3112391955e-17
YMR166C3683151976e-17
CAGL0K10362g3012921947e-17
CAGL0H03839g2822981938e-17
YGR096W (TPC1)3142701931e-16
CAGL0J09790g3002751921e-16
Scas_721.1293232121922e-16
KLLA0D09889g3642801932e-16
YLR348C (DIC1)2982771912e-16
AEL253W3652971922e-16
Sklu_2117.22982771902e-16
Kwal_23.35293952791922e-16
Kwal_33.155973052691893e-16
Scas_721.273743071913e-16
Scas_673.173142471894e-16
YKR052C (MRS4)3042951884e-16
Sklu_2260.53022961877e-16
Scas_714.183053001868e-16
Kwal_27.120813693011889e-16
YDL198C (YHM1)3002751851e-15
ADL264C3292761852e-15
Sklu_2442.82752971813e-15
Scas_558.22892931804e-15
KLLA0E15532g3263001807e-15
Kwal_23.47313143011798e-15
Scas_562.123002781798e-15
Kwal_23.39653073001799e-15
CAGL0G01166g2952831752e-14
AGL047C3162961753e-14
Sklu_2115.42992771744e-14
AER450C3082711735e-14
KLLA0F13464g3002761735e-14
Scas_702.103022881726e-14
AGL065C3353071736e-14
Sklu_2037.23103001727e-14
AAL014C2712951708e-14
Scas_697.473282851701e-13
KLLA0B14454g3052211682e-13
CAGL0B04543g3173051682e-13
Kwal_0.2322742921663e-13
CAGL0H10538g2972971673e-13
Kwal_26.79723583101683e-13
Kwal_23.57573072581664e-13
AGR191W2982801664e-13
CAGL0M05225g3813081657e-13
Scas_662.123082981648e-13
YBR192W (RIM2)3773101631e-12
KLLA0D04950g2742971574e-12
Kwal_23.29133202951585e-12
Kwal_27.116262992761569e-12
YIL134W (FLX1)3113211561e-11
ABL023W3092791551e-11
YOR100C (CRC1)3272841551e-11
Scas_716.293162991542e-11
AER366W2932851532e-11
YER053C3002581532e-11
AGL064W2962741513e-11
YPR128C (ANT1)3282841523e-11
CAGL0G08910g2892991471e-10
CAGL0K02915g3423111471e-10
CAGL0G03135g3072921462e-10
CAGL0J05522g5191871472e-10
CAGL0D04774g3222861462e-10
KLLA0C13431g3282851453e-10
YHR002W (LEU5)3573141436e-10
KLLA0E18788g3813131427e-10
KLLA0F04697g3073001401e-09
Kwal_27.114192982931382e-09
AFR147C3152431372e-09
KLLA0A00979g3433461364e-09
AGR383W2932741338e-09
CAGL0C02013g3293141338e-09
KLLA0D04290g1881821262e-08
YDL119C3072851302e-08
Scas_717.203563141293e-08
AER419W4931741285e-08
AFR542W3102781241e-07
Scas_613.241771701192e-07
YNL083W5451861232e-07
Scas_328.1227691202e-07
AAR036W3172991203e-07
KLLA0C11363g5171831214e-07
KLLA0E08877g2941891204e-07
Kwal_47.19228281751195e-07
Kwal_23.30425421861205e-07
Sklu_2127.43231531196e-07
Scas_687.15*3283311187e-07
Scas_578.3*5243071171e-06
Kwal_55.213383231401161e-06
KLLA0E02750g3042591151e-06
KLLA0D04312g103831082e-06
Kwal_55.211063282891152e-06
Sklu_2433.8420791133e-06
YFR045W2852991114e-06
Sklu_2374.7513851126e-06
Scas_705.93232951091e-05
AFR253W344971062e-05
ADR036C3401491063e-05
KLLA0F08547g3083091001e-04
YMR241W (YHM2)314301983e-04
Sklu_2194.3312291983e-04
Kwal_34.15907312266973e-04
Sklu_2435.2344308973e-04
Scas_696.9312288947e-04
CAGL0K07436g307308890.003
KLLA0B11319g355319880.004
Sklu_1809.266870691.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.8669
         (293 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.8669                                                          597   0.0  
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...   509   0.0  
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...   487   e-176
Scas_640.25                                                           418   e-148
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...   415   e-147
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...   406   e-143
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...   400   e-141
Scas_589.10                                                           313   e-107
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...   162   7e-45
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....   155   1e-42
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                         152   2e-41
Scas_602.8                                                            144   2e-38
Kwal_47.17321                                                         144   2e-38
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...   140   2e-37
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement        133   9e-37
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...   139   1e-36
Scas_691.4                                                            126   5e-34
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...   124   6e-33
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...   122   1e-32
Kwal_47.18216                                                         115   8e-30
Kwal_33.15446                                                         114   9e-30
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...   115   9e-30
Sklu_2398.4 , Contig c2398 9476-10405                                 110   4e-28
Scas_718.5                                                            108   2e-27
Scas_667.22                                                           103   8e-26
Sklu_1275.1 , Contig c1275 314-1249                                   103   1e-25
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement               103   1e-25
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...   102   3e-25
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...   102   3e-25
Kwal_23.4354                                                          102   5e-25
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...   102   5e-25
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...   101   5e-25
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement         100   1e-24
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...   101   1e-24
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...   100   3e-24
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...   100   3e-24
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...    99   5e-24
Scas_709.9                                                            100   8e-24
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    98   1e-23
Scas_582.7                                                             98   2e-23
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...    97   2e-23
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    98   3e-23
Kwal_56.23011                                                          96   1e-22
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    95   1e-22
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    95   2e-22
Kwal_55.20868                                                          96   2e-22
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement         94   2e-22
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    95   5e-22
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    94   5e-22
Kwal_26.7653                                                           94   7e-22
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    93   1e-21
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    92   1e-21
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    92   2e-21
Kwal_55.21335                                                          92   2e-21
Scas_632.9                                                             92   2e-21
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...    91   3e-21
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    91   3e-21
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    91   4e-21
Kwal_27.12599                                                          91   5e-21
Scas_489.4                                                             91   6e-21
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    90   1e-20
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    91   1e-20
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    91   1e-20
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    90   2e-20
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    89   2e-20
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    89   2e-20
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    89   3e-20
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          89   3e-20
Kwal_27.12481                                                          89   4e-20
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    89   4e-20
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         88   4e-20
Kwal_33.12988                                                          89   4e-20
Kwal_26.7967                                                           88   5e-20
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    88   5e-20
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    89   6e-20
Kwal_14.2210                                                           87   1e-19
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    87   1e-19
Kwal_33.14050                                                          87   2e-19
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    86   2e-19
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         86   4e-19
Scas_718.24                                                            86   4e-19
Scas_667.4                                                             86   5e-19
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            86   7e-19
Scas_645.9                                                             86   8e-19
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    85   8e-19
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    86   9e-19
Scas_669.6                                                             86   9e-19
Scas_379.2                                                             84   2e-18
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    84   3e-18
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    83   3e-18
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    84   3e-18
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    84   3e-18
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    83   5e-18
KLLA0D14036g complement(1203522..1204817) some similarities with...    84   7e-18
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    82   1e-17
Scas_715.45                                                            81   2e-17
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    82   2e-17
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             81   2e-17
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       80   2e-17
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    80   4e-17
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    80   5e-17
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    80   5e-17
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    80   6e-17
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    79   7e-17
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    79   8e-17
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    79   1e-16
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    79   1e-16
Scas_721.129                                                           79   2e-16
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    79   2e-16
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    78   2e-16
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    79   2e-16
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            78   2e-16
Kwal_23.3529                                                           79   2e-16
Kwal_33.15597                                                          77   3e-16
Scas_721.27                                                            78   3e-16
Scas_673.17                                                            77   4e-16
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    77   4e-16
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         77   7e-16
Scas_714.18                                                            76   8e-16
Kwal_27.12081                                                          77   9e-16
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    76   1e-15
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    76   2e-15
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          74   3e-15
Scas_558.2                                                             74   4e-15
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    74   7e-15
Kwal_23.4731                                                           74   8e-15
Scas_562.12                                                            74   8e-15
Kwal_23.3965                                                           74   9e-15
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    72   2e-14
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    72   3e-14
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            72   4e-14
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    71   5e-14
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    71   5e-14
Scas_702.10                                                            71   6e-14
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    71   6e-14
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         71   7e-14
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    70   8e-14
Scas_697.47                                                            70   1e-13
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    69   2e-13
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    69   2e-13
Kwal_0.232                                                             69   3e-13
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    69   3e-13
Kwal_26.7972                                                           69   3e-13
Kwal_23.5757                                                           69   4e-13
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    69   4e-13
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    68   7e-13
Scas_662.12                                                            68   8e-13
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    67   1e-12
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    65   4e-12
Kwal_23.2913                                                           65   5e-12
Kwal_27.11626                                                          65   9e-12
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    65   1e-11
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    64   1e-11
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    64   1e-11
Scas_716.29                                                            64   2e-11
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    64   2e-11
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    64   2e-11
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    63   3e-11
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    63   3e-11
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    61   1e-10
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    61   1e-10
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    61   2e-10
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    61   2e-10
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    61   2e-10
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    60   3e-10
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    60   6e-10
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    59   7e-10
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    59   1e-09
Kwal_27.11419                                                          58   2e-09
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    57   2e-09
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    57   4e-09
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    56   8e-09
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    56   8e-09
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    53   2e-08
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    55   2e-08
Scas_717.20                                                            54   3e-08
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    54   5e-08
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    52   1e-07
Scas_613.24                                                            50   2e-07
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    52   2e-07
Scas_328.1                                                             51   2e-07
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    51   3e-07
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    51   4e-07
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    51   4e-07
Kwal_47.19228                                                          50   5e-07
Kwal_23.3042                                                           51   5e-07
Sklu_2127.4 , Contig c2127 6322-7293                                   50   6e-07
Scas_687.15*                                                           50   7e-07
Scas_578.3*                                                            50   1e-06
Kwal_55.21338                                                          49   1e-06
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    49   1e-06
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    46   2e-06
Kwal_55.21106                                                          49   2e-06
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       48   3e-06
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    47   4e-06
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       48   6e-06
Scas_705.9                                                             47   1e-05
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    45   2e-05
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    45   3e-05
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    43   1e-04
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    42   3e-04
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            42   3e-04
Kwal_34.15907                                                          42   3e-04
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         42   3e-04
Scas_696.9                                                             41   7e-04
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    39   0.003
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    39   0.004
Sklu_1809.2 YDR194C, Contig c1809 1564-3570 reverse complement         31   1.1  

>Kwal_26.8669
          Length = 296

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/293 (100%), Positives = 293/293 (100%)

Query: 1   MTDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIV 60
           MTDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIV
Sbjct: 1   MTDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIV 60

Query: 61  AKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGC 120
           AKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGC
Sbjct: 61  AKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGC 120

Query: 121 CEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGY 180
           CEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGY
Sbjct: 121 CEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGY 180

Query: 181 FGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGAR 240
           FGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGAR
Sbjct: 181 FGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGAR 240

Query: 241 KYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRTL 293
           KYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRTL
Sbjct: 241 KYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRTL 293

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score =  509 bits (1311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/293 (81%), Positives = 267/293 (91%)

Query: 1   MTDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIV 60
           M+D +PLPF YQF AGAVAG+SEILVMYPLD+VKT MQLQVSGG GPQYKGV DC+KQI 
Sbjct: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIA 60

Query: 61  AKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGC 120
           AKEG SRLYKGISSP+LMEAPKRATKFACNDEFQKIYK  FG EKLTQ LSILSGASAG 
Sbjct: 61  AKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLSILSGASAGI 120

Query: 121 CEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGY 180
           CE+FVVVPFELVKIRLQDVSS +  PI VV+ I+ +EG+LAMYNGLEST+WRHG+WNAGY
Sbjct: 121 CESFVVVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGY 180

Query: 181 FGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGAR 240
           FGIIFQVRALLP+A +KS+QTRNDL+AG++GGT+ SL+STPFDVVKSR+QNTAV+ G  R
Sbjct: 181 FGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPR 240

Query: 241 KYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRTL 293
           KYNWSWP++ TIYKEEGF+ALYKGFVPKVLRLGPGGGILLVVFTG MDFFRT+
Sbjct: 241 KYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPGGGILLVVFTGVMDFFRTV 293

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score =  487 bits (1254), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 232/292 (79%), Positives = 258/292 (88%)

Query: 2   TDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVA 61
           +D + LPF YQF AGAVAG+SEILVMYPLDVVKTRMQLQV GG GP Y GVVDC+K+IVA
Sbjct: 4   SDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVA 63

Query: 62  KEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCC 121
            EG  RLYKGISSP+LMEAPKRATKFACNDEFQK+YK+ FGVEKL+Q LS+L+GASAGC 
Sbjct: 64  GEGVGRLYKGISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLSMLAGASAGCV 123

Query: 122 EAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYF 181
           EAFVVVPFELVKIRLQD SSSYKGP+DVVRKI+A+EGVLAMYNGLESTLWRH +WN GYF
Sbjct: 124 EAFVVVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYF 183

Query: 182 GIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARK 241
           GIIFQ RALLP A +K+Q   NDLI+ SIG +IG ++STPFDVVKSRIQNTAV+ G  RK
Sbjct: 184 GIIFQARALLPAAHNKTQCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRK 243

Query: 242 YNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRTL 293
           YNWS PS+ TIY+EEGFRALYKGFVPKVLRLGPGGGILLVVFTG +DF R +
Sbjct: 244 YNWSLPSLLTIYREEGFRALYKGFVPKVLRLGPGGGILLVVFTGVLDFCRAI 295

 Score = 33.5 bits (75), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 35/84 (41%), Gaps = 1/84 (1%)

Query: 191 LPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIF 250
           +  + +KS        AG++ G    L+  P DVVK+R+Q   V  G    Y      + 
Sbjct: 1   MSSSDTKSLPFLYQFFAGAVAGVSEILVMYPLDVVKTRMQ-LQVQGGAGPHYTGVVDCLK 59

Query: 251 TIYKEEGFRALYKGFVPKVLRLGP 274
            I   EG   LYKG    +L   P
Sbjct: 60  KIVAGEGVGRLYKGISSPILMEAP 83

>Scas_640.25
          Length = 306

 Score =  418 bits (1075), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 198/291 (68%), Positives = 237/291 (81%), Gaps = 5/291 (1%)

Query: 6   PLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVS----GGLGPQYKGVVDCIKQIVA 61
           PLPF YQF AGA+AGISE++VMYPLDVVKTRMQLQVS    G     YKGV+DC+ QIV 
Sbjct: 10  PLPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVK 69

Query: 62  KEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCC 121
           KEG   +YKGISSP+LMEAPKRA KFA NDEF K++K  FG ++LTQ +S+LSGASAG  
Sbjct: 70  KEGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLSGASAGIT 129

Query: 122 EAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYF 181
           EA V+VPFELVKIRLQDV+S +KGP++V++ II Q+G+  +Y+G+EST+WR+ VWNAGYF
Sbjct: 130 EALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYF 189

Query: 182 GIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTA-VVAGGAR 240
           G+IFQVR LLP AKSK ++TRNDL AG +GGT G + +TPFDVVKSRIQ+    +  G R
Sbjct: 190 GVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSDGNEIINGVR 249

Query: 241 KYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFR 291
           KYNW+WPS+  IY EEGFRALYKGFVPKVLRLGPGG +LLVVFT  M+ FR
Sbjct: 250 KYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNVFR 300

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score =  415 bits (1066), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 191/299 (63%), Positives = 242/299 (80%), Gaps = 7/299 (2%)

Query: 2   TDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVS----GGLGPQ---YKGVVD 54
           ++A+PLPF YQF +GAVAGISE+ VMYPLDVVKTR QL+V+      +G Q   Y GV+D
Sbjct: 5   SNAKPLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVID 64

Query: 55  CIKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILS 114
           C+K+IV KEG SRLY+GISSP+LMEAPKRATKFACND++QKI+K  F   + TQ +SI +
Sbjct: 65  CLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIAA 124

Query: 115 GASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHG 174
           GASAG  EA V+VPFEL+KIR+QDV SSY GP+D ++K I  EG++ +Y G+EST+WR+ 
Sbjct: 125 GASAGMTEAAVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNA 184

Query: 175 VWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAV 234
           +WN GYFG+I+QVR  +P AK+K Q+TRNDLIAG+IGGT+G++++TPFDVVKSRIQ+   
Sbjct: 185 LWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDA 244

Query: 235 VAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRTL 293
           V+   +KYNW  PS+  IY+EEGFRALYKGFVPKV RL PGG ++LVVFTG M+FFR L
Sbjct: 245 VSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFRDL 303

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score =  406 bits (1043), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 194/301 (64%), Positives = 238/301 (79%), Gaps = 15/301 (4%)

Query: 3   DARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGP----------QYKGV 52
           D RPLPF YQF AGA+AG+SE+LVMYPLDVVKTRMQLQV+    P           Y GV
Sbjct: 5   DNRPLPFIYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGV 64

Query: 53  VDCIKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVE--KLTQSL 110
           +DC+ +IV KEG S LYKGI+SP+LMEAPKRA KF+ ND FQ  YK+ F     ++TQ +
Sbjct: 65  MDCLTKIVKKEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQKI 124

Query: 111 SILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTL 170
           +I SGASAG  EAFVV PFELVKIRLQDV+S +K PI+VV+  + + GVL+++NGLE+T+
Sbjct: 125 AIYSGASAGAVEAFVVAPFELVKIRLQDVNSQFKTPIEVVKNSVVKGGVLSLFNGLEATI 184

Query: 171 WRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQ 230
           WRH +WNAGYFGIIFQ+R LLP AK+ +++TRNDLIAG+IGGT+G L++TPFDVVKSRIQ
Sbjct: 185 WRHVLWNAGYFGIIFQIRKLLPAAKTSTEKTRNDLIAGAIGGTVGCLLNTPFDVVKSRIQ 244

Query: 231 NTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFF 290
            +   +G  RKYNWS PS+  +Y+EEGF+ALYKGF PKV+RL PGGG+LLVVFT  MDFF
Sbjct: 245 RS---SGPLRKYNWSLPSVLLVYREEGFKALYKGFAPKVMRLAPGGGLLLVVFTNVMDFF 301

Query: 291 R 291
           R
Sbjct: 302 R 302

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score =  400 bits (1027), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 194/296 (65%), Positives = 237/296 (80%), Gaps = 7/296 (2%)

Query: 5   RPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGP--QYKGVVDCIKQIVAK 62
           +PLPF YQF +GA AG+SE+LVMYPLDVVKTRMQLQV  G G    Y GV+DC+ QIV +
Sbjct: 4   KPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKR 63

Query: 63  EGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCE 122
           EG SRLYKGISSP+LMEAPKRATKFACND +QK++K  +GV+KLTQ +SILSG+ AG  E
Sbjct: 64  EGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGVDKLTQQISILSGSLAGVTE 123

Query: 123 AFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFG 182
           A V+VPFELVKIRLQDV+S + GP++VV K I + G+L++YNGLEST+WR+  WN GYFG
Sbjct: 124 ACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFG 183

Query: 183 IIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIG-SLMSTPFDVVKSRIQN--TAVVAGGA 239
           +IFQ+RALLP+AK+ +++T NDLIAG+IGG    S   T   VVKSRIQ+  T  +A G 
Sbjct: 184 VIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGT 243

Query: 240 --RKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRTL 293
              KYNW+WPS+F IY EEGF ALYKGF+PK+LRLGPGGGI+LVVF G M FF+ +
Sbjct: 244 VVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAFFQEM 299

>Scas_589.10
          Length = 316

 Score =  313 bits (801), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 146/301 (48%), Positives = 205/301 (68%), Gaps = 13/301 (4%)

Query: 3   DARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGL----------GPQYKGV 52
           D   LPF YQF +GAVAG+SE ++MYPLDVVKTR QLQ++              P++  +
Sbjct: 7   DPVKLPFIYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSI 66

Query: 53  VDCIKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSI 112
           + C+ +I+ +EG   LYKG+S P+LME PKRA KFA N++FQ+I  ++F ++++T ++++
Sbjct: 67  LSCLSKILKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVTL 126

Query: 113 LSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWR 172
           L+G  AG  E+ +VVPFELVKIRLQD  S Y+ PI   R II  +G+  +Y G EST+WR
Sbjct: 127 LAGTFAGITESLIVVPFELVKIRLQDAQSDYRSPIRCTRTIIENQGLFGIYAGFESTIWR 186

Query: 173 HGVWNAGYFGIIFQVRALLPEAKS--KSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQ 230
           + +WNA YFG+IFQV+  +P AKS  K Q  RND + G+I G +   +S PFDVVK+R+Q
Sbjct: 187 NTIWNASYFGLIFQVKKFIPRAKSTTKFQGIRNDFLVGAIAGCMSCFLSVPFDVVKTRMQ 246

Query: 231 NTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFF 290
            +   + G   Y W+W S+F IY+ EG + +YKG +P + R GPGGG+LLVVF G  + F
Sbjct: 247 GSKKTSSGM-CYGWAWQSVFLIYRTEGIKGIYKGILPIICRYGPGGGLLLVVFNGVNELF 305

Query: 291 R 291
           R
Sbjct: 306 R 306

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score =  162 bits (410), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 104/285 (36%), Positives = 154/285 (54%), Gaps = 19/285 (6%)

Query: 10  FYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLY 69
            Y F+ G++AG     V+YP+D +KTRMQ Q S     QYK  +DC+ +I+++EG   LY
Sbjct: 531 LYNFSLGSIAGCIGATVVYPIDFIKTRMQAQRSLA---QYKNSIDCLLKIISREGIKGLY 587

Query: 70  KGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPF 129
            G+   ++  AP++A K   ND  +     + G  KL+    I+SGASAG C+     P 
Sbjct: 588 SGLGPQLIGVAPEKAIKLTVNDFMRNRLTDKNG--KLSLFPEIISGASAGACQVIFTNPL 645

Query: 130 ELVKIRLQDVSSSYKG-----PIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGII 184
           E+VKIRLQ V S Y G       +   +I+ + G+  +YNG+ + L R   ++A YF   
Sbjct: 646 EIVKIRLQ-VQSDYVGENIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYFPTY 704

Query: 185 FQVRALL----PEAKSKSQ--QTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGG 238
             ++  L    P  K+K    +T   L AG+I G   + ++TPFDV+K+R+Q       G
Sbjct: 705 AHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDP--RKG 762

Query: 239 ARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
             KYN  + +I TI KEE FR+ +KG   +VLR  P  G  L  +
Sbjct: 763 ETKYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAY 807

 Score = 69.3 bits (168), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 56/211 (26%), Positives = 95/211 (45%), Gaps = 20/211 (9%)

Query: 7   LPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGAS 66
           L  F +  +GA AG  +++   PL++VK R+Q+Q S  +G   +   +   QIV K G  
Sbjct: 622 LSLFPEIISGASAGACQVIFTNPLEIVKIRLQVQ-SDYVGENIQQANETATQIVKKLGLR 680

Query: 67  RLYKGISSPVLMEAPKRATKFAC-----NDEFQKIYKREFGVEKLTQSLSILSGASAGCC 121
            LY G+++ ++ + P  A  F        D F      +    +L     + +GA AG  
Sbjct: 681 GLYNGVAACLMRDVPFSAIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMP 740

Query: 122 EAFVVVPFELVKIRLQ----DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWN 177
            AF+  PF+++K RLQ       + Y G    +R I+ +E   + + G  + + R    +
Sbjct: 741 AAFLTTPFDVIKTRLQIDPRKGETKYNGIFHAIRTILKEESFRSFFKGGGARVLR----S 796

Query: 178 AGYFGIIFQVRALL------PEAKSKSQQTR 202
           +  FG       L       P+ K KS++ R
Sbjct: 797 SPQFGFTLAAYELFKGFIPSPDNKLKSREGR 827

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score =  155 bits (393), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 98/290 (33%), Positives = 150/290 (51%), Gaps = 23/290 (7%)

Query: 8   PFF---YQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEG 64
           P F   Y F  G+VAG    +V+YP+D+VKTRMQ Q       +YK  +DC+ +I++KEG
Sbjct: 520 PIFDSIYNFTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFS---KYKNSIDCLLKILSKEG 576

Query: 65  ASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAF 124
              LY G+   ++  AP++A K   ND  +       G  KL+    I+SGA+AG C+  
Sbjct: 577 VRGLYSGLGPQLIGVAPEKAIKLTVNDHMRATLAGRDG--KLSLPCEIISGATAGACQVV 634

Query: 125 VVVPFELVKIRLQDVSSSY-----KGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAG 179
              P E+VKIRLQ V S Y     +  ++ +  +I   G++ +Y G  + L R   ++A 
Sbjct: 635 FTNPLEIVKIRLQ-VKSDYVADAARNSVNAI-SVIKNLGLIGLYRGAGACLLRDIPFSAI 692

Query: 180 YFGIIFQVRALLPEAKSKSQQTRND------LIAGSIGGTIGSLMSTPFDVVKSRIQNTA 233
           YF     +++ +     K    RN       L++G + G   + ++TPFDV+K+R+Q   
Sbjct: 693 YFPTYAHIKSNVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQIDP 752

Query: 234 VVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
               G   YN  W +  TI KEEG ++ +KG   +VLR  P  G  L  +
Sbjct: 753 --KKGESVYNGIWDAARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAY 800

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 1/85 (1%)

Query: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGI 72
             +G +AG+    +  P DV+KTR+Q+    G    Y G+ D  + I+ +EG    +KG 
Sbjct: 724 LVSGGLAGMPAAFLTTPFDVIKTRLQIDPKKG-ESVYNGIWDAARTILKEEGIKSFFKGG 782

Query: 73  SSPVLMEAPKRATKFACNDEFQKIY 97
            + VL  +P+     A  + F  ++
Sbjct: 783 PARVLRSSPQFGFTLAAYEIFHNLF 807

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score =  152 bits (385), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 102/294 (34%), Positives = 152/294 (51%), Gaps = 31/294 (10%)

Query: 8   PFF---YQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEG 64
           P F   Y F  G++AG     V+YP+D+VKTRMQ Q S     QYK  +DC  +I ++EG
Sbjct: 514 PIFDSIYNFTLGSIAGCIGATVVYPIDLVKTRMQAQRSFS---QYKNSIDCFAKIFSREG 570

Query: 65  ASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEK---LTQSLSILSGASAGCC 121
              +Y G+   ++  AP++A K   ND     Y R   ++K   L     ILSGA AG C
Sbjct: 571 IRGIYSGLGPQLIGVAPEKAIKLTVND-----YMRGRLMDKHANLKWYFEILSGACAGAC 625

Query: 122 EAFVVVPFELVKIRLQDVSSSYKGPIDVVRK------IIAQEGVLAMYNGLESTLWRHGV 175
           +     P E+VKIRLQ V S Y G  DV++       +I Q G+  +Y G+ + L R   
Sbjct: 626 QVVFTNPLEVVKIRLQ-VRSEYAG--DVLKSQVTALGVIKQLGIKGLYKGIAACLMRDVP 682

Query: 176 WNAGYFGIIFQVRALLPEAKSKSQQTRND------LIAGSIGGTIGSLMSTPFDVVKSRI 229
           ++A YF     ++  + +   K ++ RN       L+AG + G   + ++TPFDV+K+R+
Sbjct: 683 FSAIYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRL 742

Query: 230 QNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
           Q       G  +Y   + +  TI KEE F++ +KG   +VLR  P  G  L  +
Sbjct: 743 QIDP--RKGETRYEGIFHAARTILKEESFKSFFKGGSARVLRSSPQFGFTLAAY 794

 Score = 66.6 bits (161), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 55/215 (25%), Positives = 104/215 (48%), Gaps = 27/215 (12%)

Query: 7   LPFFYQFAAGAVAGISEILVMYPLDVVKTRMQL--QVSGGLGPQYKGVVDCIKQIVAKEG 64
           L ++++  +GA AG  +++   PL+VVK R+Q+  + +G +       +  IKQ+    G
Sbjct: 610 LKWYFEILSGACAGACQVVFTNPLEVVKIRLQVRSEYAGDVLKSQVTALGVIKQL----G 665

Query: 65  ASRLYKGISSPVLMEAPKRATKFACNDEFQK-IYKREFGVEKLTQSLS----ILSGASAG 119
              LYKGI++ ++ + P  A  F      +K ++K +   +K    L     +++G  AG
Sbjct: 666 IKGLYKGIAACLMRDVPFSAIYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAG 725

Query: 120 CCEAFVVVPFELVKIRLQ----DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGV 175
              A++  PF+++K RLQ       + Y+G     R I+ +E   + + G  + + R   
Sbjct: 726 MPAAYLTTPFDVIKTRLQIDPRKGETRYEGIFHAARTILKEESFKSFFKGGSARVLR--- 782

Query: 176 WNAGYFGI------IFQVRALLPEAKSKSQQTRND 204
            ++  FG       IFQ   + P  + +S  T++D
Sbjct: 783 -SSPQFGFTLAAYEIFQ--NMFPLKREESTFTKDD 814

>Scas_602.8
          Length = 885

 Score =  144 bits (363), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 97/290 (33%), Positives = 149/290 (51%), Gaps = 22/290 (7%)

Query: 8   PFF---YQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEG 64
           P F   + F+ G+VAG     ++YP+D +KTRMQ Q S     +YK  +DC+ +I  KEG
Sbjct: 494 PIFDSIFNFSLGSVAGCIGATLVYPIDFIKTRMQAQRSL---TKYKNSIDCLVKIFGKEG 550

Query: 65  ASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAF 124
              LY G+   ++  AP++A K   ND  +K    + G   L     +LSGA+AG C+  
Sbjct: 551 IRGLYSGLGPQLIGVAPEKAIKLTVNDFMRKSLVDKKG--NLQLGAEVLSGATAGACQVV 608

Query: 125 VVVPFELVKIRLQDVSSSYKGPID-----VVRKIIAQEGVLAMYNGLESTLWRHGVWNAG 179
              P E+VKIRLQ V S Y   +         +II +  ++ +Y G+ + L R   ++A 
Sbjct: 609 FTNPLEIVKIRLQ-VKSEYTNAMIPKSQLTAFQIIKELKLIGLYKGVGACLLRDVPFSAI 667

Query: 180 YFGIIFQVRALL----PEAKSKSQ--QTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTA 233
           YF     ++  +    P  K K    +T   L AG++ G   + ++TPFDV+K+R+Q   
Sbjct: 668 YFPTYAHLKKNVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKTRLQIEP 727

Query: 234 VVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
            V  G  +Y     ++ TI KEE FR+ +KG   +V+R  P  G  L  +
Sbjct: 728 GV--GETRYTGILHAVRTILKEESFRSFFKGGAARVMRSSPQFGFTLAAY 775

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/86 (29%), Positives = 48/86 (55%), Gaps = 3/86 (3%)

Query: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLG-PQYKGVVDCIKQIVAKEGASRLYKG 71
             AGA+AG+    +  P DV+KTR  LQ+  G+G  +Y G++  ++ I+ +E     +KG
Sbjct: 699 LTAGALAGVPAAFLTTPFDVIKTR--LQIEPGVGETRYTGILHAVRTILKEESFRSFFKG 756

Query: 72  ISSPVLMEAPKRATKFACNDEFQKIY 97
            ++ V+  +P+     A  + F+ ++
Sbjct: 757 GAARVMRSSPQFGFTLAAYELFKNMF 782

>Kwal_47.17321
          Length = 881

 Score =  144 bits (362), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 98/290 (33%), Positives = 148/290 (51%), Gaps = 21/290 (7%)

Query: 7   LPFF---YQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKE 63
            P F   Y F  G+VAG      +YP+D+VKTRMQ Q +     QYK  +DC  +I ++E
Sbjct: 495 FPIFDSIYNFLLGSVAGCIGATAVYPIDLVKTRMQAQRNFS---QYKNSIDCFVKIFSRE 551

Query: 64  GASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEA 123
           G   +Y G+   ++  AP++A K   ND  +K+   E    +LT  L I+SGA+AG C+ 
Sbjct: 552 GIRGIYSGLGPQLVGVAPEKAIKLTVNDYVRKLLMDE--NNRLTLPLEIISGAAAGACQV 609

Query: 124 FVVVPFELVKIRLQDVSSSYKGPID----VVRKIIAQEGVLAMYNGLESTLWRHGVWNAG 179
               P E+VKIRLQ V S Y   +         ++   G+  +Y GL + L R   ++A 
Sbjct: 610 IFTNPLEIVKIRLQ-VRSEYADSLPKSQLTALGVVKSLGLRGLYKGLVACLMRDVPFSAI 668

Query: 180 YFGIIFQVRALL----PEAKSKSQQ--TRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTA 233
           YF     ++  +    P+ K+K  +  T   L AG + G   + ++TPFDV+K+R+Q   
Sbjct: 669 YFPTYAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQIDP 728

Query: 234 VVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
               G  +Y     +  TI KEE F++ +KG   +VLR  P  G  L  +
Sbjct: 729 --RKGETRYTGILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAY 776

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 43/85 (50%), Gaps = 1/85 (1%)

Query: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGI 72
             AG +AG+    +  P DV+KTR+Q+    G   +Y G++   + I+ +E     +KG 
Sbjct: 700 LTAGGLAGMPAAYLTTPFDVIKTRLQIDPRKG-ETRYTGILHAARTILKEERFKSFFKGG 758

Query: 73  SSPVLMEAPKRATKFACNDEFQKIY 97
            + VL  +P+     A  + FQ ++
Sbjct: 759 GARVLRSSPQFGFTLAAYEIFQNMF 783

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score =  140 bits (354), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 96/284 (33%), Positives = 146/284 (51%), Gaps = 17/284 (5%)

Query: 10  FYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLY 69
            Y F+ G+VAG     ++YP+D VKTRMQ Q S     QYK  +DC  +I+++EG   +Y
Sbjct: 544 LYNFSLGSVAGCIGATIVYPIDFVKTRMQAQRSLS---QYKNSIDCFLKILSREGIRGVY 600

Query: 70  KGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPF 129
            G+   ++  AP++A K   ND  +   K + G  KL     I+SGASAG C+     P 
Sbjct: 601 SGLGPQLIGVAPEKAIKLTVNDYMRNKLKDKNG--KLGLLSEIISGASAGACQVIFTNPL 658

Query: 130 ELVKIRLQ----DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIF 185
           E+VKIRLQ     V+ + +       +II + G+  +Y G  + L R   ++A YF    
Sbjct: 659 EIVKIRLQVKGEYVAENAENAKLTALQIIKRLGLPGLYKGAAACLLRDVPFSAIYFPTYA 718

Query: 186 QVRALL----PEAKSKSQQ--TRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGA 239
            ++  L    P  K+K  +  T   L AG++ G   + ++TPFDV+K+R+Q       G 
Sbjct: 719 HLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRLQIDP--KKGE 776

Query: 240 RKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
             Y     +  TI +EE F++ +KG   +VLR  P  G  L  +
Sbjct: 777 TIYKGIIHAARTILREESFKSFFKGGAARVLRSSPQFGFTLAAY 820

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 31/112 (27%), Positives = 56/112 (50%), Gaps = 6/112 (5%)

Query: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGI 72
            +AGA+AG+    +  P DV+KTR+Q+    G    YKG++   + I+ +E     +KG 
Sbjct: 744 LSAGALAGMPAAYLTTPFDVIKTRLQIDPKKG-ETIYKGIIHAARTILREESFKSFFKGG 802

Query: 73  SSPVLMEAPKRATKFACNDEFQKIY-----KREFGVEKLTQSLSILSGASAG 119
           ++ VL  +P+     A  + F  I+     K +F + +  +   IL+  + G
Sbjct: 803 AARVLRSSPQFGFTLAAYELFHNIFPLPNDKDKFVISEDDRRAKILNNNARG 854

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score =  133 bits (335), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 99/299 (33%), Positives = 143/299 (47%), Gaps = 31/299 (10%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGL-GPQYKGVVDCIKQIVAKEGASRLYKGIS 73
           AG  AG+ E L  +PLD +K RMQ+     L G +  G +   + I  +EG   LYKG+ 
Sbjct: 16  AGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIYTEEGLLALYKGLG 75

Query: 74  SPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSI----LSGASAGCCEAFVVV-P 128
           + V+   PK A +F+  +     + R    +K T S+S     L+G  AG  EA +VV P
Sbjct: 76  AVVIGIIPKMAIRFSSYE-----FYRSALADKQTGSVSTGNTFLAGVGAGTTEAVLVVNP 130

Query: 129 FELVKIRLQD--------VSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGY 180
            E+VKIRLQ          S  Y+  +     I+ +EG+ A+Y G+  T  R        
Sbjct: 131 MEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAARQATNQGAN 190

Query: 181 FGIIFQVRALLPEA-KSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGA 239
           F +  +++  L E  K+ +  +      G I G IG   + P D +K+R+Q     A   
Sbjct: 191 FTVYSKLKEFLQEHHKTDALPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTA--- 247

Query: 240 RKYNWS-WPSIFTI----YKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRTL 293
              N S W  I TI     KEEGFRALYKG  P+V+R+ PG  +   V+    +   TL
Sbjct: 248 ---NMSGWSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVREHLETL 303

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 84/188 (44%), Gaps = 9/188 (4%)

Query: 13  FAAGAVAGISE-ILVMYPLDVVKTRMQ---LQVSGGLGPQYKGVVDCIKQIVAKEGASRL 68
           F AG  AG +E +LV+ P++VVK R+Q   L       P+Y+  +     IV +EG   L
Sbjct: 113 FLAGVGAGTTEAVLVVNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGAL 172

Query: 69  YKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVP 128
           Y+G+S     +A  +   F    + ++  +     + L    +   G  +G    F   P
Sbjct: 173 YRGVSLTAARQATNQGANFTVYSKLKEFLQEHHKTDALPSWETSCIGLISGAIGPFSNAP 232

Query: 129 FELVKIRLQDVSSS-----YKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGI 183
            + +K RLQ   S+     +   + + +++I +EG  A+Y G+   + R     A  F +
Sbjct: 233 LDTIKTRLQKDKSTANMSGWSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTV 292

Query: 184 IFQVRALL 191
              VR  L
Sbjct: 293 YEFVREHL 300

 Score = 65.1 bits (157), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 53/192 (27%), Positives = 89/192 (46%), Gaps = 9/192 (4%)

Query: 109 SLSILSGASAGCCEAFVVVPFELVKIRLQDVSSSY------KGPIDVVRKIIAQEGVLAM 162
           ++++++G +AG  EA    P + +K+R+Q    S        G I   R I  +EG+LA+
Sbjct: 11  AVNLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIYTEEGLLAL 70

Query: 163 YNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGS-LMSTP 221
           Y GL + +       A  F      R+ L + ++ S  T N  +AG   GT  + L+  P
Sbjct: 71  YKGLGAVVIGIIPKMAIRFSSYEFYRSALADKQTGSVSTGNTFLAGVGAGTTEAVLVVNP 130

Query: 222 FDVVKSRIQNTAVV--AGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGIL 279
            +VVK R+Q   +      + +Y  +  + + I KEEG  ALY+G      R     G  
Sbjct: 131 MEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAARQATNQGAN 190

Query: 280 LVVFTGCMDFFR 291
             V++   +F +
Sbjct: 191 FTVYSKLKEFLQ 202

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 50/104 (48%), Gaps = 3/104 (2%)

Query: 2   TDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVA 61
           TDA  LP +     G ++G        PLD +KTR+Q   S      +  +V   KQ++ 
Sbjct: 207 TDA--LPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTANMSGWSRIVTIGKQLIK 264

Query: 62  KEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEK 105
           +EG   LYKGI+  V+  AP +A  F    EF + +    G+ K
Sbjct: 265 EEGFRALYKGITPRVMRVAPGQAVTFTVY-EFVREHLETLGIFK 307

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 43/99 (43%), Gaps = 4/99 (4%)

Query: 194 AKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIY 253
           +K KS     +LIAG   G   +L   P D +K R+Q     A    K      +   IY
Sbjct: 3   SKKKSSNPAVNLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIY 62

Query: 254 KEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRT 292
            EEG  ALYKG    V+ + P   I    +    +F+R+
Sbjct: 63  TEEGLLALYKGLGAVVIGIIPKMAIRFSSY----EFYRS 97

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score =  139 bits (349), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 99/289 (34%), Positives = 145/289 (50%), Gaps = 21/289 (7%)

Query: 8   PFF---YQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEG 64
           P F   + F  G++AG     V+YP+D+VKTRMQ Q +     QYK  +DC+ +I   +G
Sbjct: 500 PIFDSIHNFTLGSIAGCIGATVVYPIDLVKTRMQAQRNS---VQYKNSIDCVVKIFQTKG 556

Query: 65  ASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAF 124
              LY G+   ++  AP++A K   ND  ++ +  +    K  Q   ILSGA+AG C+  
Sbjct: 557 IRGLYSGLGPQLIGVAPEKAIKLTVNDFMRQYFMNKSRTIKWYQ--EILSGATAGACQVV 614

Query: 125 VVVPFELVKIRLQDVSSSYKG----PIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGY 180
              P E+VKIRLQ + S Y G    P      II Q G+  +Y G  + L R   ++A Y
Sbjct: 615 FTNPLEIVKIRLQ-MRSDYVGENARPQLGAVGIIRQLGLRGLYKGAAACLLRDVPFSAIY 673

Query: 181 FGIIFQVRALL----PEAKSKSQ--QTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAV 234
           F     ++  +    P  K+K    +T   L+AG I G   + ++TPFDV+K+R+Q    
Sbjct: 674 FPTYAHLKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQIDP- 732

Query: 235 VAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
              G   Y     +  TI KEE  ++ +KG   +VLR  P  G  L  F
Sbjct: 733 -RKGETTYTGVIHAARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAF 780

 Score = 68.9 bits (167), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 50/180 (27%), Positives = 87/180 (48%), Gaps = 23/180 (12%)

Query: 1   MTDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQ---VSGGLGPQYKGVVDCIK 57
           M  +R + ++ +  +GA AG  +++   PL++VK R+Q++   V     PQ  G V  I+
Sbjct: 590 MNKSRTIKWYQEILSGATAGACQVVFTNPLEIVKIRLQMRSDYVGENARPQL-GAVGIIR 648

Query: 58  QIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVE--------KLTQS 109
           Q+    G   LYKG ++ +L + P  A  F     +  + K  F  +        KL   
Sbjct: 649 QL----GLRGLYKGAAACLLRDVPFSAIYFP---TYAHLKKDVFNFDPNDKNKRNKLKTW 701

Query: 110 LSILSGASAGCCEAFVVVPFELVKIRLQ----DVSSSYKGPIDVVRKIIAQEGVLAMYNG 165
             +L+G  AG   A++  PF+++K RLQ       ++Y G I   R I+ +E + + + G
Sbjct: 702 ELLLAGGIAGMPAAYLTTPFDVIKTRLQIDPRKGETTYTGVIHAARTILKEESIKSFFKG 761

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74
           AG +AG+    +  P DV+KTR+Q+    G    Y GV+   + I+ +E     +KG  +
Sbjct: 706 AGGIAGMPAAYLTTPFDVIKTRLQIDPRKG-ETTYTGVIHAARTILKEESIKSFFKGGPA 764

Query: 75  PVLMEAPKRATKFACNDEFQKIYKREF 101
            VL  +P+     A  + FQ ++   F
Sbjct: 765 RVLRSSPQFGFTLAAFEMFQGLFPSHF 791

>Scas_691.4
          Length = 334

 Score =  126 bits (317), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 97/321 (30%), Positives = 147/321 (45%), Gaps = 38/321 (11%)

Query: 2   TDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQL-QVSGGLGPQYKGVVDCIKQIV 60
            D +  P      AG  AG+ E L  +PLD +K RMQ+ + + G+ P   G +   + I 
Sbjct: 7   NDKKSSPLI-NLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPH--GFITTGRNIY 63

Query: 61  AKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGC 120
           + EG   LYKG+ + V+   PK A +F+ + EF +    +     +T   + L+G  AG 
Sbjct: 64  SHEGFLALYKGLGAVVIGIIPKMAIRFS-SYEFYRNALTDKETRTITTGNTFLAGVGAGI 122

Query: 121 CEAFVVV-PFELVKIRLQ------------DVSSS----------YKGPIDVVRKIIAQE 157
            EA +VV P E+VKIRLQ             VS++          Y   I     I+ +E
Sbjct: 123 TEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEE 182

Query: 158 GVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSK-SQQTRNDLIAGSIGGTIGS 216
           G  A+Y G+  T  R        F +   ++  L +  ++ S  +      G I G IG 
Sbjct: 183 GAGALYRGVSLTAARQATNQGANFTVYSYLKDYLQKYHNRESLPSWETSCIGLISGAIGP 242

Query: 217 LMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTI----YKEEGFRALYKGFVPKVLRL 272
             + P D +K+R+Q    ++      N +W  I+ I     KEEGFRALYKG  P+V+R+
Sbjct: 243 FSNAPLDTIKTRLQKDKSISS-----NSAWKKIYIIGTQLIKEEGFRALYKGITPRVMRV 297

Query: 273 GPGGGILLVVFTGCMDFFRTL 293
            PG  +   V+        TL
Sbjct: 298 APGQAVTFTVYEFVRKHLETL 318

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score =  124 bits (311), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 88/286 (30%), Positives = 138/286 (48%), Gaps = 21/286 (7%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKG 71
              AG  AG+ E L  +PLD +K RMQ+      G +  G +     I + EG    YKG
Sbjct: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKG 119

Query: 72  ISSPVLMEAPKRATKFACNDEFQKIY-KREFGVEKLTQSLSILSGASAGCCEAFVVV-PF 129
           + + V+   PK A +F+  + ++ +   R+ GV  ++   + L+G  AG  EA +VV P 
Sbjct: 120 LGAVVIGIIPKMAIRFSSYEFYRTLLADRQTGV--VSTGNTFLAGVGAGVTEAVLVVNPM 177

Query: 130 ELVKIRLQDVS-------SSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFG 182
           E+VKIRLQ            Y+  I     I+ +EG+ A+Y G+  T  R        F 
Sbjct: 178 EVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFT 237

Query: 183 IIFQVRALLPEAK-SKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARK 241
           +  ++   L E   S++  +    + G + G IG   + P D +K+R+Q        + +
Sbjct: 238 VYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDK-----STR 292

Query: 242 YNWSWPSIFTI----YKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
              +W  I TI     +EEGFRALYKG  P+V+R+ PG  +   V+
Sbjct: 293 NLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVY 338

 Score = 68.2 bits (165), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 87/187 (46%), Gaps = 8/187 (4%)

Query: 13  FAAGAVAGISE-ILVMYPLDVVKTRMQLQVSGGLGPQ--YKGVVDCIKQIVAKEGASRLY 69
           F AG  AG++E +LV+ P++VVK R+Q Q   G   Q  Y+  +     IV +EG   LY
Sbjct: 159 FLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALY 218

Query: 70  KGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPF 129
           +G+S     +A  +   F    +  +  +   G + L    + L G  +G    F   P 
Sbjct: 219 RGVSLTAARQATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPL 278

Query: 130 ELVKIRLQ-DVS----SSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGII 184
           + +K RLQ D S    S++     + R+++ +EG  A+Y G+   + R     A  F + 
Sbjct: 279 DTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVY 338

Query: 185 FQVRALL 191
             VR  L
Sbjct: 339 EFVRRHL 345

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 62/222 (27%), Positives = 102/222 (45%), Gaps = 9/222 (4%)

Query: 76  VLMEAPKRATKFACNDEFQKIY-KREFGVEKLTQ-SLSILSGASAGCCEAFVVVPFELVK 133
           V + A +R+    C+   Q+ Y       +K T  ++++++G +AG  EA    P + +K
Sbjct: 23  VYIGARRRSVADPCSAVCQQPYPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIK 82

Query: 134 IRLQDVSSSYKG--PIDVVR---KIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVR 188
           +R+Q    + +G  P   +R    I + EG+LA Y GL + +       A  F      R
Sbjct: 83  VRMQIYRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYR 142

Query: 189 ALLPEAKSKSQQTRNDLIAG-SIGGTIGSLMSTPFDVVKSRIQNTAVV-AGGARKYNWSW 246
            LL + ++    T N  +AG   G T   L+  P +VVK R+Q   +  A   +KY  + 
Sbjct: 143 TLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAI 202

Query: 247 PSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMD 288
            + + I KEEG  ALY+G      R     G    V++  M+
Sbjct: 203 QAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLME 244

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 39/81 (48%)

Query: 7   LPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGAS 66
           LP +     G V+G        PLD +KTR+Q   S      +  +    +Q+V +EG  
Sbjct: 255 LPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQLVQEEGFR 314

Query: 67  RLYKGISSPVLMEAPKRATKF 87
            LYKGI+  V+  AP +A  F
Sbjct: 315 ALYKGITPRVMRVAPGQAVTF 335

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score =  122 bits (307), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 91/306 (29%), Positives = 143/306 (46%), Gaps = 35/306 (11%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQL--QVSGGLGPQYKGVVDCIKQIVAKEGASRLY 69
              AG  AG+ E L  +PLD +K RMQ+  +V+G    +  G +   + I  KEG   LY
Sbjct: 13  NLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALY 72

Query: 70  KGISSPVLMEAPKRATKFACNDEFQKIY-KREFGVEKLTQSLSILSGASAGCCEAFVVV- 127
           KG+ + V+   PK A +F+  + ++ +   +E G+  ++   + ++G  AG  EA +VV 
Sbjct: 73  KGLGAVVIGIIPKMAIRFSSYEFYRTLLVNKESGI--VSTGNTFVAGVGAGITEAVLVVN 130

Query: 128 PFELVKIRLQ---------DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNA 178
           P E+VKIRLQ         +    Y   I     I+ +EGV A+Y G+  T  R      
Sbjct: 131 PMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQG 190

Query: 179 GYFGIIFQVRALLPEAKSKSQQTRNDLIA-------GSIGGTIGSLMSTPFDVVKSRIQN 231
             F +  +++  L          + D++        G I G IG   + P D +K+R+Q 
Sbjct: 191 ANFTVYSKLKEFL------QNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQK 244

Query: 232 TAVVAGGARKYNWSWPSIFTI----YKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCM 287
              ++    +       I TI     KEEGFRALYKG  P+V+R+ PG  +   V+    
Sbjct: 245 DKSIS---LEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEYVR 301

Query: 288 DFFRTL 293
           +    L
Sbjct: 302 EHLENL 307

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 58/195 (29%), Positives = 86/195 (44%), Gaps = 11/195 (5%)

Query: 109 SLSILSGASAGCCEAFVVVPFELVKIRLQDVS-----SSYKGP--IDVVRKIIAQEGVLA 161
           ++++++G +AG  EA    P + +K+R+Q           K P  I   R I  +EG LA
Sbjct: 11  AINLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLA 70

Query: 162 MYNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGG-TIGSLMST 220
           +Y GL + +       A  F      R LL   +S    T N  +AG   G T   L+  
Sbjct: 71  LYKGLGAVVIGIIPKMAIRFSSYEFYRTLLVNKESGIVSTGNTFVAGVGAGITEAVLVVN 130

Query: 221 PFDVVKSRIQN---TAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGG 277
           P +VVK R+Q    T        KYN +  + +TI KEEG  ALY+G      R     G
Sbjct: 131 PMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQG 190

Query: 278 ILLVVFTGCMDFFRT 292
               V++   +F + 
Sbjct: 191 ANFTVYSKLKEFLQN 205

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 48/104 (46%), Gaps = 13/104 (12%)

Query: 195 KSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIF---- 250
           K K+     +L+AG   G   +L   P D +K R+Q    VAG         P  F    
Sbjct: 4   KKKASHPAINLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAG----IEHVKPPGFIKTG 59

Query: 251 -TIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRTL 293
            TIY++EGF ALYKG    V+ + P   I    +    +F+RTL
Sbjct: 60  RTIYQKEGFLALYKGLGAVVIGIIPKMAIRFSSY----EFYRTL 99

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 41/83 (49%), Gaps = 2/83 (2%)

Query: 7   LPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQ--YKGVVDCIKQIVAKEG 64
           LP +     G ++G        PLD +KTR+Q   S  L  Q   K ++    Q++ +EG
Sbjct: 212 LPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSISLEKQSGMKKIITIGAQLLKEEG 271

Query: 65  ASRLYKGISSPVLMEAPKRATKF 87
              LYKGI+  V+  AP +A  F
Sbjct: 272 FRALYKGITPRVMRVAPGQAVTF 294

>Kwal_47.18216
          Length = 333

 Score =  115 bits (288), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 88/314 (28%), Positives = 143/314 (45%), Gaps = 49/314 (15%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQL-QVSGGLGPQYKGVVDCIKQIVAKEGASRLYK 70
              AG  AG+ E L  +PLD +K RMQ+   +   G + +G +   + I  +EG   LYK
Sbjct: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72

Query: 71  GISSPVLMEAPKRATKFACNDEFQKIY-KREFGVEKLTQSLSILSGASAGCCEAFVVV-P 128
           G+ + V+   PK A +F   + F+ +   R+ GV  ++   + ++G  AG  EA +VV P
Sbjct: 73  GLGAVVIGIIPKMAIRFTSYEFFRTLLADRQTGV--VSTGNTFVAGVGAGITEAVMVVNP 130

Query: 129 FELVKIRLQ--------------------------------DVSSS--YKGPIDVVRKII 154
            E+VKIRLQ                                +V+++  Y+  I     I+
Sbjct: 131 MEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNAIQAAYVIV 190

Query: 155 AQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLPE-AKSKSQQTRNDLIAGSIGGT 213
            +EG  A+Y G+  T  R        F +   +++ L E  ++    +    + G I G 
Sbjct: 191 KEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIGLISGA 250

Query: 214 IGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTI----YKEEGFRALYKGFVPKV 269
           +G   + P D +K+R+Q     +      +  W  I  I     +EEGFRALYKG  P+V
Sbjct: 251 LGPFSNAPLDTIKTRLQKDKSTS-----KDSGWSRILAIGRQLIREEGFRALYKGITPRV 305

Query: 270 LRLGPGGGILLVVF 283
           +R+ PG  +   V+
Sbjct: 306 MRVAPGQAVTFTVY 319

 Score = 58.9 bits (141), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 88/214 (41%), Gaps = 35/214 (16%)

Query: 13  FAAGAVAGISE-ILVMYPLDVVKTRMQLQ----------VSGGLG--------------- 46
           F AG  AGI+E ++V+ P++VVK R+Q Q          ++G +                
Sbjct: 113 FVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATEN 172

Query: 47  ----PQYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFG 102
               P+Y+  +     IV +EG   LY+G+S     +A  +   F      +   +    
Sbjct: 173 VAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQ 232

Query: 103 VEKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGP-----IDVVRKIIAQE 157
            + L    + L G  +G    F   P + +K RLQ   S+ K       + + R++I +E
Sbjct: 233 TDMLPSWETSLIGLISGALGPFSNAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREE 292

Query: 158 GVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALL 191
           G  A+Y G+   + R     A  F +   +R  L
Sbjct: 293 GFRALYKGITPRVMRVAPGQAVTFTVYELIRKKL 326

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 91/221 (41%), Gaps = 55/221 (24%)

Query: 109 SLSILSGASAGCCEAFVVVPFELVKIRLQDVSSSY------KGPIDVVRKIIAQEGVLAM 162
           ++++++G +AG  EA    P + +K+R+Q  S +       +G I   R I  QEG LA+
Sbjct: 11  AINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLAL 70

Query: 163 YNGLESTLWRHGVWNAGYFGIIFQV----------RALLPEAKSKSQQTRNDLIAGSIGG 212
           Y GL + +           GII ++          R LL + ++    T N  +AG   G
Sbjct: 71  YKGLGAVV----------IGIIPKMAIRFTSYEFFRTLLADRQTGVVSTGNTFVAGVGAG 120

Query: 213 TIGSLM-STPFDVVKSRIQNTAV--------VAGGAR--------------------KYN 243
              ++M   P +VVK R+Q   V        +AG                       KY 
Sbjct: 121 ITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYR 180

Query: 244 WSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFT 284
            +  + + I KEEG RALY+G      R     G    V++
Sbjct: 181 NAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYS 221

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 41/90 (45%), Gaps = 4/90 (4%)

Query: 204 DLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYK 263
           +L+AG   G   +L   P D +K R+Q  +      ++      +   I  +EGF ALYK
Sbjct: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYK 72

Query: 264 GFVPKVLRLGPGGGILLVVFTGCMDFFRTL 293
           G    V+ + P   I    +    +FFRTL
Sbjct: 73  GLGAVVIGIIPKMAIRFTSY----EFFRTL 98

>Kwal_33.15446
          Length = 305

 Score =  114 bits (286), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 85/281 (30%), Positives = 135/281 (48%), Gaps = 21/281 (7%)

Query: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGI 72
           F +G  +GI++  V +P D +K R+Q     G   ++KG +DC+ Q + ++G    Y G 
Sbjct: 22  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTG---RFKGPLDCVYQTMRQQGIRGFYLGF 78

Query: 73  SSPVLMEAPKRATKFACNDEFQKIYKREF--GVEKLTQSLSILSGASAGCCEAFVVVPFE 130
           + P++      +    C   ++ + K+      EKL  S  ILSG  AG   +F+  P E
Sbjct: 79  TPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVE 138

Query: 131 LVKIRLQ---DVSSS-YKGPIDVVRKIIAQEGVLAMYNGLESTL--WRHGVWNAGYFGII 184
           L K +LQ   D  ++ Y+GP+DV++K+ A +G+  MY GL STL    H V+  G + ++
Sbjct: 139 LAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIFRTHFVYWWGSYELL 198

Query: 185 FQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMST-PFDVVKSRIQNTAVVAGGARKYN 243
            +      +A +    T  +  AG    + G   +  P DV+K  I       G  R   
Sbjct: 199 TR----WFKANTNLSDTAINFWAGGFSASFGFWTTAYPSDVIKQVILCNDKYDGSLR--- 251

Query: 244 WSWPSIFT-IYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
            SW +  + I++  G R  +KGFVP  LR  P     L  F
Sbjct: 252 -SWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASF 291

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 81/172 (47%), Gaps = 7/172 (4%)

Query: 104 EKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSS--YKGPIDVVRKIIAQEGVLA 161
           E  ++ +  +SG  +G  +  V  PF+ +K+RLQ    +  +KGP+D V + + Q+G+  
Sbjct: 14  EAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRG 73

Query: 162 MYNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQT---RNDLIAGSIGGTIGSLM 218
            Y G    L    + ++   G +   R LL +   + ++       +++G + G   S +
Sbjct: 74  FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFI 133

Query: 219 STPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVL 270
           + P ++ K+++Q          +Y      I  +Y  +G R +YKG V  ++
Sbjct: 134 AAPVELAKAKLQ--VQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLI 183

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score =  115 bits (288), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 92/318 (28%), Positives = 143/318 (44%), Gaps = 53/318 (16%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQL------------------------------QV 41
              AG  AG+ E L  +PLD +K RMQ+                                
Sbjct: 14  NLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGGDA 73

Query: 42  SGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIY-KRE 100
           +  + P   G +   + I A+EG   LYKG+ + V+   PK A +F+  + ++ +   ++
Sbjct: 74  TAAIKP--PGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADKQ 131

Query: 101 FGVEKLTQSLSILSGASAGCCEAFVVV-PFELVKIRLQ--------DVSS-SYKGPIDVV 150
            GV  ++ S + ++G  AG  EA +VV P E+VKIRLQ        D++   Y   +   
Sbjct: 132 TGV--VSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAG 189

Query: 151 RKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLPEAK-SKSQQTRNDLIAGS 209
             II +EG+ A+Y G+  T  R        F +  ++R  L E   +++  +      G 
Sbjct: 190 YTIIKEEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPSWETSCIGL 249

Query: 210 IGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTI----YKEEGFRALYKGF 265
           I G IG   + P D +K+R+Q     +    K    W  I  I     KEEGFRALYKG 
Sbjct: 250 ISGAIGPFSNAPLDTIKTRLQKDKSTS---FKGESGWKRIAHIGTQLLKEEGFRALYKGI 306

Query: 266 VPKVLRLGPGGGILLVVF 283
            P+V+R+ PG  +   V+
Sbjct: 307 TPRVMRVAPGQAVTFTVY 324

 Score = 71.2 bits (173), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 90/191 (47%), Gaps = 12/191 (6%)

Query: 13  FAAGAVAGISE-ILVMYPLDVVKTRMQ---LQVSGGLG-PQYKGVVDCIKQIVAKEGASR 67
           F AG  AG++E +LV+ P++VVK R+Q   L  +  L  P+Y   V     I+ +EG S 
Sbjct: 141 FIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTIIKEEGISA 200

Query: 68  LYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVV 127
           LY+G+S     +A  +   F    + ++  +   G E L    +   G  +G    F   
Sbjct: 201 LYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPSWETSCIGLISGAIGPFSNA 260

Query: 128 PFELVKIRLQ-DVSSSYKGP------IDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGY 180
           P + +K RLQ D S+S+KG         +  +++ +EG  A+Y G+   + R     A  
Sbjct: 261 PLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGITPRVMRVAPGQAVT 320

Query: 181 FGIIFQVRALL 191
           F +   VR  L
Sbjct: 321 FTVYEFVRRHL 331

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/219 (26%), Positives = 90/219 (41%), Gaps = 37/219 (16%)

Query: 110 LSILSGASAGCCEAFVVVPFELVKIRLQ-------------------------------D 138
           +++++G +AG  EA    P + +K+R+Q                               D
Sbjct: 13  VNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGGD 72

Query: 139 VSSSYKGP--IDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKS 196
            +++ K P  I   R I AQEG LA+Y GL + +       A  F      R LL + ++
Sbjct: 73  ATAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADKQT 132

Query: 197 KSQQTRNDLIAG-SIGGTIGSLMSTPFDVVKSRIQNTAVVAG---GARKYNWSWPSIFTI 252
               T N  IAG   G T   L+  P +VVK R+Q   +         KY  +  + +TI
Sbjct: 133 GVVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTI 192

Query: 253 YKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFR 291
            KEEG  ALY+G      R     G    V++   +F +
Sbjct: 193 IKEEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQ 231

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 46/99 (46%), Gaps = 3/99 (3%)

Query: 7   LPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQ--YKGVVDCIKQIVAKEG 64
           LP +     G ++G        PLD +KTR+Q   S     +  +K +     Q++ +EG
Sbjct: 239 LPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEG 298

Query: 65  ASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGV 103
              LYKGI+  V+  AP +A  F    EF + +    GV
Sbjct: 299 FRALYKGITPRVMRVAPGQAVTFTVY-EFVRRHLENLGV 336

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score =  110 bits (274), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 87/288 (30%), Positives = 129/288 (44%), Gaps = 32/288 (11%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74
           +G   GI+++LV  P D+ K RMQ              VD +  ++  EG    YKG  +
Sbjct: 29  SGTAGGIAQVLVGQPFDITKVRMQTSAGSATA------VDVVTSLIKNEGILGFYKGTLA 82

Query: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLS--ILSGASAGCCEAFVVVPFELV 132
           P++      + +F  N+  ++ ++R  G      SL    + G ++GC  AF+  P E V
Sbjct: 83  PLVGVGACVSCQFGVNEAMKRRFRRMNGDPSKPLSLKQYYVCGVASGCANAFLATPIEHV 142

Query: 133 KIRLQDVSSS-----YKGPIDVVRKIIAQEGVLAMYNGLESTLWR--HGVWNAGYFGIIF 185
           +IRLQ  + S     Y+G +D +RK++ Q    A+  G  +TL R  HG      FGI F
Sbjct: 143 RIRLQLQTKSLANAEYQGSLDCMRKLLKQG---ALMRGFTATLMRTCHG------FGIYF 193

Query: 186 QVRALLPEAKSKSQQTRNDL------IAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGA 239
                L   + K    R D+      I G+  G     M+ P DVVKS +Q+  +V+   
Sbjct: 194 STYEALIANQHKKGIPRKDIAPWKVCIFGAFSGACYWAMAYPIDVVKSIMQSDRLVSPVH 253

Query: 240 RKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCM 287
               W      +IY   G RA  KGF+P +LR  P  G     F   M
Sbjct: 254 GTNVWQVAK--SIYTTRGKRAFIKGFMPAMLRSLPVNGATFATFEMTM 299

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 85/192 (44%), Gaps = 17/192 (8%)

Query: 103 VEKLTQSLS-------ILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIA 155
           V+ L+ SL        ILSG + G  +  V  PF++ K+R+Q  S+     +DVV  +I 
Sbjct: 11  VDDLSDSLDYKRAIKDILSGTAGGIAQVLVGQPFDITKVRMQ-TSAGSATAVDVVTSLIK 69

Query: 156 QEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLPEAK---SKSQQTRNDLIAGSIGG 212
            EG+L  Y G  + L   G   +  FG+   ++          SK    +   + G   G
Sbjct: 70  NEGILGFYKGTLAPLVGVGACVSCQFGVNEAMKRRFRRMNGDPSKPLSLKQYYVCGVASG 129

Query: 213 TIGSLMSTPFDVVKSRIQ-NTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLR 271
              + ++TP + V+ R+Q  T  +A    +Y  S   +  + K+    AL +GF   ++R
Sbjct: 130 CANAFLATPIEHVRIRLQLQTKSLANA--EYQGSLDCMRKLLKQG---ALMRGFTATLMR 184

Query: 272 LGPGGGILLVVF 283
              G GI    +
Sbjct: 185 TCHGFGIYFSTY 196

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/195 (21%), Positives = 80/195 (41%), Gaps = 12/195 (6%)

Query: 4   ARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKE 63
           ++PL     +  G  +G +   +  P++ V+ R+QLQ       +Y+G +DC+++++ K+
Sbjct: 113 SKPLSLKQYYVCGVASGCANAFLATPIEHVRIRLQLQTKSLANAEYQGSLDCMRKLL-KQ 171

Query: 64  GASRLYKGISSPVLMEAPKRATKFACNDEF-QKIYKREFGVEKLTQSLSILSGASAGCCE 122
           GA  L +G ++ ++         F+  +      +K+    + +      + GA +G C 
Sbjct: 172 GA--LMRGFTATLMRTCHGFGIYFSTYEALIANQHKKGIPRKDIAPWKVCIFGAFSGACY 229

Query: 123 AFVVVPFELVKIRLQDVSSSYKGPID------VVRKIIAQEGVLAMYNGLESTLWRHGVW 176
             +  P ++VK  +Q  S     P+       V + I    G  A   G    + R    
Sbjct: 230 WAMAYPIDVVKSIMQ--SDRLVSPVHGTNVWQVAKSIYTTRGKRAFIKGFMPAMLRSLPV 287

Query: 177 NAGYFGIIFQVRALL 191
           N   F        LL
Sbjct: 288 NGATFATFEMTMRLL 302

>Scas_718.5
          Length = 324

 Score =  108 bits (270), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 82/285 (28%), Positives = 134/285 (47%), Gaps = 29/285 (10%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74
           AG   GIS+++V  P D  K RMQ         +  G +D I+++V  EG    YKG   
Sbjct: 45  AGTCGGISQVIVGQPFDTTKVRMQTSA------KSVGALDIIRKLVKNEGVWAFYKGSLI 98

Query: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLS--------ILSGASAGCCEAFVV 126
           P++      + +F  N+  ++ + RE+   + TQ            + G + G   +F+ 
Sbjct: 99  PIVGVGACVSVQFGVNEAMKRFF-REWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLA 157

Query: 127 VPFELVKIRLQDVSSS-----YKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYF 181
            P E V+IRLQ  + +     +KGP+D +RK++ ++ ++    GL   + R G     YF
Sbjct: 158 SPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKSLM---RGLRPMMLRAGHGLGCYF 214

Query: 182 GIIFQ--VRALLPEAKSKSQQTRNDLIA-GSIGGTIGSLMSTPFDVVKSRIQNTAVVAGG 238
            + ++  +   + + K +S+     L + GS+ G +  L   P DVVKS IQ   +    
Sbjct: 215 -LTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSMIQTDTLR--N 271

Query: 239 ARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
            R  N     I  +Y+E+G  A +KGF P +LR  P  G   V F
Sbjct: 272 PRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTF 316

 Score = 68.6 bits (166), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 85/181 (46%), Gaps = 13/181 (7%)

Query: 111 SILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTL 170
            IL+G   G  +  V  PF+  K+R+Q  + S  G +D++RK++  EGV A Y G    +
Sbjct: 42  DILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV-GALDIIRKLVKNEGVWAFYKGSLIPI 100

Query: 171 WRHGVWNAGYFGIIFQVRALLPE-AKSKSQQTRNDL-------IAGSIGGTIGSLMSTPF 222
              G   +  FG+   ++    E   S+  Q R+         I G  GG + S +++P 
Sbjct: 101 VGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNSFLASPI 160

Query: 223 DVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVV 282
           + V+ R+Q T    G  R++      I  + KE   ++L +G  P +LR G G G   + 
Sbjct: 161 EHVRIRLQ-TQTGNGNEREFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGHGLGCYFLT 216

Query: 283 F 283
           +
Sbjct: 217 Y 217

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/181 (21%), Positives = 76/181 (41%), Gaps = 22/181 (12%)

Query: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGI 72
           +  G   G+    +  P++ V+ R+Q Q   G   ++KG +DCI+++V ++    L +G+
Sbjct: 143 YICGLTGGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEKS---LMRGL 199

Query: 73  SSPVLMEAPKRATKFAC-----NDEFQKIYKR-EFGVEKLTQSLSILSGASAGCCEAFVV 126
              +L         F        +E +K   R E    KL        G+ +G      +
Sbjct: 200 RPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCS-----YGSLSGVVLWLAI 254

Query: 127 VPFELVKIRLQDVSSSYKGP------IDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGY 180
            P ++VK  +Q  + + + P       +V+  +  ++G+ A + G   T+ R    N   
Sbjct: 255 YPLDVVKSMIQ--TDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGAT 312

Query: 181 F 181
           F
Sbjct: 313 F 313

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 42/94 (44%), Gaps = 7/94 (7%)

Query: 198 SQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEG 257
           S +   D++AG+ GG    ++  PFD  K R+Q +A   G       +   I  + K EG
Sbjct: 36  STRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVG-------ALDIIRKLVKNEG 88

Query: 258 FRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFR 291
             A YKG +  ++ +G    +   V      FFR
Sbjct: 89  VWAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFR 122

>Scas_667.22
          Length = 306

 Score =  103 bits (258), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 82/289 (28%), Positives = 139/289 (48%), Gaps = 33/289 (11%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74
           AG   GI+++LV  P D  K R+Q   +          ++ I++++  EG    YKG  +
Sbjct: 31  AGTAGGIAQVLVGQPFDTTKVRLQTSSTP------TTAMEVIRKLLKNEGPKGFYKGTLT 84

Query: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSI----LSGASAGCCEAFVVVPFE 130
           P++      + +F  N+  ++ +      +  +Q LS+    + G + G   +F+  P E
Sbjct: 85  PLIGVGACVSLQFGVNEAMKRFFHSR-NPDSTSQILSLPQYYICGLTGGITNSFLASPIE 143

Query: 131 LVKIRLQDVSSS-----YKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIF 185
            V+IRLQ  + S     +KGP+D +RK+ AQ G +    GL  T+ R G     YF +++
Sbjct: 144 HVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFM---RGLTPTMLREGHGCGTYF-LVY 199

Query: 186 QVRALLPEAKSKSQQTRNDLIA------GSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGA 239
           +  A++    +K  + R ++ A      G++ GT   +M  P DV+KS +Q   +    +
Sbjct: 200 E--AMVANEINKGFK-RTEVPAWKLCLFGALSGTTLWMMVYPLDVIKSVMQTDNL---KS 253

Query: 240 RKYNWSWPSIF-TIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCM 287
            KY  S  S+  T+Y + G  A +KGF P +LR  P  G     F   M
Sbjct: 254 PKYGNSISSVAKTLYAKGGLGAFFKGFGPTMLRAAPANGATFATFELAM 302

 Score = 62.0 bits (149), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 82/179 (45%), Gaps = 13/179 (7%)

Query: 111 SILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTL 170
            +L+G + G  +  V  PF+  K+RLQ  SS+    ++V+RK++  EG    Y G  + L
Sbjct: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQ-TSSTPTTAMEVIRKLLKNEGPKGFYKGTLTPL 86

Query: 171 WRHGVWNAGYFGI------IFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDV 224
              G   +  FG+       F  R   P++ S+        I G  GG   S +++P + 
Sbjct: 87  IGVGACVSLQFGVNEAMKRFFHSRN--PDSTSQILSLPQYYICGLTGGITNSFLASPIEH 144

Query: 225 VKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
           V+ R+Q T   +G   ++      I  +  + GF    +G  P +LR G G G   +V+
Sbjct: 145 VRIRLQ-TQTGSGPNVEFKGPLDCIRKLRAQGGF---MRGLTPTMLREGHGCGTYFLVY 199

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 83/185 (44%), Gaps = 20/185 (10%)

Query: 7   LPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGAS 66
           LP +Y    G   GI+   +  P++ V+ R+Q Q   G   ++KG +DCI+++ A+ G  
Sbjct: 121 LPQYY--ICGLTGGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQGG-- 176

Query: 67  RLYKGISSPVLMEAPKRATKF-----ACNDEFQKIYKR-EFGVEKLTQSLSILSGASAGC 120
              +G++  +L E     T F        +E  K +KR E    KL      L GA +G 
Sbjct: 177 -FMRGLTPTMLREGHGCGTYFLVYEAMVANEINKGFKRTEVPAWKL-----CLFGALSGT 230

Query: 121 CEAFVVVPFELVKIRLQD---VSSSYKGPIDVVRKII-AQEGVLAMYNGLESTLWRHGVW 176
               +V P +++K  +Q     S  Y   I  V K + A+ G+ A + G   T+ R    
Sbjct: 231 TLWMMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLYAKGGLGAFFKGFGPTMLRAAPA 290

Query: 177 NAGYF 181
           N   F
Sbjct: 291 NGATF 295

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 37/81 (45%), Gaps = 7/81 (8%)

Query: 193 EAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTI 252
             K  + +   DL+AG+ GG    L+  PFD  K R+Q ++           +   I  +
Sbjct: 17  HPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT-------TAMEVIRKL 69

Query: 253 YKEEGFRALYKGFVPKVLRLG 273
            K EG +  YKG +  ++ +G
Sbjct: 70  LKNEGPKGFYKGTLTPLIGVG 90

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score =  103 bits (257), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 89/296 (30%), Positives = 137/296 (46%), Gaps = 36/296 (12%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74
           +G   GI+++LV  P D+ K RM  Q S G  P     ++ IK +V  EG    YKG   
Sbjct: 29  SGTSGGIAQVLVGQPFDITKVRM--QTSSG-SPT---AIEVIKNLVKNEGLLAFYKGTLV 82

Query: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILS----GASAGCCEAFVVVPFE 130
           P++      + +F  N+  ++ + R  G +   Q LS+L     G  +G   AF+  P E
Sbjct: 83  PLIGVGACVSCQFGVNEAMKRYFLRVNGYKD--QHLSLLQYYTCGFVSGSANAFLATPIE 140

Query: 131 LVKIRLQ-----DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWR--HGVWNAGYFGI 183
            V+IRLQ        + Y+G +D ++K++ Q+   A+  G  +TL R  HG      FG+
Sbjct: 141 HVRIRLQLQTKALAKAEYRGSLDCMKKLLKQK---ALMRGFTATLMRTSHG------FGV 191

Query: 184 IFQVRALLPEAKSKSQQTRNDL------IAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAG 237
            F     L   ++K+   R D+      + G+  G     M+ PFDVVKS +Q   +V+ 
Sbjct: 192 YFLTYEALIMNQNKNGVLRKDIPPWKVCVFGAFSGAFFWAMTYPFDVVKSIMQADRLVSP 251

Query: 238 GARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRTL 293
              K  +      +I+   G+ A  KGFVP +LR  P  G     F   M    +L
Sbjct: 252 VHGKNVFQVAK--SIHATRGWGAFVKGFVPTMLRSLPVNGATFATFEVTMRLLESL 305

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 83/177 (46%), Gaps = 10/177 (5%)

Query: 111 SILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTL 170
            I+SG S G  +  V  PF++ K+R+Q  SS     I+V++ ++  EG+LA Y G    L
Sbjct: 26  DIISGTSGGIAQVLVGQPFDITKVRMQ-TSSGSPTAIEVIKNLVKNEGLLAFYKGTLVPL 84

Query: 171 WRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDL---IAGSIGGTIGSLMSTPFDVVKS 227
              G   +  FG+   ++           Q  + L     G + G+  + ++TP + V+ 
Sbjct: 85  IGVGACVSCQFGVNEAMKRYFLRVNGYKDQHLSLLQYYTCGFVSGSANAFLATPIEHVRI 144

Query: 228 RIQ-NTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
           R+Q  T  +A    +Y  S   +  + K+   +AL +GF   ++R   G G+  + +
Sbjct: 145 RLQLQTKALAKA--EYRGSLDCMKKLLKQ---KALMRGFTATLMRTSHGFGVYFLTY 196

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 85/201 (42%), Gaps = 19/201 (9%)

Query: 7   LPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGAS 66
           L     +  G V+G +   +  P++ V+ R+QLQ       +Y+G +DC+K+++ ++   
Sbjct: 116 LSLLQYYTCGFVSGSANAFLATPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQKA-- 173

Query: 67  RLYKGISSPVLMEAPKRATKFAC------NDEFQKIYKREFGVEKLTQSLSILSGASAGC 120
            L +G ++ ++  +      F        N     + +++    K+      + GA +G 
Sbjct: 174 -LMRGFTATLMRTSHGFGVYFLTYEALIMNQNKNGVLRKDIPPWKVC-----VFGAFSGA 227

Query: 121 CEAFVVVPFELVKIRLQD---VSSSY-KGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVW 176
               +  PF++VK  +Q    VS  + K    V + I A  G  A   G   T+ R    
Sbjct: 228 FFWAMTYPFDVVKSIMQADRLVSPVHGKNVFQVAKSIHATRGWGAFVKGFVPTMLRSLPV 287

Query: 177 NAGYFGIIFQVRALLPEAKSK 197
           N   F   F+V   L E+  K
Sbjct: 288 NGATFA-TFEVTMRLLESLDK 307

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score =  103 bits (258), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 73/270 (27%), Positives = 126/270 (46%), Gaps = 17/270 (6%)

Query: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGI 72
           F +G  +GI++  V +P D +K R+Q         ++KG +DC+ +   ++G    Y G 
Sbjct: 64  FVSGMFSGIAKNAVGHPFDTIKVRLQTSQDS---TRFKGPLDCVYKTFTQQGIRGFYLGF 120

Query: 73  SSPVLMEAPKRATKFACNDEFQKIYKRE--FGVEKLTQSLSILSGASAGCCEAFVVVPFE 130
           + P++      +    C   ++ + K+   +  EKL  S  I+SG  AG   +F+  P E
Sbjct: 121 TPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFIAAPVE 180

Query: 131 LVKIRLQ----DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQ 186
           L K +LQ      ++ Y GP+DV++K+ +  GV  +Y GL STL      N  ++   ++
Sbjct: 181 LAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIFRT--NFVFWWGSYE 238

Query: 187 VRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMST-PFDVVKSRIQNTAVVAGGARKYNWS 245
           +     +  +    T  +  +G    + G   +  P DV+K  +       G  R    S
Sbjct: 239 LLTRWFKEHTNMSDTAINFWSGGFSASFGFWTTAYPSDVIKQVVLCNDKYDGTFR----S 294

Query: 246 WP-SIFTIYKEEGFRALYKGFVPKVLRLGP 274
           W  +   I++  G+R  +KGFVP  LR  P
Sbjct: 295 WKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 83/174 (47%), Gaps = 11/174 (6%)

Query: 104 EKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDV--SSSYKGPIDVVRKIIAQEGVLA 161
           E  ++ +  +SG  +G  +  V  PF+ +K+RLQ    S+ +KGP+D V K   Q+G+  
Sbjct: 56  EAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRG 115

Query: 162 MYNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQT---RNDLIAGSIGGTIGSLM 218
            Y G    L    + ++   G +   R LL +    +++       +I+G + G   S +
Sbjct: 116 FYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGWSVSFI 175

Query: 219 STPFDVVKSRIQNTAVVAGGARKYNWSWP--SIFTIYKEEGFRALYKGFVPKVL 270
           + P ++ K+++Q    V   A+   ++ P   I  +Y   G R LYKG    ++
Sbjct: 176 AAPVELAKAKLQ----VQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLI 225

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score =  102 bits (254), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 85/285 (29%), Positives = 133/285 (46%), Gaps = 24/285 (8%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSG-GLGPQYKGVVDCIKQIVAKEGASRLYKGIS 73
           AG  AG+ E L  +PLD +K RMQ+  +  G G +  G +    +I   EG    YKG+ 
Sbjct: 16  AGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLG 75

Query: 74  SPVLMEAPKRATKFACNDEFQKIY-KREFGVEKLTQSLSILSGASAGCCEAFVVVPFELV 132
           + V+   PK A +F+  + ++ +   +E G  K++   + ++G  AG  EA VVV    V
Sbjct: 76  AVVIGITPKMAIRFSSYEFYRTLLADKETG--KVSTGNTFIAGVGAGITEAVVVVNPMEV 133

Query: 133 -KIRLQ-------DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGII 184
            KIRLQ       + +  YK  +     I+ +EG  A+Y G+  T  R        F + 
Sbjct: 134 VKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVY 193

Query: 185 FQVRALLPEAKSKSQ-QTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYN 243
            +++  L    ++    +    + G I G IG   + P D +K+R+Q            N
Sbjct: 194 SKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQKDKSTK------N 247

Query: 244 WSWPSIFTIY-----KEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
            S     TI      +EEGFRALYKG  P+V+R+ PG  +    +
Sbjct: 248 MSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFTAY 292

 Score = 59.3 bits (142), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 87/191 (45%), Gaps = 8/191 (4%)

Query: 109 SLSILSGASAGCCEAFVVVPFELVKIRLQ----DVSSSYKGP--IDVVRKIIAQEGVLAM 162
           ++++++G  AG  E     P + +K+R+Q     V S  K P  I    +I   EG LA 
Sbjct: 11  AVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAF 70

Query: 163 YNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGG-TIGSLMSTP 221
           Y GL + +       A  F      R LL + ++    T N  IAG   G T   ++  P
Sbjct: 71  YKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAVVVVNP 130

Query: 222 FDVVKSRIQNTAVV-AGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILL 280
            +VVK R+Q   +    GA KY  +  + +TI KEEGF ALY+G      R     G   
Sbjct: 131 MEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANF 190

Query: 281 VVFTGCMDFFR 291
            V++   +F +
Sbjct: 191 TVYSKLKEFLQ 201

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 82/170 (48%), Gaps = 12/170 (7%)

Query: 13  FAAGAVAGISE-ILVMYPLDVVKTRMQLQ----VSGGLGPQYKGVVDCIKQIVAKEGASR 67
           F AG  AGI+E ++V+ P++VVK R+Q Q    V G   P+YK  V     IV +EG S 
Sbjct: 113 FIAGVGAGITEAVVVVNPMEVVKIRLQAQHLNPVEGA--PKYKNAVQACYTIVKEEGFSA 170

Query: 68  LYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVV 127
           LY+G+S     +A  +   F    + ++  +     E L    + L G  +G    F   
Sbjct: 171 LYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNA 230

Query: 128 PFELVKIRLQDVSSS-----YKGPIDVVRKIIAQEGVLAMYNGLESTLWR 172
           P + +K RLQ   S+      K    + +++I +EG  A+Y G+   + R
Sbjct: 231 PLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMR 280

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 44/100 (44%), Gaps = 4/100 (4%)

Query: 194 AKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIY 253
           +K KS     +LIAG   G +  L   P D +K R+Q      G   K      +   IY
Sbjct: 3   SKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIY 62

Query: 254 KEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRTL 293
           + EGF A YKG    V+ + P   I    +    +F+RTL
Sbjct: 63  RNEGFLAFYKGLGAVVIGITPKMAIRFSSY----EFYRTL 98

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 35/67 (52%)

Query: 29  PLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRATKFA 88
           PLD +KTR+Q   S       K +    KQ++ +EG   LYKGI+  V+  AP +A  F 
Sbjct: 231 PLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTFT 290

Query: 89  CNDEFQK 95
             +  +K
Sbjct: 291 AYEFIRK 297

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score =  102 bits (254), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 75/271 (27%), Positives = 127/271 (46%), Gaps = 19/271 (7%)

Query: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGI 72
           F AG  +G+++  V +P D +K R+Q   +     ++KG +DC+ +    +G    Y G 
Sbjct: 27  FVAGVFSGVAKNAVGHPFDTIKVRLQTSQNE---TRFKGPLDCVYKTFRNQGIRGFYLGF 83

Query: 73  SSPVLMEAPKRATKFACNDEFQKIYKREF--GVEKLTQSLSILSGASAGCCEAFVVVPFE 130
           + P++      +    C   ++ +  +      EKL  S  I+SG  AG   +F+  P E
Sbjct: 84  TPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFIAPPIE 143

Query: 131 LVKIRLQ----DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTL--WRHGVWNAGYFGII 184
           L K +LQ      ++ YKGP+DV++KI + +G+  +Y GL STL    H V+  G + ++
Sbjct: 144 LAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLIFRTHFVYWWGSYELL 203

Query: 185 FQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMST-PFDVVKSRIQNTAVVAGGARKYN 243
              R       +K  +   +  AG    + G   +  P DVVK  +       G  + + 
Sbjct: 204 --TRWF--RENTKMSEAAINFWAGGFSASFGFWTTAYPSDVVKQVVLCNDKYDGSFKSWR 259

Query: 244 WSWPSIFTIYKEEGFRALYKGFVPKVLRLGP 274
               ++  IY+ +G    +KGFVP  LR  P
Sbjct: 260 ---TAVKDIYQSKGINGFFKGFVPSFLRSFP 287

 Score = 53.5 bits (127), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 78/172 (45%), Gaps = 7/172 (4%)

Query: 104 EKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSS--YKGPIDVVRKIIAQEGVLA 161
           E  ++ +  ++G  +G  +  V  PF+ +K+RLQ   +   +KGP+D V K    +G+  
Sbjct: 19  ETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRG 78

Query: 162 MYNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQT---RNDLIAGSIGGTIGSLM 218
            Y G    L    + ++   G +   R L+ +    + +       +I+G + G   S +
Sbjct: 79  FYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVLAGWSVSFI 138

Query: 219 STPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVL 270
           + P ++ K+++Q          +Y      I  IY  +G R LYKG +  ++
Sbjct: 139 APPIELAKAKLQ--VQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188

>Kwal_23.4354
          Length = 343

 Score =  102 bits (254), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 83/333 (24%), Positives = 142/333 (42%), Gaps = 55/333 (16%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQ---------VSGGLGPQ-------------- 48
           +  +  V  +   L++ P+DVV+ R+Q Q            GL  +              
Sbjct: 14  RLLSAVVGSLLTSLILTPMDVVRIRLQQQKMLPDCGCETDAGLTSRASSKGVFWQDICFE 73

Query: 49  ----------YKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYK 98
                     Y    D   +I   EG   L++G+S  +LM AP     F     ++ +  
Sbjct: 74  DVRCKTSPVRYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFI---GYESLRD 130

Query: 99  REFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSS---------YKGPIDV 149
           +    +K      ++ GA A    A  V P EL + RLQ +  S          K  I  
Sbjct: 131 KSRLQDKYPTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIKE 190

Query: 150 VRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGI---------IFQVRALLPEAKSKSQQ 200
            R  I++ G  A++ GLE TLWR   +++ Y+G          I   ++++  + S    
Sbjct: 191 SRYEISKVGYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNVSIDSEKSIVNSSNSNWNH 250

Query: 201 TRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWS-WPSIFTIYKEEGFR 259
             N  + GS GG + ++++ PFDV K+R+Q T + +   +K + + +  +  + K EG  
Sbjct: 251 FVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLA 310

Query: 260 ALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRT 292
           ALY G VP+V+++ P   I++  +  C   F T
Sbjct: 311 ALYTGLVPRVIKIAPSCAIMISTYEVCKRLFST 343

 Score = 35.0 bits (79), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 75/182 (41%), Gaps = 27/182 (14%)

Query: 8   PFFYQFAAGAVAGISEILVMYPLDVVKTRMQ-LQVSGGLGPQYKGVVDCIKQI---VAKE 63
           P       GA+A +     + PL++ +TR+Q +  S         + D IK+    ++K 
Sbjct: 139 PTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIKESRYEISKV 198

Query: 64  GASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSL------------S 111
           G   L++G+   +  + P  +  + C +     YK    ++     +            S
Sbjct: 199 GYKALFRGLEITLWRDVPFSSIYWGCYE----FYKSNVSIDSEKSIVNSSNSNWNHFVNS 254

Query: 112 ILSGASAGCCEAFVVVPFELVKIRLQDV---SSSYKGPIDVVRKIIAQ----EGVLAMYN 164
            + G+  G   A +  PF++ K R+Q     S+  K P   + K + Q    EG+ A+Y 
Sbjct: 255 FVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLAALYT 314

Query: 165 GL 166
           GL
Sbjct: 315 GL 316

 Score = 35.0 bits (79), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 44/91 (48%), Gaps = 2/91 (2%)

Query: 9   FFYQFAAGAVAGISEILVMYPLDVVKTRMQLQ-VSGGLGPQ-YKGVVDCIKQIVAKEGAS 66
           F   F  G+  G    ++ +P DV KTRMQ+  ++  L  +  K +   + Q+   EG +
Sbjct: 251 FVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLA 310

Query: 67  RLYKGISSPVLMEAPKRATKFACNDEFQKIY 97
            LY G+   V+  AP  A   +  +  ++++
Sbjct: 311 ALYTGLVPRVIKIAPSCAIMISTYEVCKRLF 341

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 28/133 (21%), Positives = 51/133 (38%), Gaps = 32/133 (24%)

Query: 191 LPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVV--------AG----- 237
           + + K K    +  L++  +G  + SL+ TP DVV+ R+Q   ++        AG     
Sbjct: 1   MADEKQKGIGLKERLLSAVVGSLLTSLILTPMDVVRIRLQQQKMLPDCGCETDAGLTSRA 60

Query: 238 -------------------GARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGI 278
                                 +YN +W +   I K EG ++L++G    +L   P   +
Sbjct: 61  SSKGVFWQDICFEDVRCKTSPVRYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMV 120

Query: 279 LLVVFTGCMDFFR 291
             + +    D  R
Sbjct: 121 YFIGYESLRDKSR 133

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score =  102 bits (253), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 80/292 (27%), Positives = 134/292 (45%), Gaps = 35/292 (11%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74
           AG + G++++LV  P D  K R+Q   +        GV++ ++ ++  EGA   YKG+ +
Sbjct: 32  AGTMGGVAQVLVGQPFDTTKVRLQTSKTK------IGVIEVVQNLLRNEGALAFYKGMLT 85

Query: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSI--------LSGASAGCCEAFVV 126
           P+L      + +F  N+  ++ +   +  +++     +        L G + G   +F+ 
Sbjct: 86  PLLGVGICVSVQFGVNESMKRFFA-AYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLA 144

Query: 127 VPFELVKIRLQDVSSS-----YKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYF 181
            P E V+IRLQ  +S      +KGP D ++K+   +   A+  GL  T+ R G     YF
Sbjct: 145 APIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK---ALMRGLLPTMIRAGHGLGTYF 201

Query: 182 GIIFQVRALLPEAKSKSQQTRNDLIA------GSIGGTIGSLMSTPFDVVKSRIQNTAVV 235
                  AL+ +   K    RN + A      G++ GTI  L   P DVVKS +Q  ++ 
Sbjct: 202 A---AYEALVVKEFEKGT-PRNQIPAWKLCSFGALSGTILWLTVYPVDVVKSVLQTDSI- 256

Query: 236 AGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCM 287
               +  N    +   +YK+ G  A +KGFVP ++R  P      V F   M
Sbjct: 257 -ENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFEMTM 307

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 82/181 (45%), Gaps = 13/181 (7%)

Query: 111 SILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTL 170
            I +G   G  +  V  PF+  K+RLQ  S +  G I+VV+ ++  EG LA Y G+ + L
Sbjct: 29  DIFAGTMGGVAQVLVGQPFDTTKVRLQ-TSKTKIGVIEVVQNLLRNEGALAFYKGMLTPL 87

Query: 171 WRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDL--------IAGSIGGTIGSLMSTPF 222
              G+  +  FG+   ++       +     +  +        + G  GG + S ++ P 
Sbjct: 88  LGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLTGGVVNSFLAAPI 147

Query: 223 DVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVV 282
           + V+ R+Q T    G  R++   +  I  + K    +AL +G +P ++R G G G     
Sbjct: 148 EHVRIRLQ-TQTSQGNERQFKGPFDCIKKLAKA---KALMRGLLPTMIRAGHGLGTYFAA 203

Query: 283 F 283
           +
Sbjct: 204 Y 204

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 80/186 (43%), Gaps = 18/186 (9%)

Query: 6   PLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGA 65
           PLP    +  G   G+    +  P++ V+ R+Q Q S G   Q+KG  DCIK++     A
Sbjct: 123 PLPLHQYYLCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAK---A 179

Query: 66  SRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILS------GASAG 119
             L +G+   ++       T FA    ++ +  +EF  EK T    I +      GA +G
Sbjct: 180 KALMRGLLPTMIRAGHGLGTYFAA---YEALVVKEF--EKGTPRNQIPAWKLCSFGALSG 234

Query: 120 CCEAFVVVPFELVKIRLQDVS---SSYKGP-IDVVRKIIAQEGVLAMYNGLESTLWRHGV 175
                 V P ++VK  LQ  S     YK   I   R +  Q G+ A + G   T+ R   
Sbjct: 235 TILWLTVYPVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAP 294

Query: 176 WNAGYF 181
            NA  F
Sbjct: 295 ANAATF 300

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score =  101 bits (252), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 85/282 (30%), Positives = 132/282 (46%), Gaps = 29/282 (10%)

Query: 13  FAAGAVAGISEILVMYPLDVVKTRMQL-QVSGGLGPQYKGVVDCIKQIVAKEGASRLYKG 71
           F AG  +G+++  V +P D VK R+Q  QV  G G Q+KG +DC+ + +  +G   LY G
Sbjct: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72

Query: 72  ISSP----VLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVV 127
            + P    ++M++    +         K    E   +KL  S  I+SG  AG   +F+  
Sbjct: 73  FTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEH--DKLPLSGCIISGVMAGWTVSFIAA 130

Query: 128 PFELVKIRLQ----DVSSSYKGPIDVVRKIIAQ--------EGVLAMYNGLESTL-WRHG 174
           P EL K +LQ      ++ Y GPIDVV+K+  Q         GV ++Y GL STL +R  
Sbjct: 131 PVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRSN 190

Query: 175 -VWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMST-PFDVVKSRIQNT 232
            V+  G + +I Q      +  +       +  AG +  + G   S  P DVVK  +   
Sbjct: 191 FVFWWGSYELITQ----WFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVKQVVLCN 246

Query: 233 AVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGP 274
               G  + +     ++  IY++ G    +KGF+P  LR  P
Sbjct: 247 DKYDGSFKSWR---TAVSDIYRQRGIHGFFKGFLPSFLRSFP 285

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 87/186 (46%), Gaps = 23/186 (12%)

Query: 104 EKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQ--DVSS----SYKGPIDVVRKIIAQE 157
           E  ++ +  ++G  +G  +  V  PF+ VK+RLQ   V S     +KGP+D V K +  +
Sbjct: 5   ETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQ 64

Query: 158 GVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLPE---AKSKSQQTRNDLIAGSIGGTI 214
           G+  +Y G    L+   + ++   G +   R LL +    +         +I+G + G  
Sbjct: 65  GIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWT 124

Query: 215 GSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWP--SIFTIYKE--------EGFRALYKG 264
            S ++ P ++ K+++Q    V   A+   ++ P   +  ++K+         G R+LYKG
Sbjct: 125 VSFIAAPVELAKAKLQ----VQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKG 180

Query: 265 FVPKVL 270
            +  ++
Sbjct: 181 LISTLI 186

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score =  100 bits (250), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 78/288 (27%), Positives = 128/288 (44%), Gaps = 28/288 (9%)

Query: 10  FYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLY 69
           F    AG   G+S++L+  P D  K R+Q        P     +D +K++V  EG    Y
Sbjct: 24  FKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSV----PTT--ALDVVKKLVKNEGFRGFY 77

Query: 70  KGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILS----GASAGCCEAFV 125
           KG  +P++      + +F  N+  ++ +    G     ++L +L     G + G   +F+
Sbjct: 78  KGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFL 137

Query: 126 VVPFELVKIRLQD-----VSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRH----GVW 176
             P E V+IRLQ       ++ + GP+D ++K+ A     ++  GL  T+ R     GV+
Sbjct: 138 ASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKKLTANN---SLMRGLTPTMLRESHGCGVY 194

Query: 177 NAGYFGIIFQVRALLPEAKSKSQ-QTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVV 235
              Y  +I      L +  S+S+  T    + G+  GT   LM  P DV+KS +Q  +++
Sbjct: 195 FLTYEALIANE---LHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTDSLL 251

Query: 236 AGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
                K         TIY   G  + +KGF P +LR  P  G     F
Sbjct: 252 QPKQGKNMLQVAK--TIYSTRGLSSFFKGFGPTMLRAAPANGATFATF 297

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 39/81 (48%), Gaps = 7/81 (8%)

Query: 193 EAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTI 252
           +    S +   DL+AG+ GG    L+  PFD  K R+Q ++V          +   +  +
Sbjct: 15  DGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVP-------TTALDVVKKL 67

Query: 253 YKEEGFRALYKGFVPKVLRLG 273
            K EGFR  YKG +  ++ +G
Sbjct: 68  VKNEGFRGFYKGTLTPLVGVG 88

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score =  101 bits (251), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 87/305 (28%), Positives = 142/305 (46%), Gaps = 47/305 (15%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74
           AG + GI+++LV  P D  K R+Q   +          ++ ++ +V  EG    YKG  +
Sbjct: 40  AGTIGGIAQVLVGQPFDTTKVRLQTATT------RTTTLEVLRNLVKNEGVFAFYKGALT 93

Query: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVEK---------LTQSLSI------LSGASAG 119
           P+L      + +F  N+  ++ ++     +          L++S ++      + G + G
Sbjct: 94  PLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGG 153

Query: 120 CCEAFVVVPFELVKIRLQDVSSS-----YKGPIDVVRKIIAQEGVLAMYNGLESTLWR-- 172
              +F+  P E ++IRLQ  +S+     +KGP D ++K+ AQ G++    GL  T+ R  
Sbjct: 154 VVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQGGLM---RGLFPTMIRAG 210

Query: 173 HGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDL------IAGSIGGTIGSLMSTPFDVVK 226
           HG+      G  F V   L   +  +  TRN++      + G+  GT+  L   P DVVK
Sbjct: 211 HGL------GTYFLVYEALVAREIGTGLTRNEIPPWKLCLFGAFSGTMLWLTVYPLDVVK 264

Query: 227 SRIQNTAVVAGGARKYNWSWPSIF-TIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTG 285
           S IQN  +      KY  S   +  TIY +EG RA +KGF P ++R  P  G   + F  
Sbjct: 265 SIIQNDDLRK---PKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPVNGATFLTFEL 321

Query: 286 CMDFF 290
            M F 
Sbjct: 322 VMRFL 326

 Score = 65.5 bits (158), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 100/226 (44%), Gaps = 28/226 (12%)

Query: 74  SPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVK 133
           +P L++  +   K    +E     KRE    ++ +   I +G   G  +  V  PF+  K
Sbjct: 7   TPQLLDELEDQQKVTTPNE-----KRELSSNRVLKD--IFAGTIGGIAQVLVGQPFDTTK 59

Query: 134 IRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGI------IFQV 187
           +RLQ  ++     ++V+R ++  EGV A Y G  + L   G+  +  FG+       FQ 
Sbjct: 60  VRLQTATTRTTT-LEVLRNLVKNEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQN 118

Query: 188 RALLPEAKSKSQQ---TRNDL-------IAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAG 237
                     SQ    +R++        + G  GG + S +++P + ++ R+Q T    G
Sbjct: 119 YNASKNPNMSSQDVDLSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQ-TQTSNG 177

Query: 238 GARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
           G R++   W  I  +  + G   L +G  P ++R G G G   +V+
Sbjct: 178 GDREFKGPWDCIKKLKAQGG---LMRGLFPTMIRAGHGLGTYFLVY 220

 Score = 59.7 bits (143), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 82/189 (43%), Gaps = 14/189 (7%)

Query: 1   MTDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIV 60
           ++ +  LP    +  G   G+    +  P++ ++ R+Q Q S G   ++KG  DCIK++ 
Sbjct: 134 LSRSNTLPLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLK 193

Query: 61  AKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLS----ILSGA 116
           A+ G   L +G+   ++       T F     ++ +  RE G       +      L GA
Sbjct: 194 AQGG---LMRGLFPTMIRAGHGLGTYFLV---YEALVAREIGTGLTRNEIPPWKLCLFGA 247

Query: 117 SAGCCEAFVVVPFELVKIRLQDVS---SSYKGPIDVVRKII-AQEGVLAMYNGLESTLWR 172
            +G      V P ++VK  +Q+       YK  I  V K I A+EG+ A + G   T+ R
Sbjct: 248 FSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVR 307

Query: 173 HGVWNAGYF 181
               N   F
Sbjct: 308 SAPVNGATF 316

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score =  100 bits (248), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 83/292 (28%), Positives = 131/292 (44%), Gaps = 34/292 (11%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74
           AG   GI+++L+  P D  K R+Q               + +K ++  EG    YKG  +
Sbjct: 31  AGTAGGIAQVLIGQPFDTTKVRLQTSKVP------TSAAEVVKNLLKNEGPKGFYKGTLT 84

Query: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLS--ILSGASAGCCEAFVVVPFELV 132
           P++      + +F  N+  ++ +         T SLS   L G + G   +F+  P E V
Sbjct: 85  PLVGVGACVSIQFGVNEAMKRFFHARNVDHNATLSLSQYYLCGLTGGMTNSFLASPIEHV 144

Query: 133 KIRLQDVSSS-----YKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQV 187
           +IRLQ  + S     +KGPID ++K+ +Q+G++    GL  T+ R G     YF ++++ 
Sbjct: 145 RIRLQTQTGSGAQAEFKGPIDCIKKLRSQKGLM---RGLIPTMLREGHGCGTYF-LVYE- 199

Query: 188 RALLPEAKSKSQQTRNDLIA-------GSIGGTIGSLMSTPFDVVKSRIQ--NTAVVAGG 238
            AL+  +K  +Q  +   I        G++ GT   LM  P DVVKS +Q  N      G
Sbjct: 200 -ALV--SKQINQGLKRTEIPPWKLCLYGALSGTALWLMVYPIDVVKSVMQTDNLNKPQNG 256

Query: 239 ARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFF 290
                 +      +Y  EG +A +KGF P +LR  P  G     F   M   
Sbjct: 257 KNMIQVAR----NLYAREGLKAFFKGFGPTMLRAAPANGGTFATFELAMRLL 304

 Score = 62.0 bits (149), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 82/179 (45%), Gaps = 18/179 (10%)

Query: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGI 72
           +  G   G++   +  P++ V+ R+Q Q   G   ++KG +DCIK++ +++G   L +G+
Sbjct: 124 YLCGLTGGMTNSFLASPIEHVRIRLQTQTGSGAQAEFKGPIDCIKKLRSQKG---LMRGL 180

Query: 73  SSPVLMEAPKRATKFACNDEF------QKIYKREFGVEKLTQSLSILSGASAGCCEAFVV 126
              +L E     T F   +        Q + + E    KL      L GA +G     +V
Sbjct: 181 IPTMLREGHGCGTYFLVYEALVSKQINQGLKRTEIPPWKL-----CLYGALSGTALWLMV 235

Query: 127 VPFELVKIRLQ----DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYF 181
            P ++VK  +Q    +   + K  I V R + A+EG+ A + G   T+ R    N G F
Sbjct: 236 YPIDVVKSVMQTDNLNKPQNGKNMIQVARNLYAREGLKAFFKGFGPTMLRAAPANGGTF 294

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 76/179 (42%), Gaps = 14/179 (7%)

Query: 111 SILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTL 170
            +L+G + G  +  +  PF+  K+RLQ  S       +VV+ ++  EG    Y G  + L
Sbjct: 28  DLLAGTAGGIAQVLIGQPFDTTKVRLQ-TSKVPTSAAEVVKNLLKNEGPKGFYKGTLTPL 86

Query: 171 WRHGVWNAGYFGI------IFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDV 224
              G   +  FG+       F  R +   A     Q     + G  GG   S +++P + 
Sbjct: 87  VGVGACVSIQFGVNEAMKRFFHARNVDHNATLSLSQY---YLCGLTGGMTNSFLASPIEH 143

Query: 225 VKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
           V+ R+Q      G   +  +  P I  I K    + L +G +P +LR G G G   +V+
Sbjct: 144 VRIRLQTQ---TGSGAQAEFKGP-IDCIKKLRSQKGLMRGLIPTMLREGHGCGTYFLVY 198

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score =  100 bits (249), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 85/300 (28%), Positives = 132/300 (44%), Gaps = 31/300 (10%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQ---LQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKG 71
           +GA++G    +++ P DV KTR+Q   LQ        YKG       I   EGA+ LYKG
Sbjct: 44  SGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYKG 103

Query: 72  ISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGAS----AGCCEAFVVV 127
           +   VL   P     F+  D     + R++ V+    S   LS AS    AG        
Sbjct: 104 LQPTVLGYIPTLMIYFSVYD-----FCRKYSVDIFPHS-PFLSNASSAITAGAISTVATN 157

Query: 128 PFELVKIRLQ------DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYF 181
           P  +VK RL         S+ YKG ID  RKII QEG  A+Y GL   L   G+ N    
Sbjct: 158 PIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALL--GMLNVAIQ 215

Query: 182 GIIFQ---VRALLPEAKSKSQQTRND-----LIAGSIGGTIGSLMSTPFDVVKSRIQNTA 233
             +++   +R    E+   S    +      ++A  +   + S ++ P +++++R+Q  +
Sbjct: 216 FPLYENLKIRFGYSESTDVSTDVTSSNFQKLILASMLSKMVASTVTYPHEILRTRMQLKS 275

Query: 234 VVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRTL 293
            +    +++    P I   Y++EGF   Y GF   ++R  P   + LV F     +  T 
Sbjct: 276 DLPNTVQRH--LLPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSFEYSKKYLTTF 333

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 80/180 (44%), Gaps = 20/180 (11%)

Query: 8   PFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVS-GGLGPQYKGVVDCIKQIVAKEGAS 66
           PF    ++   AG    +   P+ VVKTR+ LQ   G     YKG +D  ++I+ +EGA 
Sbjct: 137 PFLSNASSAITAGAISTVATNPIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAK 196

Query: 67  RLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLS----------ILSGA 116
            LY G+  P L+     A +F   +      K  FG  + T   +          IL+  
Sbjct: 197 ALYAGL-VPALLGMLNVAIQFPLYENL----KIRFGYSESTDVSTDVTSSNFQKLILASM 251

Query: 117 SAGCCEAFVVVPFELVKIRLQ---DVSSSY-KGPIDVVRKIIAQEGVLAMYNGLESTLWR 172
            +    + V  P E+++ R+Q   D+ ++  +  + +++    QEG    Y+G  + L R
Sbjct: 252 LSKMVASTVTYPHEILRTRMQLKSDLPNTVQRHLLPLIKITYRQEGFAGFYSGFATNLVR 311

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 73/170 (42%), Gaps = 17/170 (10%)

Query: 113 LSGASAGCCEAFVVVPFELVKIRLQ--------DVSSSYKGPIDVVRKIIAQEGVLAMYN 164
           +SGA +G   A +V PF++ K RLQ          S  YKG       I   EG   +Y 
Sbjct: 43  ISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYK 102

Query: 165 GLESTLWRHGVWNAGYFGIIFQVRA----LLPEAKSKSQQTRNDLIAGSIGGTIGSLMST 220
           GL+ T+  +      YF +    R     + P +   S  +     +    G I ++ + 
Sbjct: 103 GLQPTVLGYIPTLMIYFSVYDFCRKYSVDIFPHSPFLSNAS-----SAITAGAISTVATN 157

Query: 221 PFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVL 270
           P  VVK+R+     +   +  Y  +  +   I ++EG +ALY G VP +L
Sbjct: 158 PIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALL 207

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 49/95 (51%), Gaps = 2/95 (2%)

Query: 197 KSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAV--VAGGARKYNWSWPSIFTIYK 254
           K+   R   I+G++ G + +++  PFDV K+R+Q   +  +   ++ Y   + +  TI+K
Sbjct: 34  KNADPRVAAISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFK 93

Query: 255 EEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDF 289
           +EG   LYKG  P VL   P   I   V+  C  +
Sbjct: 94  DEGAAGLYKGLQPTVLGYIPTLMIYFSVYDFCRKY 128

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 99.4 bits (246), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 80/288 (27%), Positives = 133/288 (46%), Gaps = 30/288 (10%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74
           AG   GI+++LV  P D  K R+Q   +          ++ +++++A EG    YKG  +
Sbjct: 31  AGTAGGIAQVLVGQPFDTTKVRLQTSSTP------TTAMEVVRKLLANEGPRGFYKGTLT 84

Query: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLS--ILSGASAGCCEAFVVVPFELV 132
           P++      + +F  N+  ++ +         T SL      G + G   +F+  P E V
Sbjct: 85  PLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHV 144

Query: 133 KIRLQDVSSS-----YKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQV 187
           +IRLQ  + S     +KGP++ ++K+   +   A+  GL  T+ R G     YF ++++ 
Sbjct: 145 RIRLQTQTGSGTNAEFKGPLECIKKLRHNK---ALLRGLTPTILREGHGCGTYF-LVYE- 199

Query: 188 RALLPEAKSKSQQ-TRNDL------IAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGAR 240
            AL+    +K +   R D+      I G++ GT   LM  P DV+KS +Q   +      
Sbjct: 200 -ALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQK---P 255

Query: 241 KYNWSWPSIF-TIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCM 287
           K+  S  S+  T+Y   G  A +KGF P +LR  P  G     F   M
Sbjct: 256 KFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELAM 303

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 80/176 (45%), Gaps = 8/176 (4%)

Query: 111 SILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTL 170
            +L+G + G  +  V  PF+  K+RLQ  SS+    ++VVRK++A EG    Y G  + L
Sbjct: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQ-TSSTPTTAMEVVRKLLANEGPRGFYKGTLTPL 86

Query: 171 WRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRN---DLIAGSIGGTIGSLMSTPFDVVKS 227
              G   +  FG+   ++       +    T +       G  GG + S +++P + V+ 
Sbjct: 87  IGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRI 146

Query: 228 RIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
           R+Q      G      +  P +  I K    +AL +G  P +LR G G G   +V+
Sbjct: 147 RLQTQ---TGSGTNAEFKGP-LECIKKLRHNKALLRGLTPTILREGHGCGTYFLVY 198

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 85/192 (44%), Gaps = 20/192 (10%)

Query: 1   MTDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIV 60
           M+    LP +Y  A G   GI    +  P++ V+ R+Q Q   G   ++KG ++CIK++ 
Sbjct: 114 MSSTLSLPQYY--ACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLR 171

Query: 61  AKEGASRLYKGISSPVLMEAPKRATKFACNDEF--QKIYKREFGVEKL---TQSLSILSG 115
             +    L +G++  +L E     T F   +     ++ KR  G+E+       L I  G
Sbjct: 172 HNKA---LLRGLTPTILREGHGCGTYFLVYEALIANQMNKRR-GLERKDIPAWKLCIF-G 226

Query: 116 ASAGCCEAFVVVPFELVKIRLQDVSSSYKGP------IDVVRKIIAQEGVLAMYNGLEST 169
           A +G     +V P +++K  +Q  + + + P        V + + A  G+ A + G   T
Sbjct: 227 ALSGTALWLMVYPLDVIKSVMQ--TDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPT 284

Query: 170 LWRHGVWNAGYF 181
           + R    N   F
Sbjct: 285 MLRAAPANGATF 296

>Scas_709.9
          Length = 365

 Score = 99.8 bits (247), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 81/297 (27%), Positives = 141/297 (47%), Gaps = 32/297 (10%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQ-VSGGLGPQYKGVVDCIKQIVAKEGASRLYKGIS 73
           +GA+AG    +++ PLDV KTR+Q Q +     P Y+GV+  +  IV  EG   LYKG+ 
Sbjct: 70  SGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGLYKGLI 129

Query: 74  SPVLMEAPKRATKFACNDEFQKIYKREF-GVEKLTQSLSILSGASAGCCEAFVVVPFELV 132
             +L   P     F+  +  + +Y R     + ++ S S ++   AG     +  P  +V
Sbjct: 130 PIILGYFPTWMIYFSVYEFAKDLYPRVLPNSDFISHSCSAIT---AGAASTVLTNPIWVV 186

Query: 133 KIRLQ------DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWN-AGYFGIIF 185
           K RL       +  + Y+G ID  +KII QEGV  +Y GL  +++  G+ + A +F +  
Sbjct: 187 KTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMF--GLLHVAIHFPVYE 244

Query: 186 QVRALL--------PEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQ--NTAVV 235
           +++  L          ++  S      +IA S    + S+++ P +++++R+Q  +  ++
Sbjct: 245 KLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILRTRMQLKSDKLL 304

Query: 236 AGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRT 292
               +  +     I   Y+ EG    Y GF   +LR  P   I LV F    ++FR 
Sbjct: 305 ISKHKLLDL----IKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSF----EYFRN 353

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 83/186 (44%), Gaps = 22/186 (11%)

Query: 5   RPLP---FFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLG-PQYKGVVDCIKQIV 60
           R LP   F     +   AG +  ++  P+ VVKTR+ LQ   G     Y+G +D  K+I+
Sbjct: 155 RVLPNSDFISHSCSAITAGAASTVLTNPIWVVKTRLMLQTPLGESRTHYRGTIDAFKKII 214

Query: 61  AKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREF------GVEKLTQSLS--- 111
            +EG   LY G+  P +      A  F     ++K+  R        G      SL    
Sbjct: 215 TQEGVRTLYTGL-VPSMFGLLHVAIHFPV---YEKLKNRLHCDTITGGHNSQEHSLHLTR 270

Query: 112 -ILSGASAGCCEAFVVVPFELVKIRLQDVSS----SYKGPIDVVRKIIAQEGVLAMYNGL 166
            I++ +++    + +  P E+++ R+Q  S     S    +D++++    EG+L  Y+G 
Sbjct: 271 LIIASSASKMLASILTYPHEILRTRMQLKSDKLLISKHKLLDLIKRTYRYEGLLGFYSGF 330

Query: 167 ESTLWR 172
            + L R
Sbjct: 331 ATNLLR 336

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 85/215 (39%), Gaps = 23/215 (10%)

Query: 76  VLMEAPKRATKFACNDEFQKIYKREFGVEKLTQS--------LSILSGASAGCCEAFVVV 127
           +L E  K A+    N   Q     +     + QS        ++ LSGA AG     +V 
Sbjct: 24  LLTEDAKSASHLYQNMLLQSHEPEKHIASTVIQSKLHLSDPKITALSGALAGFLSGIIVC 83

Query: 128 PFELVKIRLQDV------SSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYF 181
           P ++ K RLQ        +  Y+G +  +  I+  EGV  +Y GL   +  +      YF
Sbjct: 84  PLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGLYKGLIPIILGYFPTWMIYF 143

Query: 182 GIIFQVRALLPEAKSKSQQTRNDLIAGS----IGGTIGSLMSTPFDVVKSRIQNTAVVAG 237
            +    + L P     S     D I+ S      G   ++++ P  VVK+R+     +  
Sbjct: 144 SVYEFAKDLYPRVLPNS-----DFISHSCSAITAGAASTVLTNPIWVVKTRLMLQTPLGE 198

Query: 238 GARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRL 272
               Y  +  +   I  +EG R LY G VP +  L
Sbjct: 199 SRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMFGL 233

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 42/85 (49%)

Query: 206 IAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGF 265
           ++G++ G +  ++  P DV K+R+Q   + +     Y     ++ TI  +EG R LYKG 
Sbjct: 69  LSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGLYKGL 128

Query: 266 VPKVLRLGPGGGILLVVFTGCMDFF 290
           +P +L   P   I   V+    D +
Sbjct: 129 IPIILGYFPTWMIYFSVYEFAKDLY 153

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 98.2 bits (243), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 77/293 (26%), Positives = 135/293 (46%), Gaps = 18/293 (6%)

Query: 1   MTDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQ----VSGGLGPQYKGVVDCI 56
           M+D +   F   F  G V+         P++ VK  +Q Q      G L  +Y G+VDC 
Sbjct: 1   MSDNKQSNFLINFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDRRYNGIVDCF 60

Query: 57  KQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQ--SLSILS 114
           K+  A EG    ++G ++ V+   P +A  FA  D+ + ++     V+   +  + ++ S
Sbjct: 61  KRTAASEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFRKEVDGYAKWFAGNLAS 120

Query: 115 GASAGCCEAFVVVPFELVKIRLQDVSSS--------YKGPIDVVRKIIAQEGVLAMYNGL 166
           G +AG      V   +  + RL   S S        + G +DV +K +A +G+  +Y G 
Sbjct: 121 GGAAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGLYRGF 180

Query: 167 ESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVK 226
             ++    V+   YFG+   ++ LL     +S    + L+  ++  T  S  S P D V+
Sbjct: 181 LPSVVGIVVYRGLYFGMYDSLKPLLLTGNLESSFIASFLLGWAV-TTGASTASYPLDTVR 239

Query: 227 SRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGIL 279
            R+  T   +G A KY+ ++ +   I   EG ++L+KG    +LR   G G++
Sbjct: 240 RRMMMT---SGQAVKYDGAFDAFRKIVAAEGVKSLFKGCGANILRGVAGAGVI 289

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 76/192 (39%), Gaps = 40/192 (20%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQ---VSGGLGPQYKGVVDCIKQIVAKEGASRL 68
             A+G  AG   +L +Y LD  +TR+         G   Q+ G+VD  K+ +A +G + L
Sbjct: 117 NLASGGAAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIAGL 176

Query: 69  YKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSL------SILSGASAGCCE 122
           Y+G    V+     R   F   D  + +         LT +L      S L G +     
Sbjct: 177 YRGFLPSVVGIVVYRGLYFGMYDSLKPLL--------LTGNLESSFIASFLLGWAVTTGA 228

Query: 123 AFVVVPFELVKIRLQDVSSS---YKGPIDVVRKIIAQEGV-------------------- 159
           +    P + V+ R+   S     Y G  D  RKI+A EGV                    
Sbjct: 229 STASYPLDTVRRRMMMTSGQAVKYDGAFDAFRKIVAAEGVKSLFKGCGANILRGVAGAGV 288

Query: 160 LAMYNGLESTLW 171
           +++Y+ L+  L+
Sbjct: 289 ISLYDQLQLVLF 300

>Scas_582.7
          Length = 329

 Score = 98.2 bits (243), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 83/296 (28%), Positives = 134/296 (45%), Gaps = 25/296 (8%)

Query: 8   PFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASR 67
           P  +Q  AGA AGI E   M+P+D +KTR+Q   + G       ++  I +I   EG+  
Sbjct: 35  PLSHQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLA 94

Query: 68  LYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSI-LSGASAGCCEAFVV 126
           L+KG+ S +L   P  A  FA   EF K +       +  Q + + +SGA+A     F +
Sbjct: 95  LWKGVQSVILGAGPAHAVYFATY-EFTKAHLIPDSQRETHQPIKVAVSGATATVASDFFM 153

Query: 127 VPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQ 186
            PF+ +K R+Q      +   +V +KI   EG+ A Y    +T+  +  + A  F I   
Sbjct: 154 NPFDTIKQRMQISDLKKEKVYNVAKKIYNLEGLSAFYYSYPTTIAMNIPFAAFNFMIY-- 211

Query: 187 VRALLPEAKSK---SQQTRNDLI---AGSIGGTIGSLMSTPFDVVKSRIQ--NTAVVA-- 236
                 E+ SK        N LI    G I G I + ++TP D +K+ IQ   ++VV+  
Sbjct: 212 ------ESASKFFNPLHHYNPLIHCLCGGISGAIAAAVTTPLDCIKTVIQIRGSSVVSLE 265

Query: 237 --GGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFF 290
               A  +  +  +I  +Y   G++  ++G  P++L   P   I    +     F 
Sbjct: 266 VMKKANTFKKATSAILMVY---GWKGFWRGLQPRILANMPATAISWTAYECAKHFL 318

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score = 97.4 bits (241), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 85/296 (28%), Positives = 132/296 (44%), Gaps = 37/296 (12%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74
           +G V G++++LV  P D++K R  LQ   G    ++ + D +K     EG    YKG  +
Sbjct: 30  SGTVGGVAQVLVGQPFDIIKVR--LQTMPGNATAWEAITDLVKY----EGFMGFYKGTMA 83

Query: 75  PVLMEAPKRATKFACNDEFQKIYK---REFGVEKLTQSLS--ILSGASAGCCEAFVVVPF 129
           P++      + +F  N+  ++ ++   R  G+   T SL      G  +G   A +  P 
Sbjct: 84  PLVGVGACVSCQFGINEAMKRYFRDLNRSRGIYDNTLSLGQYYTCGFVSGSANALLATPI 143

Query: 130 ELVKIRLQD-----VSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWR--HGVWNAGYFG 182
           E V+IRLQ       ++ YK  +D   K++ Q  ++    G  +TL R  HG      FG
Sbjct: 144 EHVRIRLQLQKEALANAEYKSTLDCTEKLLKQGSLM---RGFTATLMRTSHG------FG 194

Query: 183 IIFQVRALLPEAKSKSQQTRNDLIA------GSIGGTIGSLMSTPFDVVKSRIQNTAVVA 236
           I F     L  ++      R D+ A      G++ G     M+ PFDVVKS +Q   +V 
Sbjct: 195 IYFLTYETLIASQLAHGFRREDISAWKACMFGALSGAFFWAMTYPFDVVKSVMQADKLVN 254

Query: 237 GGARKYNWSWPSIF-TIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFR 291
                Y  +   +   IY+E G RA  KGF+P +LR  P  G     F   M   +
Sbjct: 255 PA---YGTNVVQVAKNIYRERGLRAFTKGFMPTMLRSLPVNGATFAAFEVTMQMLK 307

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 79/182 (43%), Gaps = 17/182 (9%)

Query: 111 SILSGASAGCCEAFVVVPFELVKIRLQDV---SSSYKGPIDVVRKIIAQEGVLAMYNGLE 167
            + SG   G  +  V  PF+++K+RLQ +   +++++   D+V+     EG +  Y G  
Sbjct: 27  DVFSGTVGGVAQVLVGQPFDIIKVRLQTMPGNATAWEAITDLVK----YEGFMGFYKGTM 82

Query: 168 STLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDL------IAGSIGGTIGSLMSTP 221
           + L   G   +  FGI   ++    +         N L        G + G+  +L++TP
Sbjct: 83  APLVGVGACVSCQFGINEAMKRYFRDLNRSRGIYDNTLSLGQYYTCGFVSGSANALLATP 142

Query: 222 FDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLV 281
            + V+ R+Q        A +Y  +      + K+    +L +GF   ++R   G GI  +
Sbjct: 143 IEHVRIRLQLQKEALANA-EYKSTLDCTEKLLKQG---SLMRGFTATLMRTSHGFGIYFL 198

Query: 282 VF 283
            +
Sbjct: 199 TY 200

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 79/175 (45%), Gaps = 8/175 (4%)

Query: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGI 72
           +  G V+G +  L+  P++ V+ R+QLQ       +YK  +DC ++++ K+G+  L +G 
Sbjct: 126 YTCGFVSGSANALLATPIEHVRIRLQLQKEALANAEYKSTLDCTEKLL-KQGS--LMRGF 182

Query: 73  SSPVLMEAPKRATKFACNDEF-QKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFEL 131
           ++ ++  +      F   +          F  E ++   + + GA +G     +  PF++
Sbjct: 183 TATLMRTSHGFGIYFLTYETLIASQLAHGFRREDISAWKACMFGALSGAFFWAMTYPFDV 242

Query: 132 VKIRLQD---VSSSY-KGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFG 182
           VK  +Q    V+ +Y    + V + I  + G+ A   G   T+ R    N   F 
Sbjct: 243 VKSVMQADKLVNPAYGTNVVQVAKNIYRERGLRAFTKGFMPTMLRSLPVNGATFA 297

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 7/75 (9%)

Query: 199 QQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGF 258
           ++T  D+ +G++GG    L+  PFD++K R+Q    + G A     +W +I  + K EGF
Sbjct: 22  RKTLKDVFSGTVGGVAQVLVGQPFDIIKVRLQT---MPGNAT----AWEAITDLVKYEGF 74

Query: 259 RALYKGFVPKVLRLG 273
              YKG +  ++ +G
Sbjct: 75  MGFYKGTMAPLVGVG 89

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 98.2 bits (243), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 84/295 (28%), Positives = 139/295 (47%), Gaps = 31/295 (10%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGL-----GPQYKGVVDCIKQIVAKEGASRLY 69
           +GA AG    + + PLDV KTR+Q Q   GL      P Y+G++  +  IV  EG   LY
Sbjct: 83  SGAFAGFLSGVAVCPLDVAKTRLQAQ---GLQTRFENPYYRGIMGTLSTIVRDEGPRGLY 139

Query: 70  KGISSPVLMEAPKRATKFACNDEFQKIYKREF-GVEKLTQSLSILSGASAGCCEAFVVVP 128
           KG+   VL   P     F+  +  +K +   F   + + QS + ++   AG     +  P
Sbjct: 140 KGLVPIVLGYFPTWMIYFSVYEFSKKFFHGIFPQFDFVAQSCAAIT---AGAASTTLTNP 196

Query: 129 FELVKIRLQ------DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWN-AGYF 181
             +VK RL       +  + YKG  D  RK+  QEG  A+Y GL  +L   G+++ A +F
Sbjct: 197 IWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLL--GLFHVAIHF 254

Query: 182 GIIFQVRALLP----EAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAG 237
            I   ++        E  + S   +  ++A S+   I S ++ P +++++R+Q  + +  
Sbjct: 255 PIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQLKSDIPD 314

Query: 238 GARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRT 292
             ++    +P I   Y +EG +  Y GF   ++R  P   I LV F    ++FR 
Sbjct: 315 SIQRR--LFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSF----EYFRN 363

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 80/172 (46%), Gaps = 9/172 (5%)

Query: 9   FFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGP-QYKGVVDCIKQIVAKEGASR 67
           F  Q  A   AG +   +  P+ VVKTR+ LQ + G  P  YKG  D  +++  +EG   
Sbjct: 176 FVAQSCAAITAGAASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKA 235

Query: 68  LYKGISSPVLMEAPKRATKFACNDEFQ---KIYKREFGVEKLTQSLSILSGASAGCCEAF 124
           LY G+  P L+     A  F   ++ +     Y RE     +     I++ + +    + 
Sbjct: 236 LYAGL-VPSLLGLFHVAIHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASA 294

Query: 125 VVVPFELVKIRLQ---DVSSSYKGPI-DVVRKIIAQEGVLAMYNGLESTLWR 172
           V  P E+++ R+Q   D+  S +  +  +++   AQEG+   Y+G  + L R
Sbjct: 295 VTYPHEILRTRMQLKSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVR 346

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/181 (25%), Positives = 76/181 (41%), Gaps = 30/181 (16%)

Query: 110 LSILSGASAGCCEAFVVVPFELVKIRLQDV-------SSSYKGPIDVVRKIIAQEGVLAM 162
           ++ LSGA AG      V P ++ K RLQ         +  Y+G +  +  I+  EG   +
Sbjct: 79  ITALSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGL 138

Query: 163 YNGLESTLWRHGVWNAGYFG---IIFQV--------RALLPEAKSKSQQTRNDLIAGSIG 211
           Y GL   +        GYF    I F V          + P+    +Q       A    
Sbjct: 139 YKGLVPIVL-------GYFPTWMIYFSVYEFSKKFFHGIFPQFDFVAQSC-----AAITA 186

Query: 212 GTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLR 271
           G   + ++ P  VVK+R+   + +      Y  ++ +   ++ +EGF+ALY G VP +L 
Sbjct: 187 GAASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLG 246

Query: 272 L 272
           L
Sbjct: 247 L 247

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 206 IAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWS-WPSIFTIYKEEGFRALYKG 264
           ++G+  G +  +   P DV K+R+Q   +       Y      ++ TI ++EG R LYKG
Sbjct: 82  LSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKG 141

Query: 265 FVPKVLRLGPGGGILLVVFTGCMDFFR 291
            VP VL   P   I   V+     FF 
Sbjct: 142 LVPIVLGYFPTWMIYFSVYEFSKKFFH 168

>Kwal_56.23011
          Length = 303

 Score = 95.5 bits (236), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 87/300 (29%), Positives = 125/300 (41%), Gaps = 58/300 (19%)

Query: 16  GAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSP 75
           G V G++++LV  P D+ K R+Q        P        IK +V  EG    YKG  +P
Sbjct: 30  GTVGGVAQVLVGQPFDITKVRLQTS------PVPTTAAQVIKSLVKNEGLLAFYKGTLAP 83

Query: 76  VLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSI----LSGASAGCCEAFVVVPFEL 131
           +       + +F  N+  +K ++++ G     Q L++      G  +G   AF+  P E 
Sbjct: 84  LAGVGACVSCQFGVNEALKKWFRKKDG--NFDQPLALRQYYACGFVSGTANAFLATPIEH 141

Query: 132 VKIRLQDVSSS-----YKGPIDVVRKIIAQEGVLAMYNGLESTLWR--HGVWNAGYFGII 184
           V+IRLQ  ++S     Y G +D  RK++ Q    A+  G  +T  R  HG      FGI 
Sbjct: 142 VRIRLQLQTASSSAAEYHGSLDCARKLLKQG---ALMRGFTATTLRTSHG------FGIY 192

Query: 185 FQVRALLPEAKSKSQQTRNDLIA------GSIGGTIGSLMSTPFDVVKSRIQ-------- 230
           F     L   ++     R ++ A      G+  G     M+ PFDVVKS +Q        
Sbjct: 193 FLTYETLIANQAHHGVLRENIPAWKVCVYGAFSGAFFWAMTYPFDVVKSVMQADKLKNPV 252

Query: 231 ---NTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCM 287
              N   VA               IY+E G RA  KGF P +LR  P  G     F   M
Sbjct: 253 YGRNPLAVAKA-------------IYRERGPRAFTKGFTPTMLRSLPVNGATFAAFEITM 299

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 75/176 (42%), Gaps = 8/176 (4%)

Query: 111 SILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTL 170
            +  G   G  +  V  PF++ K+RLQ  S        V++ ++  EG+LA Y G  + L
Sbjct: 26  DVFCGTVGGVAQVLVGQPFDITKVRLQ-TSPVPTTAAQVIKSLVKNEGLLAFYKGTLAPL 84

Query: 171 WRHGVWNAGYFGIIFQVRALLPEAKSKSQQT---RNDLIAGSIGGTIGSLMSTPFDVVKS 227
              G   +  FG+   ++    +      Q    R     G + GT  + ++TP + V+ 
Sbjct: 85  AGVGACVSCQFGVNEALKKWFRKKDGNFDQPLALRQYYACGFVSGTANAFLATPIEHVRI 144

Query: 228 RIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
           R+Q     +  A +Y+ S      + K+    AL +GF    LR   G GI  + +
Sbjct: 145 RLQ-LQTASSSAAEYHGSLDCARKLLKQG---ALMRGFTATTLRTSHGFGIYFLTY 196

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 78/188 (41%), Gaps = 18/188 (9%)

Query: 5   RPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEG 64
           +PL     +A G V+G +   +  P++ V+ R+QLQ +     +Y G +DC ++++ K+G
Sbjct: 114 QPLALRQYYACGFVSGTANAFLATPIEHVRIRLQLQTASSSAAEYHGSLDCARKLL-KQG 172

Query: 65  ASRLYKGISSPVLMEAPKRATKF------ACNDEFQKIYKREFGVEKLTQSLSILSGASA 118
           A  L +G ++  L  +      F        N     + +      K+      + GA +
Sbjct: 173 A--LMRGFTATTLRTSHGFGIYFLTYETLIANQAHHGVLRENIPAWKV-----CVYGAFS 225

Query: 119 GCCEAFVVVPFELVKIRLQDVSSSY----KGPIDVVRKIIAQEGVLAMYNGLESTLWRHG 174
           G     +  PF++VK  +Q          + P+ V + I  + G  A   G   T+ R  
Sbjct: 226 GAFFWAMTYPFDVVKSVMQADKLKNPVYGRNPLAVAKAIYRERGPRAFTKGFTPTMLRSL 285

Query: 175 VWNAGYFG 182
             N   F 
Sbjct: 286 PVNGATFA 293

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 7/66 (10%)

Query: 199 QQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGF 258
           +Q   D+  G++GG    L+  PFD+ K R+Q + V    A+        I ++ K EG 
Sbjct: 21  KQALKDVFCGTVGGVAQVLVGQPFDITKVRLQTSPVPTTAAQ-------VIKSLVKNEGL 73

Query: 259 RALYKG 264
            A YKG
Sbjct: 74  LAFYKG 79

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 95.1 bits (235), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 82/305 (26%), Positives = 134/305 (43%), Gaps = 29/305 (9%)

Query: 3   DARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAK 62
           D++ +     F AGA+AG  E  + YP +  KTR+QL        +   V+  I      
Sbjct: 4   DSKKVDPTKSFVAGALAGAVEASITYPFEFAKTRLQLIDKSSKASRNPLVL--IYNTAKT 61

Query: 63  EGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLS----ILSGASA 118
           +G   +Y G  + ++    K AT+F   D  + + K     +K T  LS    +L+G  A
Sbjct: 62  QGVGAIYVGCPAFIVGNTAKAATRFLGYDTIRNLLK-----DKKTGELSGPRGVLAGLGA 116

Query: 119 GCCEAFV-VVPFELVKIRL----QDVSSSYKGPIDVVRK----IIAQEGVLAMYNGLEST 169
           G  E+ V V PFE +K  L    Q V   Y+     + +    ++  EG   +Y G+   
Sbjct: 117 GLLESVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGGVLPV 176

Query: 170 LWRHGVWNAGYFGIIFQVRALLPE----AKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVV 225
             R     A   G   +++ L+ +     K K   +    I G+  G +    + P D V
Sbjct: 177 SMRQAANQAVRLGCYNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMPIDTV 236

Query: 226 KSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTG 285
           K+R+Q+       A KY+ +     TIYKEEG +  +KG  P++ RL   GGI+  ++  
Sbjct: 237 KTRMQSLT-----ASKYSSTLNCFTTIYKEEGLKTFWKGATPRLGRLILSGGIVFTIYEN 291

Query: 286 CMDFF 290
            + + 
Sbjct: 292 VLLYL 296

 Score = 61.6 bits (148), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 56/205 (27%), Positives = 92/205 (44%), Gaps = 28/205 (13%)

Query: 104 EKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSSYK---GPIDVVRKIIAQEGVL 160
           +K+  + S ++GA AG  EA +  PFE  K RLQ +  S K    P+ ++      +GV 
Sbjct: 6   KKVDPTKSFVAGALAGAVEASITYPFEFAKTRLQLIDKSSKASRNPLVLIYNTAKTQGVG 65

Query: 161 AMYNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMS- 219
           A+Y G  + +  +    A  F     +R LL + K+        ++AG   G + S+++ 
Sbjct: 66  AIYVGCPAFIVGNTAKAATRFLGYDTIRNLLKDKKTGELSGPRGVLAGLGAGLLESVVAV 125

Query: 220 TPFDVVKS-----------RIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPK 268
           TPF+ +K+           + QN       AR Y        ++ K+EGFR LY G +P 
Sbjct: 126 TPFEAIKTVLIDDKQSVRPKYQNNG--RSMARNY-------ISLVKDEGFRGLYGGVLPV 176

Query: 269 VLRLGPGGGILLVVFTGCMDFFRTL 293
            +R      + L    GC +  + L
Sbjct: 177 SMRQAANQAVRL----GCYNKIKVL 197

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 95.1 bits (235), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 127/288 (44%), Gaps = 20/288 (6%)

Query: 2   TDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQ--VSGGLGPQYKGVVDCIKQI 59
           T A  +  F  F AG +A    + V  P D VKTRMQLQ  +       Y   +     I
Sbjct: 13  TAAHKVSKFGSFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVI 72

Query: 60  VAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREF--GVE--KLTQ-SLSILS 114
              EG + L KG++S  L +     ++    +  + I    F   VE  K+    +++ +
Sbjct: 73  FKNEGIAGLQKGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHIGINVAA 132

Query: 115 GASAGCCEAFVVVPFELVKIRLQDVSSS--------YKGPIDVVRKIIAQEGVLAMYNGL 166
           GA++G   AF+  P  LVK R+Q  S++        Y    + +  I   EG+  ++ G+
Sbjct: 133 GATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGIKGLFRGV 192

Query: 167 ESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVK 226
           ++ + R G+ +A    I    +  L +    +  T   L++ +I G    +   P+DVV 
Sbjct: 193 DAAMLRTGIGSAVQLPIYNICKNFLLKHDLMNDGTGLHLLSSTIAGFGVGVAMNPWDVVL 252

Query: 227 SRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGP 274
           +R+ N          Y+          + EG  ALYKGF  ++LR+GP
Sbjct: 253 TRVYNQK-----GNLYSGPIDCFIKTVRNEGLSALYKGFGAQILRIGP 295

 Score = 84.0 bits (206), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 96/209 (45%), Gaps = 15/209 (7%)

Query: 97  YKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQ-------DVSSSYKGPIDV 149
           + ++    K+++  S ++G  A C    V  PF+ VK R+Q       + +  Y  PI  
Sbjct: 9   HNQKTAAHKVSKFGSFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQA 68

Query: 150 VRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALL-----PEAKS-KSQQTRN 203
              I   EG+  +  GL S        N    G    +R +L     P  +S K Q    
Sbjct: 69  FGVIFKNEGIAGLQKGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHIGI 128

Query: 204 DLIAGSIGGTIGSLMSTPFDVVKSRIQN--TAVVAGGARKYNWSWPSIFTIYKEEGFRAL 261
           ++ AG+  G +G+ + +P  +VK+R+Q+   A+  G    Y  ++  + TI++ EG + L
Sbjct: 129 NVAAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGIKGL 188

Query: 262 YKGFVPKVLRLGPGGGILLVVFTGCMDFF 290
           ++G    +LR G G  + L ++  C +F 
Sbjct: 189 FRGVDAAMLRTGIGSAVQLPIYNICKNFL 217

>Kwal_55.20868
          Length = 380

 Score = 95.9 bits (237), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 84/297 (28%), Positives = 135/297 (45%), Gaps = 29/297 (9%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQ-VSGGLGPQYKGVVDCIKQIVAKEGASRLYKGIS 73
           +GA+AG    + + PLDV KTR+Q Q +       YKG++  +  I+  EGA  LYKG+ 
Sbjct: 81  SGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGLYKGLV 140

Query: 74  SPVLMEAPKRATKFACNDEFQKIYKREF-GVEKLTQSLSILSGASAGCCEAFVVVPFELV 132
             ++   P     F+  +  +K+Y R F   + ++ S S L   +AG     +  P  +V
Sbjct: 141 PIIMGYFPTWMIYFSVYERSKKLYPRIFPSFDFISHSASAL---TAGTVSTILTNPVWVV 197

Query: 133 KIRL------QDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWN-AGYFGIIF 185
           K RL         S+ Y    D   K+   EG+   Y GL  +L   G+++ A +F I  
Sbjct: 198 KTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLL--GLFHVAIHFPIYE 255

Query: 186 QVRALLPEAKSKSQQTRNDL------IAGSIGGTIGSLMSTPFDVVKSRIQNTA-----V 234
           +++  L    S S+   ++L      IA S    + S ++ P +++++R+Q  A     +
Sbjct: 256 KLKVWLHCTPSMSRTEDHNLNLARLIIASSASKMVASTLTYPHEILRTRMQLKAYPTDPL 315

Query: 235 VAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFR 291
            A      +     I   YK EG R  Y GF   + R  P   I LV F    ++FR
Sbjct: 316 AALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSF----EYFR 368

 Score = 66.6 bits (161), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 90/213 (42%), Gaps = 21/213 (9%)

Query: 72  ISSPVLMEAPKRATKFACNDEFQKI--YKREFGVEKLTQSLSILSGASAGCCEAFVVVPF 129
           +SS  ++E   R      ND    I    R F   ++T     LSGA AG      V P 
Sbjct: 41  LSSADVLEDYARPRTGGSNDGSNTIPFVNRSFDDTEITA----LSGAMAGFLAGVTVCPL 96

Query: 130 ELVKIRLQ------DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGI 183
           ++ K RLQ      + S+ YKG +  +  II  EG   +Y GL   +  +      YF +
Sbjct: 97  DVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGLYKGLVPIIMGYFPTWMIYFSV 156

Query: 184 IFQVRALLPEAKSKSQQTRNDLIAGS----IGGTIGSLMSTPFDVVKSRIQNTAVVAGGA 239
             + + L P           D I+ S      GT+ ++++ P  VVK+R+     V   +
Sbjct: 157 YERSKKLYPRIFPSF-----DFISHSASALTAGTVSTILTNPVWVVKTRLMLQTHVNKNS 211

Query: 240 RKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRL 272
             Y  ++ +   +Y  EG R  Y G +P +L L
Sbjct: 212 THYTSTFDAFHKMYTTEGLRTFYAGLLPSLLGL 244

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 41/78 (52%)

Query: 206 IAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGF 265
           ++G++ G +  +   P DV K+R+Q   + +  +  Y     ++ TI ++EG R LYKG 
Sbjct: 80  LSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGLYKGL 139

Query: 266 VPKVLRLGPGGGILLVVF 283
           VP ++   P   I   V+
Sbjct: 140 VPIIMGYFPTWMIYFSVY 157

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/186 (20%), Positives = 69/186 (37%), Gaps = 28/186 (15%)

Query: 9   FFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVS-GGLGPQYKGVVDCIKQIVAKEGASR 67
           F    A+   AG    ++  P+ VVKTR+ LQ         Y    D   ++   EG   
Sbjct: 173 FISHSASALTAGTVSTILTNPVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRT 232

Query: 68  LYKGISSPVLMEAPKRATKF----------ACNDEFQKIYKREFGVEKLTQSLSILSGAS 117
            Y G+  P L+     A  F           C     +       + +L     I++ ++
Sbjct: 233 FYAGL-LPSLLGLFHVAIHFPIYEKLKVWLHCTPSMSRTEDHNLNLARL-----IIASSA 286

Query: 118 AGCCEAFVVVPFELVKIRLQDVS-----------SSYKGPIDVVRKIIAQEGVLAMYNGL 166
           +    + +  P E+++ R+Q  +           +S  G I +++     EG+   Y+G 
Sbjct: 287 SKMVASTLTYPHEILRTRMQLKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGF 346

Query: 167 ESTLWR 172
            + L R
Sbjct: 347 TANLAR 352

 Score = 31.6 bits (70), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 34/76 (44%), Gaps = 6/76 (7%)

Query: 26  VMYPLDVVKTRMQLQV--SGGLGPQYK----GVVDCIKQIVAKEGASRLYKGISSPVLME 79
           + YP ++++TRMQL+   +  L    K    G++  IK     EG    Y G ++ +   
Sbjct: 294 LTYPHEILRTRMQLKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLART 353

Query: 80  APKRATKFACNDEFQK 95
            P  A      + F+K
Sbjct: 354 LPASAITLVSFEYFRK 369

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score = 94.4 bits (233), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 122/278 (43%), Gaps = 28/278 (10%)

Query: 16  GAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASR-LYKGISS 74
           G++AG    ++ YP D VK R+Q Q +      +     CIK     EG  R  Y+GI S
Sbjct: 13  GSIAGAVGKVIEYPFDTVKVRLQTQPA----HMFPTTWSCIKFTYDNEGLWRGFYQGIGS 68

Query: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLS--ILSGASAGCCEAFVVVPFELV 132
           P+   A + A  F   ++     KR   VE L   LS  + +GA AG C +FV+ P EL+
Sbjct: 69  PLAGAALENAVLFVSFNQ----AKRLLDVESLLSPLSKTVWAGAFAGACASFVLTPVELI 124

Query: 133 KIRLQ-----DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQV 187
           K +LQ        +S+   +  ++ ++++ G L ++ G   T  R     A +F     V
Sbjct: 125 KCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTYEVV 184

Query: 188 RALLPEAKSKSQQTRNDLIA-GSIGGTIGSLMSTPFDVVKSRIQNTAV-VAGGARKYNWS 245
           +  L   +   Q T  +L+A G+  G   +    P D +KS +Q   + ++   RK    
Sbjct: 185 KNYLASRRQAEQNTTWELLASGASAGLAFNASIFPADTIKSTMQTDHIDLSSATRK---- 240

Query: 246 WPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
                 IY  +G    Y+G    ++R  P    +   +
Sbjct: 241 ------IYARQGIAGFYRGLGITLIRAVPANAAIFYTY 272

 Score = 56.2 bits (134), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 78/171 (45%), Gaps = 11/171 (6%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74
           AGA AG     V+ P++++K ++Q+         +  ++  IK ++++ G   L++G S 
Sbjct: 106 AGAFAGACASFVLTPVELIKCKLQVSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSG 165

Query: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKI 134
             + E+   A  F   +  +         E+ T    + SGASAG      + P + +K 
Sbjct: 166 TFIRESGGGAAWFTTYEVVKNYLASRRQAEQNTTWELLASGASAGLAFNASIFPADTIKS 225

Query: 135 RLQ----DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYF 181
            +Q    D+SS+        RKI A++G+   Y GL  TL R    NA  F
Sbjct: 226 TMQTDHIDLSSA-------TRKIYARQGIAGFYRGLGITLIRAVPANAAIF 269

 Score = 46.6 bits (109), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 76/174 (43%), Gaps = 4/174 (2%)

Query: 112 ILSGASAGCCEAFVVVPFELVKIRLQDVSSS-YKGPIDVVRKIIAQEGVL-AMYNGLEST 169
           IL G+ AG     +  PF+ VK+RLQ   +  +      ++     EG+    Y G+ S 
Sbjct: 10  ILYGSIAGAVGKVIEYPFDTVKVRLQTQPAHMFPTTWSCIKFTYDNEGLWRGFYQGIGSP 69

Query: 170 LWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRI 229
           L    + NA  F    Q + LL + +S        + AG+  G   S + TP +++K ++
Sbjct: 70  LAGAALENAVLFVSFNQAKRLL-DVESLLSPLSKTVWAGAFAGACASFVLTPVELIKCKL 128

Query: 230 QNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
           Q  + ++     +    P+I ++  E GF  L++G     +R   GG      +
Sbjct: 129 Q-VSNLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAAWFTTY 181

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 39/86 (45%), Gaps = 6/86 (6%)

Query: 199 QQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEG- 257
           ++   D++ GSI G +G ++  PFD VK R+Q        A  +  +W  I   Y  EG 
Sbjct: 4   EEAAKDILYGSIAGAVGKVIEYPFDTVKVRLQTQP-----AHMFPTTWSCIKFTYDNEGL 58

Query: 258 FRALYKGFVPKVLRLGPGGGILLVVF 283
           +R  Y+G    +        +L V F
Sbjct: 59  WRGFYQGIGSPLAGAALENAVLFVSF 84

 Score = 33.1 bits (74), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGI 72
            A+GA AG++    ++P D +K+ MQ          +  +    ++I A++G +  Y+G+
Sbjct: 203 LASGASAGLAFNASIFPADTIKSTMQ--------TDHIDLSSATRKIYARQGIAGFYRGL 254

Query: 73  SSPVLMEAPKRATKF 87
              ++   P  A  F
Sbjct: 255 GITLIRAVPANAAIF 269

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 94.7 bits (234), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 87/295 (29%), Positives = 136/295 (46%), Gaps = 23/295 (7%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQ---LQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKG 71
           +GA+AG+   +V+ PLDV KTR+Q   LQ        Y+G +  +  IV  EG   LYKG
Sbjct: 74  SGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYKG 133

Query: 72  ISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFEL 131
           +   ++   P     F+   EF K   R         S S  S  +AG     V  P  +
Sbjct: 134 LVPIIMGYFPTWMIYFSVY-EFCKDNLRTNSSNWSFVSHS-FSAITAGAVSTVVTNPIWV 191

Query: 132 VKIRLQ------DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWN-AGYFGII 184
           VK RL         ++ Y+G  D  +KII QEGV A+Y GL  +L   G+ + A +F + 
Sbjct: 192 VKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPSLL--GLLHVAIHFPVY 249

Query: 185 FQVRALL-----PEAKSKSQQTRNDLI-AGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGG 238
            +++         E+ ++S+     LI A S+   + S++S P +++++R+Q  + +   
Sbjct: 250 ERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILRTRLQLKSDLPSH 309

Query: 239 ARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRTL 293
            R+     P I   Y +EG    Y GF   + R  P   I LV F    +F   +
Sbjct: 310 QRRL---IPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFEYVRNFLNKI 361

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 81/195 (41%), Gaps = 21/195 (10%)

Query: 92  EFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQ--------DVSSSY 143
           E  ++    FG       ++ +SGA AG     VV P ++ K RLQ          +  Y
Sbjct: 52  EVPRVRNTLFGFTLNDNRINAISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYY 111

Query: 144 KGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFG---IIFQVRALLPE---AKSK 197
           +G I  +  I+  EGV  +Y GL   +        GYF    I F V     +     S 
Sbjct: 112 RGSIGTMTTIVRDEGVRGLYKGLVPII-------MGYFPTWMIYFSVYEFCKDNLRTNSS 164

Query: 198 SQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEG 257
           +    +   +    G + ++++ P  VVK+R+     +      Y  ++ +   I  +EG
Sbjct: 165 NWSFVSHSFSAITAGAVSTVVTNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEG 224

Query: 258 FRALYKGFVPKVLRL 272
            +ALY G VP +L L
Sbjct: 225 VKALYAGLVPSLLGL 239

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 47/96 (48%), Gaps = 2/96 (2%)

Query: 199 QQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARK--YNWSWPSIFTIYKEE 256
              R + I+G++ G +  ++  P DV K+R+Q   +         Y  S  ++ TI ++E
Sbjct: 66  NDNRINAISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDE 125

Query: 257 GFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRT 292
           G R LYKG VP ++   P   I   V+  C D  RT
Sbjct: 126 GVRGLYKGLVPIIMGYFPTWMIYFSVYEFCKDNLRT 161

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 94.4 bits (233), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 80/319 (25%), Positives = 137/319 (42%), Gaps = 56/319 (17%)

Query: 25  LVMYPLDVVKTRMQLQ-------VSGGL----------------------GPQYKGVVDC 55
           L + PLDVV+ R+  Q        +G L                        + +G ++ 
Sbjct: 27  LFLTPLDVVRVRLHQQEMLPSCTCTGQLSKPAGKVFWQDECFANVGCREPAARLQGTLEG 86

Query: 56  IKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSG 115
           +++I   EG   L++G+   ++M  P     F+    ++ +        +L  +  ++ G
Sbjct: 87  LRKIAQLEGLPTLWRGLGITLVMAVPANVVYFS---GYEALRDNSPLASRLPVANPLVCG 143

Query: 116 ASAGCCEAFVVVPFELVKIRLQDVSSSYKGPI------DVVRKIIAQEGVL---AMYNGL 166
           A A    A  + P EL++ RLQ V  +           D++R++  +  V+   A++ GL
Sbjct: 144 AFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREMRHEVSVMGYRALFKGL 203

Query: 167 ESTLWRHGVWNAGYFGII------FQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMST 220
           E TLWR   ++A Y+G        F  R       S           GS+GG + +L++ 
Sbjct: 204 EITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFIGSFACGSMGGAVAALLTH 263

Query: 221 PFDVVKSRIQ------NTAVVAGGARKYNWS---WPSIFTIYKEEGFRALYKGFVPKVLR 271
           PFDV K+R+Q          V G A K + S   +  +  I K EG RALY G +P+V++
Sbjct: 264 PFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRKSEGIRALYTGLLPRVMK 323

Query: 272 LGPGGGILLVVFTGCMDFF 290
           + P   I++  +     FF
Sbjct: 324 IAPSCAIMISTYELSKKFF 342

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 45/99 (45%), Gaps = 10/99 (10%)

Query: 9   FFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVS-------GGLGPQY---KGVVDCIKQ 58
           F   FA G++ G    L+ +P DV KTRMQ+ ++       GG   +    +G+   +  
Sbjct: 244 FIGSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNA 303

Query: 59  IVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIY 97
           I   EG   LY G+   V+  AP  A   +  +  +K +
Sbjct: 304 IRKSEGIRALYTGLLPRVMKIAPSCAIMISTYELSKKFF 342

 Score = 33.1 bits (74), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 40/187 (21%), Positives = 72/187 (38%), Gaps = 24/187 (12%)

Query: 4   ARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVV-DCIKQI--- 59
           A  LP       GA A I     + PL++++TR+Q         +   ++ D ++++   
Sbjct: 131 ASRLPVANPLVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREMRHE 190

Query: 60  VAKEGASRLYKGISSPVLMEAPKRATKFA----CNDEFQKIYKREFGVEKLTQSL-SILS 114
           V+  G   L+KG+   +  + P  A  +     C  +F   +            + S   
Sbjct: 191 VSVMGYRALFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFIGSFAC 250

Query: 115 GASAGCCEAFVVVPFELVKIRLQDVSSS---------------YKGPIDVVRKIIAQEGV 159
           G+  G   A +  PF++ K R+Q   +S                +G    +  I   EG+
Sbjct: 251 GSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRKSEGI 310

Query: 160 LAMYNGL 166
            A+Y GL
Sbjct: 311 RALYTGL 317

>Kwal_26.7653
          Length = 325

 Score = 93.6 bits (231), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 95/202 (47%), Gaps = 15/202 (7%)

Query: 104 EKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQ-------DVSSSYKGPIDVVRKIIAQ 156
           +K++++ S ++G  A C    V  P ELVK R+Q       D    YK P+  ++ I   
Sbjct: 20  QKVSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKN 79

Query: 157 EGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLPEA------KSKSQQTRNDLIAGSI 210
           EG+  +  GL          N    G    +R++L +         K Q    ++++G+ 
Sbjct: 80  EGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGAT 139

Query: 211 GGTIGSLMSTPFDVVKSRIQN--TAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPK 268
            G IG++M +P  ++K+R+Q+   A+  G    Y   W  + +IY+ EGF+ LY+G    
Sbjct: 140 SGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAA 199

Query: 269 VLRLGPGGGILLVVFTGCMDFF 290
           +LR G G  + L ++     F 
Sbjct: 200 ILRTGAGSSVQLPIYNTAKHFL 221

 Score = 81.6 bits (200), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/277 (24%), Positives = 122/277 (44%), Gaps = 20/277 (7%)

Query: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQ--YKGVVDCIKQIVAKEGASRLYK 70
           F AG +A    + V  P+++VKTRMQLQ       Q  YK  +  +K I   EG   L K
Sbjct: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK 87

Query: 71  GISSPVLMEAPKRATKFACNDEFQKIYKREF----GVEKLTQ-SLSILSGASAGCCEAFV 125
           G+S   + +     ++    +  + +  + F       K+   +++++SGA++G   A +
Sbjct: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIM 147

Query: 126 VVPFELVKIRLQDVSSS--------YKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWN 177
             P  L+K R+Q  S++        Y    + +  I   EG   +Y G+++ + R G  +
Sbjct: 148 GSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGS 207

Query: 178 AGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAG 237
           +    I    +  L +     + T   L+A ++ G    ++  P+DV+ +R+ N      
Sbjct: 208 SVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQK---- 263

Query: 238 GARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGP 274
               Y           + EG  ALYKGF  ++ R+ P
Sbjct: 264 -GNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAP 299

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 42/94 (44%), Gaps = 7/94 (7%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKG 71
              A  V+G    +VM P DV+ TR+  Q     G  YKG +DC  + V  EG   LYKG
Sbjct: 234 HLVASTVSGFGVGVVMNPWDVILTRVYNQK----GNLYKGPLDCFVKTVRIEGIGALYKG 289

Query: 72  ISSPVLMEAPKRATKFACNDEFQKIYKREFGVEK 105
             + +   AP       C    ++  K  + VEK
Sbjct: 290 FEAQIFRIAPH---TILCLTFMEQTMKVVYAVEK 320

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 93.2 bits (230), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 79/306 (25%), Positives = 134/306 (43%), Gaps = 34/306 (11%)

Query: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGI 72
           F AG +AG     V+ P + VK  +Q+Q S       KG+ D I Q+  +E    L++G 
Sbjct: 27  FLAGGIAGAISRTVVSPFERVKILLQVQSS--TTAYNKGLFDAIGQVYKEENIKGLFRGN 84

Query: 73  SSPVLMEAPKRATKFACNDEFQKIYKREFGV------EKLTQSLSILSGASAGCCEAFVV 126
               +   P  A +F     F+   K  F V      E+L     + SGA  G C     
Sbjct: 85  GLNCIRVFPYSAVQFVV---FEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVAT 141

Query: 127 VPFELVKIRLQDVSSSYK--------------GPIDVVRKIIAQEG-VLAMYNGLESTLW 171
            P +LV+ RL   +++                G   ++ K  A+EG ++ +Y G+  T  
Sbjct: 142 YPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSL 201

Query: 172 RHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIA---GSIGGTIGSLMSTPFDVVKSR 228
               + A  F +  Q++  +P  ++ +   R+ L     G+I G +   ++ PFD+++ R
Sbjct: 202 GIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRR 261

Query: 229 IQNTAVVAGGAR---KYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTG 285
            Q  A+  GG      YN  W ++ TI K EGF+  YKG    + ++ P   +  +V+  
Sbjct: 262 FQVLAM--GGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYEL 319

Query: 286 CMDFFR 291
             D+ +
Sbjct: 320 TWDYMK 325

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 86/202 (42%), Gaps = 18/202 (8%)

Query: 105 KLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSS---YKGPIDVVRKIIAQEGVLA 161
           K   +++ L+G  AG     VV PFE VKI LQ  SS+    KG  D + ++  +E +  
Sbjct: 20  KQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKG 79

Query: 162 MYNGLESTLWRHGVWNAGYFGIIFQ---VRALLPEAKSKSQQTRN--DLIAGSIGGTIGS 216
           ++ G      R   ++A  F ++F+         + K K +Q  N   L +G++ G    
Sbjct: 80  LFRGNGLNCIRVFPYSAVQF-VVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSV 138

Query: 217 LMSTPFDVVKSRIQNTAVVAGGARKYNWS--------WPSIFTIYKEE-GFRALYKGFVP 267
           + + P D+V++R+           K   S        W  +   Y EE G   LY+G  P
Sbjct: 139 VATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWP 198

Query: 268 KVLRLGPGGGILLVVFTGCMDF 289
             L + P   +   V+    +F
Sbjct: 199 TSLGIVPYVALNFAVYEQLKEF 220

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 2/80 (2%)

Query: 10  FYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGG--LGPQYKGVVDCIKQIVAKEGASR 67
            Y+ + GA++G     + YP D+++ R Q+   GG  LG  Y  V D +  I   EG   
Sbjct: 235 LYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKG 294

Query: 68  LYKGISSPVLMEAPKRATKF 87
            YKG+++ +    P  A  +
Sbjct: 295 YYKGLTANLFKVVPSTAVSW 314

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 92.4 bits (228), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 77/290 (26%), Positives = 125/290 (43%), Gaps = 30/290 (10%)

Query: 14  AAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASR-LYKGI 72
           A G+VAG    ++ YP D VK R+Q Q +      Y     CI+     EG  +  Y+GI
Sbjct: 12  AYGSVAGAIGKVIEYPFDTVKVRLQTQPAH----LYPTTWSCIRSTYTDEGIWKGFYQGI 67

Query: 73  SSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELV 132
           +SP+   A + A  F   ++          ++ LT++  I SGA AG C +F++ P ELV
Sbjct: 68  ASPLFGAALENAVLFVSFNQCTNFLDEFTQLKPLTKT--IYSGAFAGACASFILTPVELV 125

Query: 133 KIRLQ--DVSSS------YKGPIDVVRKIIAQEGVLAMYNGLESTLWRH----GVWNAGY 180
           K +LQ  ++S+S      +      ++ +I ++G+L ++ G  ST  R      VW   Y
Sbjct: 126 KCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAVWFTTY 185

Query: 181 FGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGAR 240
             +  +  +L P    K   T   L++G+  G + +    P D VKS  Q   V    A 
Sbjct: 186 EIMKMKFASLHP--AEKENHTWELLVSGASAGVLFNASVFPADTVKSVCQTEHVSIVNAL 243

Query: 241 KYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFF 290
           K          + +  G    Y+G    ++R  P    +   +      F
Sbjct: 244 K---------KVLRTHGITGFYRGLGITLIRAAPANATVFYTYETLKKMF 284

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 78/176 (44%), Gaps = 5/176 (2%)

Query: 112 ILSGASAGCCEAFVVVPFELVKIRLQDVSSS-YKGPIDVVRKIIAQEGVL-AMYNGLEST 169
           I  G+ AG     +  PF+ VK+RLQ   +  Y      +R     EG+    Y G+ S 
Sbjct: 11  IAYGSVAGAIGKVIEYPFDTVKVRLQTQPAHLYPTTWSCIRSTYTDEGIWKGFYQGIASP 70

Query: 170 LWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRI 229
           L+   + NA  F    Q    L E       T+  + +G+  G   S + TP ++VK ++
Sbjct: 71  LFGAALENAVLFVSFNQCTNFLDEFTQLKPLTKT-IYSGAFAGACASFILTPVELVKCKL 129

Query: 230 Q--NTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
           Q  N +       ++   WP+I ++ KE+G   L++G +   +R   GG +    +
Sbjct: 130 QVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAVWFTTY 185

 Score = 50.1 bits (118), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 43/96 (44%), Gaps = 6/96 (6%)

Query: 196 SKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKE 255
           S  +    D+  GS+ G IG ++  PFD VK R+Q        A  Y  +W  I + Y +
Sbjct: 2   SDLESALKDIAYGSVAGAIGKVIEYPFDTVKVRLQTQP-----AHLYPTTWSCIRSTYTD 56

Query: 256 EG-FRALYKGFVPKVLRLGPGGGILLVVFTGCMDFF 290
           EG ++  Y+G    +        +L V F  C +F 
Sbjct: 57  EGIWKGFYQGIASPLFGAALENAVLFVSFNQCTNFL 92

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 92.0 bits (227), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/294 (25%), Positives = 131/294 (44%), Gaps = 21/294 (7%)

Query: 8   PFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASR 67
           P ++Q  AGA AGI E  VM+P+D +KTR+Q   +  L    K ++  I  I   EG   
Sbjct: 32  PLYHQLIAGAFAGIMEHSVMFPIDALKTRIQSANAKSLSA--KNMLSQISHISTSEGTLA 89

Query: 68  LYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVV 127
           L+KG+ S +L   P  A  F   +  +K        +      + +SGA A      ++ 
Sbjct: 90  LWKGVQSVILGAGPAHAVYFGTYEFCKKNLIDSSDTQTHHPFKTAISGACATTASDALMN 149

Query: 128 PFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQV 187
           PF+ +K R+Q  +S+        ++I   EG+ A Y    +TL    V N  +    F  
Sbjct: 150 PFDTIKQRIQLNTSA--SVWQTTKQIYQSEGLAAFYYSYPTTL----VMNIPFAAFNF-- 201

Query: 188 RALLPEAKSKSQQTRND------LIAGSIGGTIGSLMSTPFDVVKSRIQ---NTAVVAGG 238
             ++ E+ +K     N+       + GSI G+  + ++TP D +K+ +Q   +  V    
Sbjct: 202 --VIYESSTKFLNPSNEYNPLIHCLCGSISGSTCAAITTPLDCIKTVLQIRGSQTVSLEI 259

Query: 239 ARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRT 292
            RK +    +   IY+  G++  ++G+ P+++   P   I    +     F  T
Sbjct: 260 MRKADTFSKAASAIYQVYGWKGFWRGWKPRIVANMPATAISWTAYECAKHFLMT 313

>Kwal_55.21335
          Length = 317

 Score = 92.0 bits (227), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 71/277 (25%), Positives = 127/277 (45%), Gaps = 26/277 (9%)

Query: 16  GAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASR-LYKGISS 74
           G++AG +  ++ YPLD +K R+Q Q +      +     CIK    KEG  +  Y+G++S
Sbjct: 52  GSIAGAAGKVIEYPLDTIKVRLQTQPAHVFPTSW----SCIKYTYQKEGFVKGFYQGVAS 107

Query: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKI 134
           P++  A + A  F   +  Q   ++   V  L+Q+  +LSGA AG C ++V+ P EL+K 
Sbjct: 108 PLVGAALENAVLFVTFNRAQNFLQQYESVSPLSQT--VLSGAFAGACTSYVLTPVELIKC 165

Query: 135 RLQ-----DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRA 189
            LQ       ++ +      V+ I+  +G+  ++ G  ST  R     A +F     +++
Sbjct: 166 TLQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVWFTTYESLKS 225

Query: 190 LLPEAKSKSQQTRNDLIA-GSIGGTIGSLMSTPFDVVKS--RIQNTAVVAGGARKYNWSW 246
            L   ++ ++    +L+A G+  G   +    P D +KS  + Q+  +V    R      
Sbjct: 226 YLARRRNDTENHTWELLASGASAGVAFNASIFPADTIKSTAQTQHLGIVDATKR------ 279

Query: 247 PSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
                I    G   LY+G    ++R  P   I+   +
Sbjct: 280 -----ILARSGPAGLYRGLGITLIRAAPANAIVFYTY 311

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 82/181 (45%), Gaps = 4/181 (2%)

Query: 112 ILSGASAGCCEAFVVVPFELVKIRLQDVSSS-YKGPIDVVRKIIAQEG-VLAMYNGLEST 169
           IL G+ AG     +  P + +K+RLQ   +  +      ++    +EG V   Y G+ S 
Sbjct: 49  ILYGSIAGAAGKVIEYPLDTIKVRLQTQPAHVFPTSWSCIKYTYQKEGFVKGFYQGVASP 108

Query: 170 LWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRI 229
           L    + NA  F    + +  L + +S S  ++  +++G+  G   S + TP +++K  +
Sbjct: 109 LVGAALENAVLFVTFNRAQNFLQQYESVSPLSQT-VLSGAFAGACTSYVLTPVELIKCTL 167

Query: 230 QNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDF 289
           Q  + + G   +++  WP++  I + +G   L++G     +R   GG +    +     +
Sbjct: 168 Q-VSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVWFTTYESLKSY 226

Query: 290 F 290
            
Sbjct: 227 L 227

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 41/75 (54%), Gaps = 8/75 (10%)

Query: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGI 72
            A+GA AG++    ++P D +K+  Q         Q+ G+VD  K+I+A+ G + LY+G+
Sbjct: 242 LASGASAGVAFNASIFPADTIKSTAQ--------TQHLGIVDATKRILARSGPAGLYRGL 293

Query: 73  SSPVLMEAPKRATKF 87
              ++  AP  A  F
Sbjct: 294 GITLIRAAPANAIVF 308

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 41/89 (46%), Gaps = 6/89 (6%)

Query: 204 DLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGF-RALY 262
           D++ GSI G  G ++  P D +K R+Q        A  +  SW  I   Y++EGF +  Y
Sbjct: 48  DILYGSIAGAAGKVIEYPLDTIKVRLQTQP-----AHVFPTSWSCIKYTYQKEGFVKGFY 102

Query: 263 KGFVPKVLRLGPGGGILLVVFTGCMDFFR 291
           +G    ++       +L V F    +F +
Sbjct: 103 QGVASPLVGAALENAVLFVTFNRAQNFLQ 131

>Scas_632.9
          Length = 292

 Score = 91.7 bits (226), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 77/279 (27%), Positives = 128/279 (45%), Gaps = 27/279 (9%)

Query: 16  GAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASR-LYKGISS 74
           G++AG    ++ YP D VK R+Q Q S      +     CIK     EG  R  ++GI S
Sbjct: 24  GSIAGAFGKIIEYPFDTVKVRLQTQGSHIFPTTW----SCIKYTYHNEGVWRGFFQGIGS 79

Query: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKI 134
           P+   A + AT F   ++   + ++   V  L+  L  LSGA AG C +FV+ P EL+K 
Sbjct: 80  PLFGAALENATLFVSYNQCSNVLEKFTNVSPLSNIL--LSGAFAGSCASFVLTPVELIKC 137

Query: 135 RLQ--DVSSSYKGPIDVVRKI------IAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQ 186
           +LQ  ++ ++ +G I   + I      + ++G+L ++ G  ST  R  +    +F   ++
Sbjct: 138 KLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQGQSSTFIRESLGGVAWFA-TYE 196

Query: 187 V--RALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNW 244
           V  + L    K    +T   L++G+  G   +    P D VKS +Q   +    A K   
Sbjct: 197 VMKQGLKDRRKDTENKTWELLVSGASAGLAFNASIFPADTVKSMMQTEHITLINAVK--- 253

Query: 245 SWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
               + T Y   GF   Y+G    ++R  P    +  ++
Sbjct: 254 ---KVLTTYGITGF---YRGLGITLIRAVPANATVFYMY 286

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 78/169 (46%), Gaps = 5/169 (2%)

Query: 112 ILSGASAGCCEAFVVVPFELVKIRLQDVSSS-YKGPIDVVRKIIAQEGVL-AMYNGLEST 169
           I++G+ AG     +  PF+ VK+RLQ   S  +      ++     EGV    + G+ S 
Sbjct: 21  IVNGSIAGAFGKIIEYPFDTVKVRLQTQGSHIFPTTWSCIKYTYHNEGVWRGFFQGIGSP 80

Query: 170 LWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRI 229
           L+   + NA  F    Q   +L E  +      N L++G+  G+  S + TP +++K ++
Sbjct: 81  LFGAALENATLFVSYNQCSNVL-EKFTNVSPLSNILLSGAFAGSCASFVLTPVELIKCKL 139

Query: 230 Q--NTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGG 276
           Q  N      G  K+    P++  + +E+G   L++G     +R   GG
Sbjct: 140 QVSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQGQSSTFIRESLGG 188

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 43/98 (43%), Gaps = 6/98 (6%)

Query: 192 PEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFT 251
           P  KS  Q   +D++ GSI G  G ++  PFD VK R+Q       G+  +  +W  I  
Sbjct: 8   PIEKSSVQNALSDIVNGSIAGAFGKIIEYPFDTVKVRLQTQ-----GSHIFPTTWSCIKY 62

Query: 252 IYKEEG-FRALYKGFVPKVLRLGPGGGILLVVFTGCMD 288
            Y  EG +R  ++G    +         L V +  C +
Sbjct: 63  TYHNEGVWRGFFQGIGSPLFGAALENATLFVSYNQCSN 100

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 41/82 (50%), Gaps = 8/82 (9%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74
           +GA AG++    ++P D VK+ MQ         ++  +++ +K+++   G +  Y+G+  
Sbjct: 219 SGASAGLAFNASIFPADTVKSMMQ--------TEHITLINAVKKVLTTYGITGFYRGLGI 270

Query: 75  PVLMEAPKRATKFACNDEFQKI 96
            ++   P  AT F   +   K+
Sbjct: 271 TLIRAVPANATVFYMYETLSKM 292

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score = 91.3 bits (225), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 79/274 (28%), Positives = 122/274 (44%), Gaps = 36/274 (13%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74
           AG   GI+++LV  P D  K R+Q   +          V  IK ++  EG    YKG  +
Sbjct: 29  AGTAGGIAQVLVGQPFDTTKVRLQTSETS------TNAVKVIKDLIKNEGPMGFYKGTLT 82

Query: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILS----GASAGCCEAFVVVPFE 130
           P++      + +F  N+  ++ +   F  E  +Q LS+L     G + G   +F+  P E
Sbjct: 83  PLVGVGACVSLQFGVNEAMKRFF-HTFD-EAASQHLSLLQYYICGVAGGFTNSFLASPIE 140

Query: 131 LVKIRLQDVSSS-----YKGPIDVVRKIIAQEGVLAMYNGLESTLWR--HGVWNAGYFGI 183
            ++IRLQ  + S     +KGPID ++K+     ++    GL  T+ R  HG       G+
Sbjct: 141 HIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLM---RGLTPTMLRESHGC------GV 191

Query: 184 IFQVRALLPEAKSKSQQTRNDLIA------GSIGGTIGSLMSTPFDVVKSRIQNTAVVAG 237
            F     L   + KS   R D+ A      G+  GT+   M  P DV+KS +Q   +   
Sbjct: 192 YFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVIKSVMQTDNLKT- 250

Query: 238 GARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLR 271
             +  N       TI   +G   L+KGF P +LR
Sbjct: 251 -PKNGNNILTVGRTIIARQGVSGLFKGFAPTMLR 283

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 75/176 (42%), Gaps = 8/176 (4%)

Query: 111 SILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTL 170
            +L+G + G  +  V  PF+  K+RLQ  S +    + V++ +I  EG +  Y G  + L
Sbjct: 26  DLLAGTAGGIAQVLVGQPFDTTKVRLQ-TSETSTNAVKVIKDLIKNEGPMGFYKGTLTPL 84

Query: 171 WRHGVWNAGYFGIIFQVRAL---LPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKS 227
              G   +  FG+   ++       EA S+        I G  GG   S +++P + ++ 
Sbjct: 85  VGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRI 144

Query: 228 RIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
           R+Q      G      +  P I  I K      L +G  P +LR   G G+  + +
Sbjct: 145 RLQTQ---TGSGATAEFKGP-IDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTY 196

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 82/181 (45%), Gaps = 22/181 (12%)

Query: 4   ARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKE 63
           ++ L     +  G   G +   +  P++ ++ R+Q Q   G   ++KG +DCIK++    
Sbjct: 113 SQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVN- 171

Query: 64  GASRLYKGISSPVLMEAPKRATKFACNDEF------QKIYKREFGVEKLTQSLSILSGAS 117
              +L +G++  +L E+      F   +          I +++    KL      L GA+
Sbjct: 172 --GQLMRGLTPTMLRESHGCGVYFLTYEALIGHQVKSGIQRKDIPAWKL-----CLFGAA 224

Query: 118 AGCCEAFVVVPFELVKIRLQDVSSSYKGP------IDVVRKIIAQEGVLAMYNGLESTLW 171
           +G     +V P +++K  +Q  + + K P      + V R IIA++GV  ++ G   T+ 
Sbjct: 225 SGTLLWTMVYPLDVIKSVMQ--TDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTML 282

Query: 172 R 172
           R
Sbjct: 283 R 283

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 45/111 (40%), Gaps = 9/111 (8%)

Query: 185 FQVRALLPEAKSKSQQTR--NDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKY 242
           F    L+ + +S    TR   DL+AG+ GG    L+  PFD  K R+Q +       +  
Sbjct: 5   FPTPQLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVK-- 62

Query: 243 NWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRTL 293
                 I  + K EG    YKG +  ++ +G    +   V      FF T 
Sbjct: 63  -----VIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTF 108

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 91.3 bits (225), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 77/283 (27%), Positives = 132/283 (46%), Gaps = 28/283 (9%)

Query: 8   PFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASR 67
           P  +Q  AGA AGI E  V++P+D +KTR+Q   SG      +G++  I +I   EG+  
Sbjct: 15  PLHHQLLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAAT---QGLIKQISKITTAEGSLA 71

Query: 68  LYKGISSPVLMEAPKRATKFACNDEFQK---IYKREFGVEKLTQSLSILSGASAGCCEAF 124
           L+KG+ S +L   P  A  FA   EF K   I  ++    +  ++   +SG +A      
Sbjct: 72  LWKGVQSVILGAGPAHAVYFATY-EFSKSKLIDPQDMHTHQPIKTA--ISGMAATTVADA 128

Query: 125 VVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGII 184
           ++ PF+++K R+Q   ++ +    V + I  +EG  A Y    +TL    V N  +    
Sbjct: 129 LMNPFDVIKQRMQ--LNTRESVWHVTKNIYHKEGFAAFYYSYPTTL----VMNIPFAAFN 182

Query: 185 FQVRALLPEAKSKSQQTRND------LIAGSIGGTIGSLMSTPFDVVKSRIQ---NTAVV 235
           F +     E+ +K     N+       I+G + G   + ++TP D +K+ +Q   +  V 
Sbjct: 183 FAIY----ESATKFMNPSNEYNPFIHCISGGLSGATCAAITTPLDCIKTVLQVRGSETVS 238

Query: 236 AGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGI 278
               ++ N    +   IYK  G++   +G  P+V+   P   I
Sbjct: 239 NEIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAI 281

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 38/85 (44%), Gaps = 10/85 (11%)

Query: 202 RNDLIAGSIGGTIGSLMSTPFDVVKSRIQNT---AVVAGGARKYNWSWPSIFTIYKEEGF 258
            + L+AG+  G +   +  P D +K+RIQ++   A   G  ++       I  I   EG 
Sbjct: 17  HHQLLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLIKQ-------ISKITTAEGS 69

Query: 259 RALYKGFVPKVLRLGPGGGILLVVF 283
            AL+KG    +L  GP   +    +
Sbjct: 70  LALWKGVQSVILGAGPAHAVYFATY 94

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 90.9 bits (224), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 80/287 (27%), Positives = 130/287 (45%), Gaps = 37/287 (12%)

Query: 9   FFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRL 68
           FF    +GA AG S  LV +P+D +KTR  LQ  GG                A  G   +
Sbjct: 4   FFLSLLSGAAAGTSTDLVFFPIDTIKTR--LQAKGGF--------------FANGGYKGI 47

Query: 69  YKGISSPVLMEAPKRATKFACNDEFQKIYKREF-------GVEKLTQSLSILSGASAG-C 120
           Y+G+ S V+  AP  A+ F  + ++ K+  R +       G E+L  + + +  +S G  
Sbjct: 48  YRGLGSAVVASAPG-ASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEI 106

Query: 121 CEAFVVVPFELVKIRLQ--DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNA 178
           C   V VP E+VK R Q    +SS++    ++R    +     +Y G  +T+ R   +  
Sbjct: 107 CACLVRVPAEVVKQRTQVHSTNSSWQTLQSILRNDNKEGLRKNLYRGWSTTIMREIPFTC 166

Query: 179 GYFGIIFQVRALLPEAKSKSQ-QTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQ-NTAVVA 236
             F +   ++    +A  +SQ +     I GSI G I +  +TP D +K+R+  N    +
Sbjct: 167 IQFPLYEYLKKTWAKANGQSQVEPWKGAICGSIAGGIAAATTTPLDFLKTRLMLNKTTAS 226

Query: 237 GGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
            G+         I  IY+EEG    + G  P+ + +  GG I L ++
Sbjct: 227 LGS--------VIIRIYREEGPAVFFSGVGPRTMWISAGGAIFLGMY 265

>Kwal_27.12599
          Length = 304

 Score = 90.9 bits (224), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 78/289 (26%), Positives = 127/289 (43%), Gaps = 28/289 (9%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74
           AG   G++++LV  P D  K R+Q   +          V+ +K++V  EG    YKG  +
Sbjct: 30  AGTAGGMAQVLVGQPFDTTKVRLQTSTTP------TTAVEVVKKLVKNEGLRGFYKGTLT 83

Query: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLS--ILSGASAGCCEAFVVVPFELV 132
           P++      + +F  N+  ++ ++        T +L    + G   G   +F+  P E V
Sbjct: 84  PLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHV 143

Query: 133 KIRLQDVSSS-----YKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQV 187
           +IRLQ  ++S     +KGP+D + K+ A     A+  GL  T+ R     A YF      
Sbjct: 144 RIRLQTQTASGTVAEFKGPLDCINKLRANG---ALMRGLSPTILREAQGCATYF---LTY 197

Query: 188 RALLPEAKSKSQQTRNDLIA------GSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARK 241
            AL+     K    R+D+ A      G++ G    L   P DV+KS +Q T  +    R 
Sbjct: 198 EALVANQIGKG-IARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQ-TDNLKNPVRG 255

Query: 242 YNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFF 290
            N    +   +  + G+++ +KGF P +LR  P  G     F   M F 
Sbjct: 256 KNIIQVARL-VNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAMRFL 303

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 78/168 (46%), Gaps = 8/168 (4%)

Query: 111 SILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTL 170
            +L+G + G  +  V  PF+  K+RLQ  S++    ++VV+K++  EG+   Y G  + L
Sbjct: 27  DLLAGTAGGMAQVLVGQPFDTTKVRLQ-TSTTPTTAVEVVKKLVKNEGLRGFYKGTLTPL 85

Query: 171 WRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRN---DLIAGSIGGTIGSLMSTPFDVVKS 227
              G   +  FG+   ++     + +   +T       I G +GG   S +++P + V+ 
Sbjct: 86  VGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPIEHVRI 145

Query: 228 RIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPG 275
           R+Q T   +G   ++      +  I K     AL +G  P +LR   G
Sbjct: 146 RLQ-TQTASGTVAEFKG---PLDCINKLRANGALMRGLSPTILREAQG 189

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 85/187 (45%), Gaps = 24/187 (12%)

Query: 7   LPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGAS 66
           LP +Y    G V G++   +  P++ V+ R+Q Q + G   ++KG +DCI ++ A  GA 
Sbjct: 119 LPQYY--ICGFVGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINKLRA-NGA- 174

Query: 67  RLYKGISSPVLMEAPKRATKF------ACNDEFQKIYKREFGVEKLTQSLSILSGASAGC 120
            L +G+S  +L EA   AT F        N   + I + +    KL      L GA +G 
Sbjct: 175 -LMRGLSPTILREAQGCATYFLTYEALVANQIGKGIARSDVPAWKL-----CLFGAVSGV 228

Query: 121 CEAFVVVPFELVKIRLQDVSSSYKGP------IDVVRKIIAQEGVLAMYNGLESTLWRHG 174
                V P +++K  +Q  + + K P      I V R + A+ G  + + G   T+ R  
Sbjct: 229 TLWLTVYPLDVIKSLMQ--TDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAA 286

Query: 175 VWNAGYF 181
             N   F
Sbjct: 287 PANGATF 293

>Scas_489.4
          Length = 297

 Score = 90.5 bits (223), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 72/301 (23%), Positives = 131/301 (43%), Gaps = 21/301 (6%)

Query: 3   DARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAK 62
           + +P+   + F AGA+AG  E  + YP +  KTR+QL        +   V+  I      
Sbjct: 4   EKKPVDPLHSFIAGALAGAIEASITYPFEFAKTRLQLIDKTSTASRNPLVL--IYNTAKT 61

Query: 63  EGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCE 122
           +G   +Y G  + ++    K   +F   D  + +  R+    +L+    +++G  AG  E
Sbjct: 62  QGTGAIYVGCPAFIVGNTAKAGIRFLGFDTIKNML-RDPVTGELSGPRGVVAGLGAGLLE 120

Query: 123 AFV-VVPFELVKIRLQDVSSSYK--------GPIDVVRKIIAQEGVLAMYNGLESTLWRH 173
           + V V PFE +K  L D   + K        G +     ++  +G++ +Y G+     R 
Sbjct: 121 SVVAVTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVLPVSMRQ 180

Query: 174 GVWNAGYFGIIFQVRALLPE----AKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRI 229
               A   G   +++ ++ +     K +   +    I G+  G +    + P D VK+R+
Sbjct: 181 AANQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTTMPIDTVKTRM 240

Query: 230 QNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDF 289
           Q+       A KY  +      I+KEEG +  +KG  P++ RL   GGI+  ++   + F
Sbjct: 241 QSL-----DATKYTSTVNCFAKIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYENVLVF 295

Query: 290 F 290
            
Sbjct: 296 L 296

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 90.1 bits (222), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 131/295 (44%), Gaps = 24/295 (8%)

Query: 2   TDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVA 61
           +D  PL   + F AG++AG +E  + YP +  KTR+QL        +   V+  I +   
Sbjct: 8   SDVDPL---HSFLAGSLAGAAEACITYPFEFAKTRLQLIDKASKASRNPLVL--IYKTAK 62

Query: 62  KEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCC 121
            +G   +Y G  + ++    K   +F   D  + +  R+    +L+ +  +++G  AG  
Sbjct: 63  TQGIGSIYVGCPAFIIGNTAKAGIRFLGFDTIKDML-RDSETGELSGTRGVIAGLGAGLL 121

Query: 122 EAFV-VVPFELVKIRLQDVSSSY--------KGPIDVVRKIIAQEGVLAMYNGLESTLWR 172
           E+   V PFE +K  L D   S         +G +     ++  +G   +Y G+     R
Sbjct: 122 ESVAAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMR 181

Query: 173 HGVWNAGYFGIIFQVRALLPE----AKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSR 228
                A   G   +++ L+ +     K K   +    + G+  G +    + P D VK+R
Sbjct: 182 QAANQAVRLGCYNKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTMPLDTVKTR 241

Query: 229 IQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
           +Q+       + KY+ +     TI+KEEG +  +KG  P++ RL   GGI+  ++
Sbjct: 242 MQSL-----DSTKYSSTMNCFATIFKEEGLKTFWKGATPRLGRLVLSGGIVFTIY 291

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 90.9 bits (224), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 74/287 (25%), Positives = 129/287 (44%), Gaps = 21/287 (7%)

Query: 10  FYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLY 69
           F+ F AG++AG  E  + YP +  KTR+QL        +   V+  I       G S +Y
Sbjct: 91  FHSFLAGSIAGAIEASITYPFEFAKTRLQLVDKASKASRNPLVL--IYNTGKNYGISSIY 148

Query: 70  KGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFV-VVP 128
            G  + ++    K   +F   D  + +  R+    +L+    +++G  AG  E+ V V P
Sbjct: 149 VGCPAFIVGNTAKAGIRFLGFDTIKNLL-RDKKTGELSGFRGVVAGLGAGLLESVVAVTP 207

Query: 129 FELVKIRLQD--------VSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGY 180
           FE +K  L D          ++ KG +    K+++ +G   +Y G+     R     A  
Sbjct: 208 FEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQAANQAVR 267

Query: 181 FGIIFQVRALLPE----AKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVA 236
            G   +++ L+ +     K K   +    I G+  G +    + P D VK+R+Q+     
Sbjct: 268 LGCYNKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTTMPIDTVKTRMQSL---- 323

Query: 237 GGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
             A +Y+ +     TI+KEEG +  +KG  P++ RL   GGI+  ++
Sbjct: 324 -NAGQYSSTINCFATIFKEEGLKTFWKGATPRLGRLILSGGIVFTIY 369

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 33/67 (49%), Gaps = 4/67 (5%)

Query: 5   RPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEG 64
           +PL     F  GA +GI  +    P+D VKTRMQ   +G    QY   ++C   I  +EG
Sbjct: 288 KPLSSGLTFIVGAFSGIVTVYTTMPIDTVKTRMQSLNAG----QYSSTINCFATIFKEEG 343

Query: 65  ASRLYKG 71
               +KG
Sbjct: 344 LKTFWKG 350

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 90.9 bits (224), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 69/265 (26%), Positives = 114/265 (43%), Gaps = 32/265 (12%)

Query: 48  QYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLT 107
           ++    +   +I   EG + L++G+S  +LM  P     F+  + F+           L 
Sbjct: 96  RFNSTWEAFTKISEVEGLATLWRGLSITLLMAIPANVVYFSGYEMFRDHSPMRDSYPSLN 155

Query: 108 QSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSS---------YKGPIDVVRKIIAQEG 158
               +  GA+A    A  V P EL+K RLQ +  S         +K  +   R  I   G
Sbjct: 156 ---PLFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSGG 212

Query: 159 VLAMYNGLESTLWRHGVWNAGYFG----------IIFQVRALLPEAKSKSQQTRNDLIAG 208
              ++ GLE TLWR   ++A Y+G          I F  + L            N  I G
Sbjct: 213 YKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINSFIGG 272

Query: 209 SIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWS----------WPSIFTIYKEEGF 258
           S+ G+  +L++ PFDV K+R+Q T  +    R    S          +  ++ I + EG+
Sbjct: 273 SVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQTEGY 332

Query: 259 RALYKGFVPKVLRLGPGGGILLVVF 283
            ALY G +P+V+++ P   I++  +
Sbjct: 333 GALYTGLIPRVMKIAPSCAIMISTY 357

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/210 (21%), Positives = 91/210 (43%), Gaps = 26/210 (12%)

Query: 1   MTDARPL--PFFYQFAAGAVAGISEILVMYPLDVVKTRMQ----LQVSGGLGPQYKGVVD 54
           M D+ P   P F     GA A +     + PL+++KTR+Q     +        +K ++ 
Sbjct: 147 MRDSYPSLNPLF----CGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLK 202

Query: 55  CIKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSL---- 110
             +  +   G   L+KG+   +  + P  A  +   + ++K +  +F  + L  +L    
Sbjct: 203 ETRNEIRSGGYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNW 262

Query: 111 -----SILSGASAGCCEAFVVVPFELVKIRLQ---DVSSSYKGPIDVVRKIIAQEGVLAM 162
                S + G+ +G   A +  PF++ K R+Q   D+ +  +  +   +K ++  G+   
Sbjct: 263 DFFINSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKF 322

Query: 163 YNGLESTLWRHGVWNAGYFGIIFQVRALLP 192
              ++ T    G + A Y G+I +V  + P
Sbjct: 323 LYNIKQT---EG-YGALYTGLIPRVMKIAP 348

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 41/87 (47%), Gaps = 11/87 (12%)

Query: 9   FFYQFAAGAVAGISEILVMYPLDVVKTRMQL-------QVSGGLGPQY----KGVVDCIK 57
           F   F  G+V+G S  L+ +P DV KTRMQ+       Q +  + P+     +G+   + 
Sbjct: 265 FINSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLY 324

Query: 58  QIVAKEGASRLYKGISSPVLMEAPKRA 84
            I   EG   LY G+   V+  AP  A
Sbjct: 325 NIKQTEGYGALYTGLIPRVMKIAPSCA 351

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 89.7 bits (221), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 77/285 (27%), Positives = 129/285 (45%), Gaps = 19/285 (6%)

Query: 9   FFYQFAAGAVAGISEILVMYPLDVVKTRMQLQ----VSGGLGPQYKGVVDCIKQIVAKEG 64
           F   F  G V+         P++ VK  +Q Q      G L  +Y G++DC K+   +EG
Sbjct: 23  FLIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEG 82

Query: 65  ASRLYKGISSPVLMEAPKRATKFACNDEFQKI--YKREFGVEKLTQSLSILSGASAGCCE 122
               ++G ++ V+   P +A  FA  D+ + +  +K+E G  K     ++ SG +AG   
Sbjct: 83  VISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAG-NLASGGAAGALS 141

Query: 123 AFVVVPFELVKIRLQDVSSS--------YKGPIDVVRKIIAQEGVLAMYNGLESTLWRHG 174
              V   +  + RL   S S        + G IDV +K +  +GV  +Y G   ++    
Sbjct: 142 LLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIV 201

Query: 175 VWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAV 234
           V+   YFG+   ++ LL     +     + L+ G +  T  S  S P D V+ R+  T  
Sbjct: 202 VYRGLYFGMYDSLKPLLLTGSLEGSFLASFLL-GWVVTTGASTCSYPLDTVRRRMMMT-- 258

Query: 235 VAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGIL 279
            +G A KY+ ++  +  I   EG  +L+KG    +LR   G G++
Sbjct: 259 -SGQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAGVI 302

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 75/192 (39%), Gaps = 40/192 (20%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSG---GLGPQYKGVVDCIKQIVAKEGASRL 68
             A+G  AG   +L +Y LD  +TR+         G   Q+ G++D  K+ +  +G + L
Sbjct: 130 NLASGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGL 189

Query: 69  YKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSL------SILSGASAGCCE 122
           Y+G    V+     R   F   D  + +         LT SL      S L G       
Sbjct: 190 YRGFLPSVVGIVVYRGLYFGMYDSLKPLL--------LTGSLEGSFLASFLLGWVVTTGA 241

Query: 123 AFVVVPFELVKIRLQDVSSS---YKGPIDVVRKIIAQEGV-------------------- 159
           +    P + V+ R+   S     Y G  D +RKI+A EGV                    
Sbjct: 242 STCSYPLDTVRRRMMMTSGQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAGV 301

Query: 160 LAMYNGLESTLW 171
           ++MY+ L+  L+
Sbjct: 302 ISMYDQLQMILF 313

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 89.0 bits (219), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 76/276 (27%), Positives = 121/276 (43%), Gaps = 23/276 (8%)

Query: 16  GAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASR-LYKGISS 74
           G VAG    LV YP D VK R+Q Q S  L P       C+     +EG  R  Y+G++S
Sbjct: 15  GGVAGSLGKLVEYPFDTVKVRLQTQ-SAALFPT---TWSCVSHTYKQEGLWRGFYQGMAS 70

Query: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKI 134
           PV     + A  F   +  Q + +  +    L +   + +GA AG C ++V+ P ELVK 
Sbjct: 71  PVFGAFLEHAVLFVSFNRAQAVLENCYSCGPLEK--VVFAGAIAGACTSYVLTPVELVKC 128

Query: 135 RLQDVSSS------YKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVR 188
           +LQ  + +      Y   +  +R I+ Q G+  ++ G   T  R     A +F     ++
Sbjct: 129 KLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQSGTFIRESAGGAVWFTAYEVLK 188

Query: 189 ALLPEAKSKSQQTRNDLIAGSIGGTIGSLMST-PFDVVKSRIQNTAVVAGGARKYNWSWP 247
             L   +  ++ T  +L+A   G       S  P D VKS +Q   +  G         P
Sbjct: 189 GWLARRRGSTENTVWELLASGAGAGAAFHASIFPADTVKSTMQTEHLGLG---------P 239

Query: 248 SIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
           ++ T+ K+ G    Y+G    +LR  P   ++  V+
Sbjct: 240 AVRTVLKKHGPTGFYRGVGITLLRALPANAVIFYVY 275

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 78/174 (44%), Gaps = 3/174 (1%)

Query: 112 ILSGASAGCCEAFVVVPFELVKIRLQDVSSS-YKGPIDVVRKIIAQEGVL-AMYNGLEST 169
           +L G  AG     V  PF+ VK+RLQ  S++ +      V     QEG+    Y G+ S 
Sbjct: 12  LLYGGVAGSLGKLVEYPFDTVKVRLQTQSAALFPTTWSCVSHTYKQEGLWRGFYQGMASP 71

Query: 170 LWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRI 229
           ++   + +A  F    + +A+L    S        + AG+I G   S + TP ++VK ++
Sbjct: 72  VFGAFLEHAVLFVSFNRAQAVLENCYS-CGPLEKVVFAGAIAGACTSYVLTPVELVKCKL 130

Query: 230 QNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
           Q + +      +Y    P++  I K+ G   L++G     +R   GG +    +
Sbjct: 131 QVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQSGTFIRESAGGAVWFTAY 184

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 77/159 (48%), Gaps = 4/159 (2%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQL-QVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGIS 73
           AGA+AG     V+ P+++VK ++Q+  ++G  GP+Y  V+  ++ IV + G   L++G S
Sbjct: 108 AGAIAGACTSYVLTPVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQS 167

Query: 74  SPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVK 133
              + E+   A  F   +  +    R  G  + T    + SGA AG      + P + VK
Sbjct: 168 GTFIRESAGGAVWFTAYEVLKGWLARRRGSTENTVWELLASGAGAGAAFHASIFPADTVK 227

Query: 134 IRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWR 172
             +Q   + + G    VR ++ + G    Y G+  TL R
Sbjct: 228 STMQ---TEHLGLGPAVRTVLKKHGPTGFYRGVGITLLR 263

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 42/88 (47%), Gaps = 6/88 (6%)

Query: 198 SQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEG 257
           + +   DL+ G + G++G L+  PFD VK R+Q  +     A  +  +W  +   YK+EG
Sbjct: 5   ADKAYKDLLYGGVAGSLGKLVEYPFDTVKVRLQTQS-----AALFPTTWSCVSHTYKQEG 59

Query: 258 -FRALYKGFVPKVLRLGPGGGILLVVFT 284
            +R  Y+G    V        +L V F 
Sbjct: 60  LWRGFYQGMASPVFGAFLEHAVLFVSFN 87

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 89.0 bits (219), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 119/282 (42%), Gaps = 29/282 (10%)

Query: 16  GAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASR-LYKGISS 74
           G++AG    ++ +P D VK R+Q Q S      +     CIK     EG +R  ++GI+S
Sbjct: 20  GSIAGACGKVIEFPFDTVKVRLQTQASNVFPTTW----SCIKFTYQNEGIARGFFQGIAS 75

Query: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKI 134
           P++    + AT F   ++  K  ++   V  L Q L  +SG  AG C + V+ P ELVK 
Sbjct: 76  PLVGACLENATLFVSYNQCSKFLEKHTNVFPLGQIL--ISGGVAGSCASLVLTPVELVKC 133

Query: 135 RLQ-------DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQV 187
           +LQ          + +   +  ++ II + G+  ++ G   T  R       +F     V
Sbjct: 134 KLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFGGVAWFATYEIV 193

Query: 188 RALLPEAKSKSQQTRND------LIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARK 241
           +  L +  S     R++      LI+G   G   +    P D VKS +Q   +    A K
Sbjct: 194 KKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPADTVKSVMQTEHISLTNAVK 253

Query: 242 YNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
                     I+ + G +  Y+G    + R  P    +  +F
Sbjct: 254 ---------KIFGKFGLKGFYRGLGITLFRAVPANAAVFYIF 286

 Score = 58.9 bits (141), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 79/170 (46%), Gaps = 4/170 (2%)

Query: 110 LSILSGASAGCCEAFVVVPFELVKIRLQDVSSS-YKGPIDVVRKIIAQEGVL-AMYNGLE 167
           L I++G+ AG C   +  PF+ VK+RLQ  +S+ +      ++     EG+    + G+ 
Sbjct: 15  LDIINGSIAGACGKVIEFPFDTVKVRLQTQASNVFPTTWSCIKFTYQNEGIARGFFQGIA 74

Query: 168 STLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKS 227
           S L    + NA  F    Q    L E  +        LI+G + G+  SL+ TP ++VK 
Sbjct: 75  SPLVGACLENATLFVSYNQCSKFL-EKHTNVFPLGQILISGGVAGSCASLVLTPVELVKC 133

Query: 228 RIQNTAV-VAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGG 276
           ++Q   + VA    K+    P+I  I  E G   L++G     +R   GG
Sbjct: 134 KLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFGG 183

 Score = 55.8 bits (133), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 53/184 (28%), Positives = 87/184 (47%), Gaps = 12/184 (6%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQ---LQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKG 71
           +G VAG    LV+ P+++VK ++Q   LQV+       K V+  IK I+ + G + L++G
Sbjct: 113 SGGVAGSCASLVLTPVELVKCKLQVANLQVASAKTKHTK-VLPTIKAIITERGLAGLWQG 171

Query: 72  ISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLS-----ILSGASAGCCEAFVV 126
            S   + E+      FA  +  +K  K    ++   +  S     ++SG SAG      +
Sbjct: 172 QSGTFIRESFGGVAWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASI 231

Query: 127 VPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQ 186
            P + VK  +Q   + +    + V+KI  + G+   Y GL  TL+R    NA  F I   
Sbjct: 232 FPADTVKSVMQ---TEHISLTNAVKKIFGKFGLKGFYRGLGITLFRAVPANAAVFYIFET 288

Query: 187 VRAL 190
           + AL
Sbjct: 289 LSAL 292

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 39/89 (43%), Gaps = 6/89 (6%)

Query: 204 DLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGF-RALY 262
           D+I GSI G  G ++  PFD VK R+Q  A     +  +  +W  I   Y+ EG  R  +
Sbjct: 16  DIINGSIAGACGKVIEFPFDTVKVRLQTQA-----SNVFPTTWSCIKFTYQNEGIARGFF 70

Query: 263 KGFVPKVLRLGPGGGILLVVFTGCMDFFR 291
           +G    ++        L V +  C  F  
Sbjct: 71  QGIASPLVGACLENATLFVSYNQCSKFLE 99

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 89.0 bits (219), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 81/285 (28%), Positives = 128/285 (44%), Gaps = 19/285 (6%)

Query: 9   FFYQFAAGAVAGISEILVMYPLDVVKTRMQLQ----VSGGLGPQYKGVVDCIKQIVAKEG 64
           F   F  G V+         P++ VK  +Q Q      G L  +YKG+VDC ++   +EG
Sbjct: 11  FAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQRTARQEG 70

Query: 65  ASRLYKGISSPVLMEAPKRATKFACNDEFQKI--YKREFGVEKLTQSLSILSGASAGCCE 122
               ++G ++ V+   P +A  FA  D+ + +  +K+E G  K     ++ SG  AG   
Sbjct: 71  IISFWRGNTANVIRYFPTQALNFAFKDQIKAMFGFKKEEGYAKWFAG-NLASGGIAGGLS 129

Query: 123 AFVVVPFELVKIRL-QDVSSSYKGP-------IDVVRKIIAQEGVLAMYNGLESTLWRHG 174
              V   +  + RL  D  SS KG        +DV +K IA +GV  +Y G   ++    
Sbjct: 130 LMFVYSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGLYRGFLPSVIGIV 189

Query: 175 VWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAV 234
           V+   YFG+    + LL     +     + L+ G +  T  S  S P D V+ R+  T  
Sbjct: 190 VYRGLYFGLYDSCKPLLLTGSLEGSFIASFLL-GWVVTTGASTASYPLDTVRRRMMMT-- 246

Query: 235 VAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGIL 279
            +G A KY  +   +  I   EG  +L+KG    +LR   G G++
Sbjct: 247 -SGQAVKYKGAMDCLQKIVAAEGVSSLFKGCGANILRGVAGAGVI 290

 Score = 53.1 bits (126), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 88/192 (45%), Gaps = 22/192 (11%)

Query: 112 ILSGASAGCCEAFVVVPFELVKIRLQD---------VSSSYKGPIDVVRKIIAQEGVLAM 162
           ++ G SA   +     P E VK+ +Q+         +   YKG +D  ++   QEG+++ 
Sbjct: 16  LMGGVSAAVAKT-AASPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQRTARQEGIISF 74

Query: 163 YNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSK--SQQTRNDLIAGSIGGTIGSLMST 220
           + G  + + R+    A  F    Q++A+    K +  ++    +L +G I G +  +   
Sbjct: 75  WRGNTANVIRYFPTQALNFAFKDQIKAMFGFKKEEGYAKWFAGNLASGGIAGGLSLMFVY 134

Query: 221 PFDVVKSRIQNTAVVA--GGARKYNWSWPSIFTIYKE----EGFRALYKGFVPKVLRLGP 274
             D  ++R+   A  +  GG R++N     +  +YK+    +G   LY+GF+P V+ +  
Sbjct: 135 SLDYARTRLAADAKSSKKGGERQFN----GLVDVYKKTIASDGVAGLYRGFLPSVIGIVV 190

Query: 275 GGGILLVVFTGC 286
             G+   ++  C
Sbjct: 191 YRGLYFGLYDSC 202

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 79/192 (41%), Gaps = 40/192 (20%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSG---GLGPQYKGVVDCIKQIVAKEGASRL 68
             A+G +AG   ++ +Y LD  +TR+         G   Q+ G+VD  K+ +A +G + L
Sbjct: 118 NLASGGIAGGLSLMFVYSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGL 177

Query: 69  YKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSL------SILSGASAGCCE 122
           Y+G    V+     R   F   D  + +         LT SL      S L G       
Sbjct: 178 YRGFLPSVIGIVVYRGLYFGLYDSCKPLL--------LTGSLEGSFIASFLLGWVVTTGA 229

Query: 123 AFVVVPFELVKIRLQDVSSS---YKGPIDVVRKIIAQEGV-------------------- 159
           +    P + V+ R+   S     YKG +D ++KI+A EGV                    
Sbjct: 230 STASYPLDTVRRRMMMTSGQAVKYKGAMDCLQKIVAAEGVSSLFKGCGANILRGVAGAGV 289

Query: 160 LAMYNGLESTLW 171
           +++Y+ L+  L+
Sbjct: 290 ISLYDQLQMILF 301

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 89.0 bits (219), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 76/302 (25%), Positives = 130/302 (43%), Gaps = 29/302 (9%)

Query: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGI 72
           F AG +AG     V+ P + VK  +Q+Q S     Q  G+V  ++Q+  +EG   L++G 
Sbjct: 26  FLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQ--GIVGAVRQVYREEGTPGLFRGN 83

Query: 73  SSPVLMEAPKRATKF----ACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVP 128
               +   P  A +F    AC   F  +   + G E+L     + SGA  G C      P
Sbjct: 84  GLNCIRIFPYSAVQFVVYEACKKHFFHVDGSK-GREQLQNWQRLFSGALCGGCSVLATYP 142

Query: 129 FELVKIRLQDVSSSYK--------------GPIDVVRKIIAQEG-VLAMYNGLESTLWRH 173
            +LV+ RL   +++                G  D++ +   +EG +  +Y G+  T    
Sbjct: 143 LDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLGV 202

Query: 174 GVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTA 233
             + A  F +  Q +  +PE    +      L  G++ G +   ++ PFD+++ R Q   
Sbjct: 203 VPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQ--- 259

Query: 234 VVAGGARKYNWSWPSIF----TIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDF 289
           V+A G  +  + + S+     TI K EGFR  YKG    + ++ P   +  +V+    D 
Sbjct: 260 VLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEVVCDL 319

Query: 290 FR 291
             
Sbjct: 320 MH 321

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 94/201 (46%), Gaps = 16/201 (7%)

Query: 105 KLTQSLSILSGASAGCCEAFVVVPFELVKIRL--QDVSSSY-KGPIDVVRKIIAQEGVLA 161
           K   +++ L+G  AG     VV PFE VKI L  Q+ +++Y +G +  VR++  +EG   
Sbjct: 19  KNDSNVAFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPG 78

Query: 162 MYNGLESTLWRHGVWNAGYFGIIFQVRALLPE---AKSKSQ-QTRNDLIAGSIGGTIGSL 217
           ++ G      R   ++A  F +    +        +K + Q Q    L +G++ G    L
Sbjct: 79  LFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQLQNWQRLFSGALCGGCSVL 138

Query: 218 MSTPFDVVKSRIQ-NTAVVA--GGARKYNWS-----WPSIFTIYKEE-GFRALYKGFVPK 268
            + P D+V++R+   TA +     +R +N S     W  +   YKEE G + LY+G  P 
Sbjct: 139 ATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPT 198

Query: 269 VLRLGPGGGILLVVFTGCMDF 289
            L + P   +   V+    +F
Sbjct: 199 SLGVVPYVALNFAVYEQFKEF 219

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 2/83 (2%)

Query: 7   LPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGG--LGPQYKGVVDCIKQIVAKEG 64
           L  FY+ + GA++G     V YP D+++ R Q+   GG  LG +YK V+D +  I   EG
Sbjct: 228 LANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEG 287

Query: 65  ASRLYKGISSPVLMEAPKRATKF 87
               YKG+++ +    P  A  +
Sbjct: 288 FRGYYKGLTANLFKVIPSTAVSW 310

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 49/110 (44%), Gaps = 9/110 (8%)

Query: 186 QVRALLPEAKSKSQQTRND----LIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARK 241
           ++  +LP+        +ND     +AG + G +   + +PF+ VK  +Q    V      
Sbjct: 3   ELAQVLPQPSYVKSILKNDSNVAFLAGGLAGAVSRTVVSPFERVKILLQ----VQNSTTA 58

Query: 242 YNWSW-PSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFF 290
           YN     ++  +Y+EEG   L++G     +R+ P   +  VV+  C   F
Sbjct: 59  YNQGIVGAVRQVYREEGTPGLFRGNGLNCIRIFPYSAVQFVVYEACKKHF 108

>Kwal_27.12481
          Length = 304

 Score = 88.6 bits (218), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 77/294 (26%), Positives = 133/294 (45%), Gaps = 20/294 (6%)

Query: 1   MTDARPLP-FFYQFAAGAVAGISEILVMYPLDVVKTRMQLQ----VSGGLGPQYKGVVDC 55
           M D++    F   F  G V+         P++ VK  +Q Q      G L  +Y G+ +C
Sbjct: 1   MADSKKQSNFAVDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIGEC 60

Query: 56  IKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKI--YKREFGVEKLTQSLSIL 113
            K+  A EG +  ++G ++ V+   P +A  FA  D+ + +  +K+E G  K     ++ 
Sbjct: 61  FKRTAANEGIASFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAG-NLA 119

Query: 114 SGASAGCCEAFVVVPFELVKIRLQDVSS--------SYKGPIDVVRKIIAQEGVLAMYNG 165
           SG +AG      V   +  + RL   S          + G +DV +K +A +G+  +Y G
Sbjct: 120 SGGAAGGLSLMFVYSLDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAGLYRG 179

Query: 166 LESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVV 225
              ++    V+   YFG    ++ LL     +     + L+  ++  T  S  S P D V
Sbjct: 180 FLPSVVGIVVYRGLYFGGYDSLKPLLLTGSLEGSFLASFLLGWAV-TTGASTASYPLDTV 238

Query: 226 KSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGIL 279
           + R+  T   +G A KYN ++ +   I   EG ++L+KG    +LR   G G++
Sbjct: 239 RRRMMMT---SGQAVKYNGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGVI 289

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 77/192 (40%), Gaps = 40/192 (20%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSG---GLGPQYKGVVDCIKQIVAKEGASRL 68
             A+G  AG   ++ +Y LD  +TR+     G   G   Q+ G+VD  K+ +A +G + L
Sbjct: 117 NLASGGAAGGLSLMFVYSLDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAGL 176

Query: 69  YKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSL------SILSGASAGCCE 122
           Y+G    V+     R   F   D  + +         LT SL      S L G +     
Sbjct: 177 YRGFLPSVVGIVVYRGLYFGGYDSLKPLL--------LTGSLEGSFLASFLLGWAVTTGA 228

Query: 123 AFVVVPFELVKIRLQDVSSS---YKGPIDVVRKIIAQEG--------------------V 159
           +    P + V+ R+   S     Y G  D  RKI+A EG                    V
Sbjct: 229 STASYPLDTVRRRMMMTSGQAVKYNGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGV 288

Query: 160 LAMYNGLESTLW 171
           ++MY+ L+  L+
Sbjct: 289 ISMYDQLQMILF 300

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 89.4 bits (220), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 78/297 (26%), Positives = 143/297 (48%), Gaps = 38/297 (12%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74
           +GA+AG    +++ PLDV KTR+Q Q +G     Y+G+V  +  I+  EG + LYKG++ 
Sbjct: 90  SGALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLYKGLAP 149

Query: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKI 134
            VL   P     F+  ++ ++ Y        ++ + S L   +AG     +  P  +VK 
Sbjct: 150 IVLGYFPTWMLYFSVYEKCKQRYPSYLPGGFVSHAASAL---TAGAISTALTNPIWVVKT 206

Query: 135 RL---QDV---SSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWN-AGYFGIIFQV 187
           RL    DV   S++Y+  +D  RK+   EG+   Y+GL  +L+  G+++ A +F +  ++
Sbjct: 207 RLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLF--GLFHVAIHFPVYEKL 264

Query: 188 RALLPEAKSKSQQTRND---------LIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGG 238
           +  L      +   R D         ++A  +   + S+++ P +++++R+Q        
Sbjct: 265 KIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSKVVASVITYPHEILRTRMQV------- 317

Query: 239 ARKYNWSWPSIFT----IYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFR 291
             +++   PS+      I   EG+   Y GF   ++R  P   I LV F    ++FR
Sbjct: 318 --RHSGVPPSLLNLLGRIRASEGYVGFYSGFATNLVRTVPASVITLVSF----EYFR 368

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 75/170 (44%), Gaps = 11/170 (6%)

Query: 110 LSILSGASAGCCEAFVVVPFELVKIRLQDVSSS-----YKGPIDVVRKIIAQEGVLAMYN 164
           ++ +SGA AG     +V P ++ K RLQ   +      Y+G +  +  I+  EGV  +Y 
Sbjct: 86  VTAVSGALAGFVSGIMVCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLYK 145

Query: 165 GLESTLWRHGVWNAGYFGIIFQVRALLPEAKSKS--QQTRNDLIAGSIGGTIGSLMSTPF 222
           GL   +  +      YF +  + +   P            + L AG+    I + ++ P 
Sbjct: 146 GLAPIVLGYFPTWMLYFSVYEKCKQRYPSYLPGGFVSHAASALTAGA----ISTALTNPI 201

Query: 223 DVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRL 272
            VVK+R+   + V+  +  Y  +  +   +Y+ EG +  Y G VP +  L
Sbjct: 202 WVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLFGL 251

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 41/88 (46%), Gaps = 1/88 (1%)

Query: 199 QQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGF 258
             T+   ++G++ G +  +M  P DV K+R+Q       G R Y     ++  I ++EG 
Sbjct: 82  DDTQVTAVSGALAGFVSGIMVCPLDVAKTRLQAQG-AGSGERYYRGIVGTLSAILRDEGV 140

Query: 259 RALYKGFVPKVLRLGPGGGILLVVFTGC 286
             LYKG  P VL   P   +   V+  C
Sbjct: 141 AGLYKGLAPIVLGYFPTWMLYFSVYEKC 168

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 71/175 (40%), Gaps = 13/175 (7%)

Query: 9   FFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGL-GPQYKGVVDCIKQIVAKEGASR 67
           F    A+   AG     +  P+ VVKTR+ +Q         Y+  +D  +++   EG   
Sbjct: 180 FVSHAASALTAGAISTALTNPIWVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKV 239

Query: 68  LYKGISSPVLMEAPKRATKFACNDEFQKIYKRE--------FGVEKLTQSLSILSGASAG 119
            Y G+  P L      A  F   ++ +    R             KL     I++   + 
Sbjct: 240 FYSGL-VPSLFGLFHVAIHFPVYEKLKIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSK 298

Query: 120 CCEAFVVVPFELVKIRLQDVSSSYKGP--IDVVRKIIAQEGVLAMYNGLESTLWR 172
              + +  P E+++ R+Q V  S   P  ++++ +I A EG +  Y+G  + L R
Sbjct: 299 VVASVITYPHEILRTRMQ-VRHSGVPPSLLNLLGRIRASEGYVGFYSGFATNLVR 352

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 88.2 bits (217), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 73/296 (24%), Positives = 132/296 (44%), Gaps = 21/296 (7%)

Query: 1   MTDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIV 60
           M+ ++ +     F AG +AG  E  V YP +  KTR+QL        +   V+  I    
Sbjct: 1   MSQSKQVDPSKSFIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKASRNPLVL--IYNTA 58

Query: 61  AKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGC 120
             +G   +Y G  + ++    K   +F   D  + +  R+    +L+    +++G  AG 
Sbjct: 59  KTQGIGSVYVGCPAFIVGNTAKAGVRFLGFDTIKNLL-RDPKTGELSGPRGVIAGLGAGL 117

Query: 121 CEAFV-VVPFELVKIRLQDVSSSY--------KGPIDVVRKIIAQEGVLAMYNGLESTLW 171
            E+ V V PFE +K  L D   S         KG +     ++ ++G+  +Y G+     
Sbjct: 118 LESVVAVTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLPVSM 177

Query: 172 RHGVWNAGYFGIIFQVRALLPE----AKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKS 227
           R     A   G   +++ ++ +     K K   +    + G+  G +    + P D VK+
Sbjct: 178 RQAANQAVRLGCYNKIKVMVQDYTNAPKDKPLSSGLTFVVGAFSGIVTVYTTMPIDTVKT 237

Query: 228 RIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
           R+Q+       +++Y+ +     TI+KEEG +A +KG  P++ RL   GGI+  V+
Sbjct: 238 RMQSL-----DSKRYSSTINCFTTIFKEEGLKAFWKGATPRLGRLFLSGGIVFTVY 288

 Score = 52.8 bits (125), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 93/202 (46%), Gaps = 22/202 (10%)

Query: 104 EKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQ---DVSSSYKGPIDVVRKIIAQEGVL 160
           +++  S S ++G  AG  EA V  PFE  K RLQ     S + + P+ ++      +G+ 
Sbjct: 5   KQVDPSKSFIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKASRNPLVLIYNTAKTQGIG 64

Query: 161 AMYNGLESTLWRHGVWNAGYFGIIF----QVRALLPEAKSKSQQTRNDLIAGSIGGTIGS 216
           ++Y G  + +    V N    G+ F     ++ LL + K+        +IAG   G + S
Sbjct: 65  SVYVGCPAFI----VGNTAKAGVRFLGFDTIKNLLRDPKTGELSGPRGVIAGLGAGLLES 120

Query: 217 LMS-TPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIY----KEEGFRALYKGFVPKVLR 271
           +++ TPF+ +K+ + +    A    KY+ +   +   Y    +++G   LY+G +P  +R
Sbjct: 121 VVAVTPFEAIKTALIDDKQSA--TPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLPVSMR 178

Query: 272 LGPGGGILLVVFTGCMDFFRTL 293
                 + L    GC +  + +
Sbjct: 179 QAANQAVRL----GCYNKIKVM 196

>Kwal_33.12988
          Length = 303

 Score = 88.6 bits (218), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 77/291 (26%), Positives = 129/291 (44%), Gaps = 36/291 (12%)

Query: 14  AAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGIS 73
            AG   GI+++LV  P D+ K R+Q   +          +  ++ +V  EG    YKG +
Sbjct: 28  TAGTTGGIAQVLVGQPFDITKVRLQTSSTPTTA------LRVVQDLVKNEGLRGFYKGTT 81

Query: 74  SPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLS--ILSGASAGCCEAFVVVPFEL 131
            P++      +++F  N+  ++ + +    +  +  L      G  +GC  AF+  P E 
Sbjct: 82  LPLIGVGLCVSSQFGTNEAMKRYFHKRNNFQSTSLRLPEYYACGFVSGCANAFLATPIEH 141

Query: 132 VKIRLQDVSSS-----YKGPIDVVRKIIAQEGVLAMYNGLESTLWR--HGVWNAGYFGII 184
           V+I LQ  + S     Y+G +D ++K++ +EG L    G   T+ R  HG      FG+ 
Sbjct: 142 VRILLQVQTKSRADAEYQGAMDCIKKLL-KEGKLM--RGFTPTILRTSHG------FGVY 192

Query: 185 FQVRALLPEAKSKSQQTRNDLIA------GSIGGTIGSLMSTPFDVVKSRIQNTAVVAG- 237
           F     +  ++ +    R D+ A      G+  G++   M  PFDV+KS +Q+  +    
Sbjct: 193 FTSYEAMICSEQRKGIARKDIPAWKLCLYGAFSGSLLWAMVYPFDVIKSVMQSDKLRTPV 252

Query: 238 -GARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCM 287
            G   +  +      IY E G +A  KGF P +LR  P  G     F   M
Sbjct: 253 YGTNVFQVAK----NIYNERGPKAFVKGFGPTMLRSLPVNGATFTAFEMAM 299

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 86/187 (45%), Gaps = 24/187 (12%)

Query: 7   LPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGAS 66
           LP +Y  A G V+G +   +  P++ V+  +Q+Q       +Y+G +DCIK+++ KEG  
Sbjct: 118 LPEYY--ACGFVSGCANAFLATPIEHVRILLQVQTKSRADAEYQGAMDCIKKLL-KEG-- 172

Query: 67  RLYKGISSPVLMEAPKRATKFA------CNDEFQKIYKREFGVEKLTQSLSILSGASAGC 120
           +L +G +  +L  +      F       C+++ + I +++    KL      L GA +G 
Sbjct: 173 KLMRGFTPTILRTSHGFGVYFTSYEAMICSEQRKGIARKDIPAWKL-----CLYGAFSGS 227

Query: 121 CEAFVVVPFELVKIRLQDVSSSYKGPI------DVVRKIIAQEGVLAMYNGLESTLWRHG 174
               +V PF+++K  +Q  S   + P+       V + I  + G  A   G   T+ R  
Sbjct: 228 LLWAMVYPFDVIKSVMQ--SDKLRTPVYGTNVFQVAKNIYNERGPKAFVKGFGPTMLRSL 285

Query: 175 VWNAGYF 181
             N   F
Sbjct: 286 PVNGATF 292

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 75/184 (40%), Gaps = 24/184 (13%)

Query: 111 SILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTL 170
            I +G + G  +  V  PF++ K+RLQ  SS+    + VV+ ++  EG+   Y G    L
Sbjct: 26  DITAGTTGGIAQVLVGQPFDITKVRLQ-TSSTPTTALRVVQDLVKNEGLRGFYKGTTLPL 84

Query: 171 WRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDL-----------IAGSIGGTIGSLMS 219
              G+  +  FG          EA  +    RN+              G + G   + ++
Sbjct: 85  IGVGLCVSSQFGT--------NEAMKRYFHKRNNFQSTSLRLPEYYACGFVSGCANAFLA 136

Query: 220 TPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGIL 279
           TP + V+  +Q        A +Y  +   I  + KE     L +GF P +LR   G G+ 
Sbjct: 137 TPIEHVRILLQVQTKSRADA-EYQGAMDCIKKLLKEG---KLMRGFTPTILRTSHGFGVY 192

Query: 280 LVVF 283
              +
Sbjct: 193 FTSY 196

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 7/70 (10%)

Query: 195 KSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYK 254
           KS  ++T  D+ AG+ GG    L+  PFD+ K R+Q ++      R        +  + K
Sbjct: 17  KSDIRRTLKDITAGTTGGIAQVLVGQPFDITKVRLQTSSTPTTALR-------VVQDLVK 69

Query: 255 EEGFRALYKG 264
            EG R  YKG
Sbjct: 70  NEGLRGFYKG 79

>Kwal_26.7967
          Length = 297

 Score = 88.2 bits (217), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 71/296 (23%), Positives = 131/296 (44%), Gaps = 21/296 (7%)

Query: 1   MTDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIV 60
           M+  + +   + F AG++AG  E  + YP +  KTR+QL          +  +  I +  
Sbjct: 1   MSQKKQVDPLHSFLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTAS--RNPLTLIYRTA 58

Query: 61  AKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGC 120
             +G   +Y G  + ++    K   +F   D  + I  R+    +L+    I++G  AG 
Sbjct: 59  KVQGLGAVYVGCPAFIVGNTAKAGVRFLGFDAIKNIL-RDPTTGELSGPRGIVAGLGAGL 117

Query: 121 CEAFV-VVPFELVKIRL----QDVSSSY----KGPIDVVRKIIAQEGVLAMYNGLESTLW 171
            E+ V V PFE +K  L    Q  S  Y    +G +     ++  +G   +Y G+     
Sbjct: 118 LESVVAVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSM 177

Query: 172 RHGVWNAGYFGIIFQVRALLPE----AKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKS 227
           R     A   G   +++ ++ +    AK K   +    + G+  G +    + P D VK+
Sbjct: 178 RQAANQAVRLGCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKT 237

Query: 228 RIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
           R+Q+       + KY+ +     T+++EEG +  +KG  P++ RL   GGI+  ++
Sbjct: 238 RMQSL-----DSSKYSSTINCFATVFREEGLKTFWKGATPRLGRLILSGGIVFTIY 288

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 88.2 bits (217), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 78/292 (26%), Positives = 133/292 (45%), Gaps = 19/292 (6%)

Query: 2   TDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQ----VSGGLGPQYKGVVDCIK 57
           TD +   F   F  G V+         P++ VK  +Q Q      G L  +Y G+V+C K
Sbjct: 3   TDKKQSNFAIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECFK 62

Query: 58  QIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKI--YKREFGVEKLTQSLSILSG 115
           +  A EG +  ++G ++ V+   P +A  FA  D+ + +  +K+E G  K         G
Sbjct: 63  RTAADEGVASFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYAKWFAGNLASGG 122

Query: 116 ASAGCCEAFVVVPFELVKIRLQDVSSS--------YKGPIDVVRKIIAQEGVLAMYNGLE 167
            + G    F V   +  + RL   S S        + G +DV +K +A +GV  +Y G  
Sbjct: 123 LAGGLSLLF-VYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFL 181

Query: 168 STLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKS 227
            ++    V+   YFG+   ++ LL     ++    + L+  ++  T  S  S P D V+ 
Sbjct: 182 PSVVGIVVYRGLYFGLYDSLKPLLLTGSLENSFLASFLLGWAV-TTGASTASYPLDTVRR 240

Query: 228 RIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGIL 279
           R+  T   +G A KY+ ++ +   I   EG ++L+KG    +LR   G G++
Sbjct: 241 RMMMT---SGQAVKYDGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGVI 289

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 69/177 (38%), Gaps = 40/177 (22%)

Query: 27  MYPLDVVKTRMQLQ---VSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKR 83
           +Y LD  +TR+         G   Q+ G+VD  K+ +A +G + LY+G    V+     R
Sbjct: 132 VYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFLPSVVGIVVYR 191

Query: 84  ATKFACNDEFQKIYKREFGVEKLTQSL------SILSGASAGCCEAFVVVPFELVKIRLQ 137
              F   D  + +         LT SL      S L G +     +    P + V+ R+ 
Sbjct: 192 GLYFGLYDSLKPLL--------LTGSLENSFLASFLLGWAVTTGASTASYPLDTVRRRMM 243

Query: 138 DVSSS---YKGPIDVVRKIIAQEG--------------------VLAMYNGLESTLW 171
             S     Y G  D  RKI+A EG                    V++MY+ L+  L+
Sbjct: 244 MTSGQAVKYDGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGVISMYDQLQVILF 300

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 89.0 bits (219), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 72/259 (27%), Positives = 119/259 (45%), Gaps = 30/259 (11%)

Query: 48  QYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLT 107
           ++ G ++  ++I   EG + L++GIS  +LM  P     F     ++ +  R   +  L 
Sbjct: 109 KFNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFT---GYEYVRDRS-PLNGLY 164

Query: 108 QSLS-ILSGASAGCCEAFVVVPFELVKIRLQDVSSS---------YKGPIDVVRKIIAQE 157
            +++ ++ GA A    A  V P EL+K +LQ + SS         Y+   + ++  IA  
Sbjct: 165 PTINPLICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMR 224

Query: 158 GVL-AMYNGLESTLWRH----GVWNAGYFGIIFQVRALLPEAKSKSQQT----RNDLIAG 208
           GV   M+ GLE TLWR      ++ A Y     +V  L P    K+        N  + G
Sbjct: 225 GVAQTMFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHFTNSFLGG 284

Query: 209 SIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIY-------KEEGFRAL 261
            I G++ ++ + PFDV K+R Q + V        N  + S  T++       K EG  AL
Sbjct: 285 FISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKTEGIGAL 344

Query: 262 YKGFVPKVLRLGPGGGILL 280
           Y G  P+V ++ P   I++
Sbjct: 345 YTGLAPRVAKIAPSCAIMI 363

 Score = 35.4 bits (80), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 51/233 (21%), Positives = 92/233 (39%), Gaps = 39/233 (16%)

Query: 1   MTDARPLPFFYQ--FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQ 58
           MTD  P     Q    +  V  +   +++ P+DVV+ R+Q         Q + + DC   
Sbjct: 1   MTDRPPATLTIQERMMSATVGSLLTSVILTPMDVVRIRLQ---------QQQMLADCGCA 51

Query: 59  IVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASA 118
            +++   S++ K IS   +                     R   +E+L QS  +++    
Sbjct: 52  DISELDDSKVRKRISEGGV---------------------RRNTLEQLRQS-KVVNRIDT 89

Query: 119 GCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNA 178
                +    F+ +  R Q     + G ++   KI   EGV  ++ G+  TL      N 
Sbjct: 90  VPKIFWESTCFQNLNCRNQK----FNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANV 145

Query: 179 GYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQN 231
            YF     VR   P   +    T N LI G+   T+ +    P +++K+++Q+
Sbjct: 146 VYFTGYEYVRDRSP--LNGLYPTINPLICGAFARTLAATSVAPLELIKTKLQS 196

>Kwal_14.2210
          Length = 315

 Score = 87.4 bits (215), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 73/300 (24%), Positives = 132/300 (44%), Gaps = 24/300 (8%)

Query: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGI 72
           F AG +AG     V+ P + VK  +Q+Q S        G+   +KQ+  +EG   L +G 
Sbjct: 21  FCAGGIAGAVSRTVVSPFERVKILLQVQSS--THAYNHGLFRAVKQVYLEEGVPGLLRGN 78

Query: 73  SSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELV 132
               +   P  A +F   +  +K + ++     +     ++SGA  G C      P +LV
Sbjct: 79  GLNCIRIFPYSAVQFLVYEFCKKQWFQQNPDTVVLNWHRLVSGALCGGCSVLATYPLDLV 138

Query: 133 KIRLQDVSSSYK--------------GPIDVVRKIIAQEG-VLAMYNGLESTLWRHGVWN 177
           + RL   +++                G  +++RK   QEG +  +Y G+  T      + 
Sbjct: 139 RTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIGVVPYV 198

Query: 178 AGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAG 237
           A  F +  Q+R  +P +   +  +   L  G+I G +   ++ PFD+++ R Q   V+A 
Sbjct: 199 ALNFAVYEQLREYIPASFDPASASLYKLSIGAISGGVAQTITYPFDLLRRRFQ---VLAM 255

Query: 238 GARKYNWSWPSI----FTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRTL 293
           G  +  + + S+     TI + EGF+  YKG    + ++ P   +  VV+    D+ + L
Sbjct: 256 GQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKVVPSTAVSWVVYETVRDYMQLL 315

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 85/182 (46%), Gaps = 22/182 (12%)

Query: 10  FYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYK----------GVVDCIKQI 59
           +++  +GA+ G   +L  YPLD+V+TR+ +Q +  L   +K          GV + +++ 
Sbjct: 115 WHRLVSGALCGGCSVLATYPLDLVRTRLSIQ-TANLARLHKAKAASAAKPPGVWELLRKT 173

Query: 60  VAKEGA-SRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILS-GAS 117
             +EG    LY+G+    +   P  A  FA  ++ ++     F  +  + SL  LS GA 
Sbjct: 174 YTQEGGIFGLYRGVWPTSIGVVPYVALNFAVYEQLREYIPASF--DPASASLYKLSIGAI 231

Query: 118 AGCCEAFVVVPFELVKIRLQ-------DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTL 170
           +G     +  PF+L++ R Q       ++   YK   D +  I   EG    Y GL + L
Sbjct: 232 SGGVAQTITYPFDLLRRRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANL 291

Query: 171 WR 172
           ++
Sbjct: 292 FK 293

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/178 (24%), Positives = 76/178 (42%), Gaps = 13/178 (7%)

Query: 110 LSILSGASAGCCEAFVVVPFELVKIRLQDVSSSY---KGPIDVVRKIIAQEGVLAMYNGL 166
           ++  +G  AG     VV PFE VKI LQ  SS++    G    V+++  +EGV  +  G 
Sbjct: 19  IAFCAGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNHGLFRAVKQVYLEEGVPGLLRGN 78

Query: 167 ESTLWRHGVWNAGYFGII-FQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVV 225
                R   ++A  F +  F  +    +         + L++G++ G    L + P D+V
Sbjct: 79  GLNCIRIFPYSAVQFLVYEFCKKQWFQQNPDTVVLNWHRLVSGALCGGCSVLATYPLDLV 138

Query: 226 KSRIQ----NTAVVAGGARKYNWSWPSIF-----TIYKEEGFRALYKGFVPKVLRLGP 274
           ++R+     N A +           P ++     T  +E G   LY+G  P  + + P
Sbjct: 139 RTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSIGVVP 196

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 87.0 bits (214), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 80/294 (27%), Positives = 130/294 (44%), Gaps = 21/294 (7%)

Query: 2   TDAR--PLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQ----VSGGLGPQYKGVVDC 55
           +DA+     F   F  G V+         P++ VK  +Q Q      G L  +Y G+VDC
Sbjct: 3   SDAKQQETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDC 62

Query: 56  IKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKI--YKREFGVEKLTQSLSIL 113
            K+   +EG    ++G ++ V+   P +A  FA  D+ + +  +K+E G  K     ++ 
Sbjct: 63  FKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEEGYGKWFAG-NLA 121

Query: 114 SGASAGCCEAFVVVPFELVKIRL-QDVSSSYKGP-------IDVVRKIIAQEGVLAMYNG 165
           SG +AG      V   +  + RL  D  SS KG         DV +K +  +G+  +Y G
Sbjct: 122 SGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRG 181

Query: 166 LESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVV 225
              ++    V+   YFG+   ++ L+    S         + G +  T  S  S P D V
Sbjct: 182 FMPSVVGIVVYRGLYFGMFDSLKPLVLTG-SLDGSFLASFLLGWVVTTGASTCSYPLDTV 240

Query: 226 KSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGIL 279
           + R+  T   +G A KYN +   +  I   EG  +L+KG    +LR   G G++
Sbjct: 241 RRRMMMT---SGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGVI 291

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 75/192 (39%), Gaps = 40/192 (20%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSG---GLGPQYKGVVDCIKQIVAKEGASRL 68
             A+G  AG   +L +Y LD  +TR+         G   Q+ G+ D  K+ +  +G + L
Sbjct: 119 NLASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGL 178

Query: 69  YKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSL------SILSGASAGCCE 122
           Y+G    V+     R   F   D  + +         LT SL      S L G       
Sbjct: 179 YRGFMPSVVGIVVYRGLYFGMFDSLKPLV--------LTGSLDGSFLASFLLGWVVTTGA 230

Query: 123 AFVVVPFELVKIRLQDVSSS---YKGPIDVVRKIIAQEGV-------------------- 159
           +    P + V+ R+   S     Y G ID ++KI+A EGV                    
Sbjct: 231 STCSYPLDTVRRRMMMTSGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGV 290

Query: 160 LAMYNGLESTLW 171
           ++MY+ L+  L+
Sbjct: 291 ISMYDQLQMILF 302

>Kwal_33.14050
          Length = 314

 Score = 86.7 bits (213), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 76/285 (26%), Positives = 129/285 (45%), Gaps = 22/285 (7%)

Query: 8   PFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQY------KGVVDCIKQIVA 61
           P  +Q AAGA AGI E  +M+P+D +KTRMQ  +S  +G           +V  I +I  
Sbjct: 15  PLTHQLAAGAFAGIMEHSIMFPIDAIKTRMQ-ALSATIGSANAAAKLPSNIVQQIARIST 73

Query: 62  KEGASRLYKGISSPVLMEAPKRATKFACNDEFQK--IYKREFGVEKLTQSLSILSGASAG 119
            EG+  L+KG+ S +L   P  A  FA  +  +   I  ++F   +  ++ +  SG +A 
Sbjct: 74  TEGSMALWKGVQSVILGAGPAHAVYFATYEMCKSYLIDPQDFQTHQPLKTAA--SGIAAT 131

Query: 120 CCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAG 179
                ++ PF+ +K R+Q  + S      V  +I   EG+ A +    +T+  +  + A 
Sbjct: 132 VAADLLMNPFDTIKQRMQLRTFSKDRMWSVASRIYRNEGLAAFFYSYPTTIAMNIPFAAF 191

Query: 180 YFGIIFQVRALLPEAKSKSQQTRNDLI---AGSIGGTIGSLMSTPFDVVKSRIQ---NTA 233
            F I               + T N LI    G I G   + ++TP D +K+ +Q   + +
Sbjct: 192 NFAIYESATKFF-----NPENTYNPLIHCLCGGISGATCAAITTPLDCIKTVLQVRGSES 246

Query: 234 VVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGI 278
           VV    R+ +    +   I K  G+   ++G  P+++   P   I
Sbjct: 247 VVDPLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNMPATAI 291

 Score = 58.9 bits (141), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 87/197 (44%), Gaps = 19/197 (9%)

Query: 106 LTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSSY-------KGPIDVVRKII---A 155
           LT  L+  +GA AG  E  ++ P + +K R+Q +S++        K P ++V++I     
Sbjct: 16  LTHQLA--AGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARIST 73

Query: 156 QEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIG 215
            EG +A++ G++S +   G  +A YF      ++ L + +           A  I  T+ 
Sbjct: 74  TEGSMALWKGVQSVILGAGPAHAVYFATYEMCKSYLIDPQDFQTHQPLKTAASGIAATVA 133

Query: 216 S-LMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGP 274
           + L+  PFD +K R+Q    +   ++   WS  S   IY+ EG  A +  +   +    P
Sbjct: 134 ADLLMNPFDTIKQRMQ----LRTFSKDRMWSVAS--RIYRNEGLAAFFYSYPTTIAMNIP 187

Query: 275 GGGILLVVFTGCMDFFR 291
                  ++     FF 
Sbjct: 188 FAAFNFAIYESATKFFN 204

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 86.3 bits (212), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 74/297 (24%), Positives = 134/297 (45%), Gaps = 18/297 (6%)

Query: 7   LPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGAS 66
           + ++    AG+V+G+   +   P+D VK R QLQ       +YKG+   ++ I+ +EG  
Sbjct: 16  VSWYNSVIAGSVSGVFARMATAPMDTVKIRYQLQPVQE--DKYKGIASTVRTIMKEEGLR 73

Query: 67  RLYKGISSPVLMEAPKRATKFACNDEFQKIYKREF-GVEKLTQSLSILSGASAGCCEAFV 125
            L+KG      M     A +F     F  ++  +F    +  Q+L++  GA AG   + V
Sbjct: 74  ALWKGNIPATAMYVVYGAVQFGSYSWFNNVWSAKFPRFSQQGQTLTV--GALAGMTSSVV 131

Query: 126 VVPFELVKIRLQDVSSSYKGPI-DVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGII 184
             P +L++ RL    +S++  + +  R++   EGV   + G+ + +    +  A  F + 
Sbjct: 132 SYPLDLLRTRLIANRTSHRTSVAEECRQMWLNEGVRGFFTGISTAMTTVTLSTAIMF-LT 190

Query: 185 FQVRALLPEAKSKSQQTRN-DLIAGSIGGTIGSLMSTPFDVVKSRIQ--NTAVVAGGAR- 240
           ++   ++ E   K   +R     +G I G +   M  P D ++ R+Q  N+       + 
Sbjct: 191 YETVNIVCENHEKEFWSRPVSASSGIIAGFVSKTMVFPIDTLRRRMQVMNSKRTVHFTKF 250

Query: 241 -------KYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFF 290
                  +Y  S   I+ I ++EG  ALY+G    + +  P   I L V+   MD F
Sbjct: 251 PAVYHEYRYKSSTAIIYKILRQEGVSALYRGLTMGLCKSVPTTAISLFVYERTMDLF 307

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 85.9 bits (211), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 70/277 (25%), Positives = 121/277 (43%), Gaps = 20/277 (7%)

Query: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQ--YKGVVDCIKQIVAKEGASRLYK 70
           F AG +A    + V  P ++VKTRMQLQ       Q  Y+     +  I   EG   L +
Sbjct: 27  FIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGVIFKNEGVKGLQR 86

Query: 71  GISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSL-----SILSGASAGCCEAFV 125
           G+ S  + +     ++    +  + +  + F  E     L     ++ +GA++G   A V
Sbjct: 87  GLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQNVAVNVTAGATSGIIGAIV 146

Query: 126 VVPFELVKIRLQDVSSS--------YKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWN 177
             P  LVK R+Q  S++        Y    + +  I  +EGVL ++ G+++ + R G  +
Sbjct: 147 GSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRGVDAAILRTGAGS 206

Query: 178 AGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAG 237
           +    I    +  L +     + T   L++ ++ G    ++  P+DVV +R+ N      
Sbjct: 207 SVQLPIYNTTKNFLLQNDIMKEGTALHLLSSTVTGLGVGIVMNPWDVVLTRVYNQK---- 262

Query: 238 GARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGP 274
               Y      +F   K EG  ALYKGF  ++ R+ P
Sbjct: 263 -GNTYKGPIDCMFKTIKIEGIGALYKGFGAQLFRIAP 298

 Score = 80.9 bits (198), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 97/202 (48%), Gaps = 15/202 (7%)

Query: 104 EKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQ---DVSSS----YKGPIDVVRKIIAQ 156
           +K+++  S ++G  A C    V  PFELVK R+Q   ++S++    Y+ P   +  I   
Sbjct: 19  QKVSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGVIFKN 78

Query: 157 EGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALL-----PEAK-SKSQQTRNDLIAGSI 210
           EGV  +  GL S        N    G    +R +L     PE+   K Q    ++ AG+ 
Sbjct: 79  EGVKGLQRGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQNVAVNVTAGAT 138

Query: 211 GGTIGSLMSTPFDVVKSRIQN--TAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPK 268
            G IG+++ +P  +VK+R+Q+   A+  G    Y      + TI+K+EG   L++G    
Sbjct: 139 SGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRGVDAA 198

Query: 269 VLRLGPGGGILLVVFTGCMDFF 290
           +LR G G  + L ++    +F 
Sbjct: 199 ILRTGAGSSVQLPIYNTTKNFL 220

>Scas_718.24
          Length = 337

 Score = 85.9 bits (211), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 78/294 (26%), Positives = 132/294 (44%), Gaps = 20/294 (6%)

Query: 1   MTDARPLP-FFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVS----GGLGPQYKGVVDC 55
           M+  +P   F   F  G V+         P++ VK  +Q Q      G L  +YKG+VDC
Sbjct: 33  MSTEKPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQNEMLKQGTLDTKYKGIVDC 92

Query: 56  IKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKI--YKREFGVEKLTQSLSIL 113
            ++   +EG    ++G ++ V+   P +A  FA  D+ + +  +K+E G  K     ++ 
Sbjct: 93  FRRTAQQEGIISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKEDGYGKWFAG-NLA 151

Query: 114 SGASAGCCEAFVVVPFELVKIRLQDVSSS--------YKGPIDVVRKIIAQEGVLAMYNG 165
           SG +AG      V   +  + RL   S S        + G IDV +K +  +GV  +Y G
Sbjct: 152 SGGAAGGLSLLFVYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRG 211

Query: 166 LESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVV 225
              ++    V+   YFG+   ++ +L     +     + L+ G +  T  S  S P D V
Sbjct: 212 FLPSVVGIIVYRGLYFGLYDSIKPVLLTGSLEGSFLASFLL-GWVVTTGASTCSYPLDTV 270

Query: 226 KSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGIL 279
           + ++  T   +G A KY  ++     I   EG  +L+KG    +LR   G G++
Sbjct: 271 RRKMMMT---SGQAVKYKGAFDCFKKIVAAEGVASLFKGCGANILRGVAGAGVI 321

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 75/192 (39%), Gaps = 40/192 (20%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSG---GLGPQYKGVVDCIKQIVAKEGASRL 68
             A+G  AG   +L +Y LD  +TR+         G   Q+ G++D  K+ +  +G + L
Sbjct: 149 NLASGGAAGGLSLLFVYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGL 208

Query: 69  YKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSL------SILSGASAGCCE 122
           Y+G    V+     R   F   D  + +         LT SL      S L G       
Sbjct: 209 YRGFLPSVVGIIVYRGLYFGLYDSIKPVL--------LTGSLEGSFLASFLLGWVVTTGA 260

Query: 123 AFVVVPFELVKIRLQDVSSS---YKGPIDVVRKIIAQEGV-------------------- 159
           +    P + V+ ++   S     YKG  D  +KI+A EGV                    
Sbjct: 261 STCSYPLDTVRRKMMMTSGQAVKYKGAFDCFKKIVAAEGVASLFKGCGANILRGVAGAGV 320

Query: 160 LAMYNGLESTLW 171
           ++MY+ L+  L+
Sbjct: 321 ISMYDQLQMILF 332

>Scas_667.4
          Length = 308

 Score = 85.5 bits (210), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 78/287 (27%), Positives = 130/287 (45%), Gaps = 23/287 (8%)

Query: 9   FFYQFAAGAVAGISEILVMYPLDVVKTRMQLQ----VSGGLGPQYKGVVDCIKQIVAKEG 64
           F   F  G V+         P++ VK  +Q Q      G L  +YKG+++C ++    EG
Sbjct: 13  FAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDSKYKGIIECFQRTAKTEG 72

Query: 65  ASRLYKGISSPVLMEAPKRATKFACNDEFQKI--YKREFGVEKLTQSLSILSGASAGCCE 122
               ++G ++ V+   P +A  FA  D+ + +  +K+E G  K     ++ SG +AG   
Sbjct: 73  IIAFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKEEGYGKWFAG-NLASGGAAGGLS 131

Query: 123 AFVVVPFELVKIRL-QDVSSS-------YKGPIDVVRKIIAQEGVLAMYNGLESTLWRHG 174
              V   +  + RL  D  SS       YKG IDV ++ +A +G+  +Y G   ++    
Sbjct: 132 LLFVYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAGLYRGFLPSVVGII 191

Query: 175 VWNAGYFGIIFQVRALLPEAKSKSQQTR--NDLIAGSIGGTIGSLMSTPFDVVKSRIQNT 232
           V+   YFG+     +L P   + S +       + G I  T  S  S P D V+ R+  T
Sbjct: 192 VYRGLYFGL---YDSLKPAVLTGSLEGSFLASFLLGWIVTTGASTASYPLDTVRRRMMMT 248

Query: 233 AVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGIL 279
              +G A KY+ ++     +   EG  +L+KG    +LR   G G++
Sbjct: 249 ---SGQAVKYDGAFDCFRKVVAAEGVSSLFKGCGANILRGVAGAGVI 292

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 75/192 (39%), Gaps = 40/192 (20%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSG---GLGPQYKGVVDCIKQIVAKEGASRL 68
             A+G  AG   +L +Y LD  +TR+         G   QYKG++D  KQ +A +G + L
Sbjct: 120 NLASGGAAGGLSLLFVYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAGL 179

Query: 69  YKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSL------SILSGASAGCCE 122
           Y+G    V+     R   F   D  +           LT SL      S L G       
Sbjct: 180 YRGFLPSVVGIIVYRGLYFGLYDSLKPAV--------LTGSLEGSFLASFLLGWIVTTGA 231

Query: 123 AFVVVPFELVKIRLQDVSSS---YKGPIDVVRKIIAQEGV-------------------- 159
           +    P + V+ R+   S     Y G  D  RK++A EGV                    
Sbjct: 232 STASYPLDTVRRRMMMTSGQAVKYDGAFDCFRKVVAAEGVSSLFKGCGANILRGVAGAGV 291

Query: 160 LAMYNGLESTLW 171
           ++MY+ L+  ++
Sbjct: 292 ISMYDQLQMIMF 303

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 85.9 bits (211), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 76/303 (25%), Positives = 132/303 (43%), Gaps = 58/303 (19%)

Query: 25  LVMYPLDVVKTRMQLQV--------SGGLGP-----------QYKGVVDCIKQIVAKEGA 65
           +V  P DVVKTR+Q  V        +  +GP            +K     I  +   EG 
Sbjct: 68  VVTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGF 127

Query: 66  SRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFV 125
             L+KG+   ++   P R+  F      ++IY +     +    + +++ A+AG   +  
Sbjct: 128 RSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKTLNNGQEAVWIHLMAAATAGWATSTA 187

Query: 126 VVPFELVKIRLQ----DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYF 181
             P  LVK RLQ      +  YK   D ++ ++ +EG+L +Y GL          +A Y 
Sbjct: 188 TNPIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQKEGILGLYKGL----------SASYL 237

Query: 182 G---------IIFQVRALLPEAK-------SKSQQTRNDLI------AGSIGGT--IGSL 217
           G         +  Q++ ++ +         S+ +++ +D I      +GS G    + S+
Sbjct: 238 GSVEGILQWVLYEQMKHIIKQRSMEKFGNISEVEKSTSDKIKEWCQRSGSAGLAKFVASI 297

Query: 218 MSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGG 277
           ++ P +VV++R++  A +  G  KY     SI  I KEEG  ++Y G  P +LR  P   
Sbjct: 298 ITYPHEVVRTRLRQ-APLENGKLKYTGLVQSIRVIIKEEGLASMYGGLTPHLLRTVPNSI 356

Query: 278 ILL 280
           I+ 
Sbjct: 357 IMF 359

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 44/92 (47%), Gaps = 18/92 (19%)

Query: 217 LMSTPFDVVKSRIQNTA------------------VVAGGARKYNWSWPSIFTIYKEEGF 258
           +++ PFDVVK+R+Q+                    V+A G R +  ++  I  +Y+ EGF
Sbjct: 68  VVTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGF 127

Query: 259 RALYKGFVPKVLRLGPGGGILLVVFTGCMDFF 290
           R+L+KG  P ++ + P   I    +    + +
Sbjct: 128 RSLFKGLGPNLVGVIPARSINFFTYGTTKEIY 159

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 83/189 (43%), Gaps = 31/189 (16%)

Query: 125 VVVPFELVKIRLQ-DV-SSSYKGPIDVV----RKIIAQEGVLAMYN--GLESTLWRHGVW 176
           V  PF++VK RLQ DV  ++YK     +      +IAQ GV       G+ S ++R+  +
Sbjct: 69  VTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQ-GVRHFKETFGIISNVYRNEGF 127

Query: 177 NAGYFGIIFQVRALLP----------EAKSKSQQTRND--------LIAGSIGGTIGSLM 218
            + + G+   +  ++P            K    +T N+        L+A +  G   S  
Sbjct: 128 RSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKTLNNGQEAVWIHLMAAATAGWATSTA 187

Query: 219 STPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGI 278
           + P  +VK+R+Q     AG  +KY  SW  +  + ++EG   LYKG       LG   GI
Sbjct: 188 TNPIWLVKTRLQLDK--AGTTKKYKNSWDCLKNVVQKEGILGLYKGLSASY--LGSVEGI 243

Query: 279 LLVVFTGCM 287
           L  V    M
Sbjct: 244 LQWVLYEQM 252

>Scas_645.9
          Length = 391

 Score = 85.9 bits (211), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 71/257 (27%), Positives = 120/257 (46%), Gaps = 29/257 (11%)

Query: 48  QYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLT 107
           ++ G ++   +I   EG + L++GIS  +LM  P     F   +     Y R+      +
Sbjct: 128 RFNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYE-----YLRDNSPLATS 182

Query: 108 QSL--SILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPID--VVRKIIAQE------ 157
                 ++ GA A    A  V P EL+K +LQ +    K      +V++++ +       
Sbjct: 183 SPTFNPLMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETRQEMRI 242

Query: 158 --GVLAMYNGLESTLWRHGVWNAGYFGI--IFQVRALLPEAKSKSQQTR--NDLIAGSIG 211
                A++ GLE TLWR   ++A Y+G     +    +  +KS S  T   N  I GSI 
Sbjct: 243 SGASNALFKGLEITLWRDVPFSAIYWGSYEFCKTHLWMDTSKSHSNLTFFINSFIGGSIS 302

Query: 212 GTIGSLMSTPFDVVKSRIQ--------NTAVVAGGARKYNWSWPSIFTIYKEEGFRALYK 263
           GTI +L++ PFDV K+R Q         + V +    +    +  +  I+K EG+ ALY 
Sbjct: 303 GTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWKLEGWGALYT 362

Query: 264 GFVPKVLRLGPGGGILL 280
           G VP+++++ P   I++
Sbjct: 363 GLVPRMVKIAPSCAIMI 379

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 90/207 (43%), Gaps = 21/207 (10%)

Query: 1   MTDARPL----PFFYQFAAGAVAGISEILVMYPLDVVKTRMQ----LQVSGGLGPQYKGV 52
           + D  PL    P F     GA+A I     + PL+++KT++Q    +  S       K +
Sbjct: 173 LRDNSPLATSSPTFNPLMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKEL 232

Query: 53  VDCIKQIVAKEGASR-LYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSL- 110
           +   +Q +   GAS  L+KG+   +  + P  A  +  + EF K +       K   +L 
Sbjct: 233 LKETRQEMRISGASNALFKGLEITLWRDVPFSAIYWG-SYEFCKTH-LWMDTSKSHSNLT 290

Query: 111 ----SILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPID-VVRKIIAQEGVLAMYNG 165
               S + G+ +G   A V  PF++ K R Q    S+ G  D  V K    E    M+  
Sbjct: 291 FFINSFIGGSISGTIAALVTHPFDVGKTRWQ---ISFMGNNDKSVVKSPDIEQTKNMFKF 347

Query: 166 LESTLWRHGVWNAGYFGIIFQVRALLP 192
           L + +W+   W A Y G++ ++  + P
Sbjct: 348 LRN-IWKLEGWGALYTGLVPRMVKIAP 373

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 70/168 (41%), Gaps = 18/168 (10%)

Query: 133 KIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLP 192
           ++  ++ S  + G ++   KI   EG+  ++ G+   L      N  YF     +R   P
Sbjct: 119 ELNCKNSSVRFNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYEYLRDNSP 178

Query: 193 EAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTI 252
            A   S  T N L+ G+I   + +    P +++K+++Q+   V+    K   SW  +  +
Sbjct: 179 LA--TSSPTFNPLMCGAIARILAASTVAPLELLKTKLQSIPRVS----KSTTSWMMVKEL 232

Query: 253 YKEE--------GFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRT 292
            KE            AL+KG    + R  P   I    + G  +F +T
Sbjct: 233 LKETRQEMRISGASNALFKGLEITLWRDVPFSAI----YWGSYEFCKT 276

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 36/85 (42%), Gaps = 9/85 (10%)

Query: 9   FFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLG---------PQYKGVVDCIKQI 59
           F   F  G+++G    LV +P DV KTR Q+   G             Q K +   ++ I
Sbjct: 292 FINSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNI 351

Query: 60  VAKEGASRLYKGISSPVLMEAPKRA 84
              EG   LY G+   ++  AP  A
Sbjct: 352 WKLEGWGALYTGLVPRMVKIAPSCA 376

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 84.7 bits (208), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 74/270 (27%), Positives = 129/270 (47%), Gaps = 22/270 (8%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74
           AGA+   S    M P+DVVKTR+QL+ +       KG+V   ++I+A+EGA  L  G   
Sbjct: 19  AGAIGCGSTHSSMVPIDVVKTRIQLEPT----VYNKGMVGSFRKIIAEEGAGALLTGFGP 74

Query: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVE---KLTQSLSILSGASAGCCEAFVVVPFEL 131
            +L  + + A KF   + F+K +    G +   +   S+ I S A+A       + P E 
Sbjct: 75  TLLGYSIQGAFKFGGYEVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEA 134

Query: 132 VKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRA-- 189
            +IRL    +   G +    +I+ +EGV + Y+G    L++   +N   F ++F+ RA  
Sbjct: 135 TRIRLVSQPTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKF-LVFE-RASE 192

Query: 190 ----LLPEAKSKSQQ--TRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYN 243
               L P   + SQ   T  +L++G   G   +++S P D + S++  T+   G      
Sbjct: 193 LYFSLAPPKDTLSQTSLTAINLLSGLTAGLAAAIVSQPADTLLSKVNKTSKAPG-----Q 247

Query: 244 WSWPSIFTIYKEEGFRALYKGFVPKVLRLG 273
            +   +F + K+ GF   + G   +++ +G
Sbjct: 248 STVGLLFQLAKQLGFVGSFAGLPTRLVMVG 277

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 74/173 (42%), Gaps = 11/173 (6%)

Query: 126 VVPFELVKIRLQDVSSSY-KGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFG-- 182
           +VP ++VK R+Q   + Y KG +   RKIIA+EG  A+  G   TL  + +  A  FG  
Sbjct: 31  MVPIDVVKTRIQLEPTVYNKGMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQGAFKFGGY 90

Query: 183 IIFQVRALLPEAKSKSQQTRNDLIAGSIGGT--IGSLMSTPFDVVKSRIQNTAVVAGGAR 240
            +F+   +       + + +N +  GS      +  +   P +  + R+ +    A    
Sbjct: 91  EVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEATRIRLVSQPTFA---- 146

Query: 241 KYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRTL 293
             N        I KEEG  + Y GF P + +  P      +VF    + + +L
Sbjct: 147 --NGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFERASELYFSL 197

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 34/67 (50%), Gaps = 9/67 (13%)

Query: 206 IAGSIG-GTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIF-TIYKEEGFRALYK 263
           +AG+IG G+  S M  P DVVK+RIQ    V      YN      F  I  EEG  AL  
Sbjct: 18  LAGAIGCGSTHSSM-VPIDVVKTRIQLEPTV------YNKGMVGSFRKIIAEEGAGALLT 70

Query: 264 GFVPKVL 270
           GF P +L
Sbjct: 71  GFGPTLL 77

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 85.5 bits (210), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 81/302 (26%), Positives = 129/302 (42%), Gaps = 58/302 (19%)

Query: 26  VMYPLDVVKTRMQLQV-----------SGGLGP---------QYKGVVDCIKQIVAKEGA 65
           V  P DVVKTR+Q  V           + G             +K     I  +  +EG 
Sbjct: 67  VTCPFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGF 126

Query: 66  SRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFV 125
             L+KG+   ++   P R+  F      + IY R     +    + +L+ A+AG   + V
Sbjct: 127 RSLFKGLGPNLVGVIPARSINFLTYGTTKDIYSRTLNNGQEAPWIHLLAAATAGWATSTV 186

Query: 126 VVPFELVKIRLQ---DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFG 182
             P  LVK RLQ     + +YK  +D ++ ++  EGVL +Y GL          +A Y G
Sbjct: 187 TNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYKGL----------SASYLG 236

Query: 183 --------IIF-QVRALLPE------------AKSKSQQTRNDLI-AGSIGGT--IGSLM 218
                   I++ Q++ ++ E            AKS S + +     +GS G    + S++
Sbjct: 237 SVEGILQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGLAKFVASIV 296

Query: 219 STPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGI 278
           + P +VV++R++  A    G  KY     S   I KEEG  ++Y G  P +LR  P   I
Sbjct: 297 TYPHEVVRTRLRQ-APTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPHLLRTVPNSII 355

Query: 279 LL 280
           + 
Sbjct: 356 MF 357

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 47/96 (48%), Gaps = 20/96 (20%)

Query: 218 MSTPFDVVKSRIQN---------TAVVAGGARKYNWSWPSIF----------TIYKEEGF 258
           ++ PFDVVK+R+Q+          A+   G+   ++   S+            +Y++EGF
Sbjct: 67  VTCPFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGF 126

Query: 259 RALYKGFVPKVLRLGPGGGILLVVFTGCMDFF-RTL 293
           R+L+KG  P ++ + P   I  + +    D + RTL
Sbjct: 127 RSLFKGLGPNLVGVIPARSINFLTYGTTKDIYSRTL 162

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 33/63 (52%)

Query: 25  LVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRA 84
           +V YP +VV+TR++   +     +Y G+V   + I+ +EG   +Y G++  +L   P   
Sbjct: 295 IVTYPHEVVRTRLRQAPTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPHLLRTVPNSI 354

Query: 85  TKF 87
             F
Sbjct: 355 IMF 357

>Scas_669.6
          Length = 373

 Score = 85.5 bits (210), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 80/292 (27%), Positives = 131/292 (44%), Gaps = 40/292 (13%)

Query: 27  MYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASR-LYKGISSPVLMEAPKRAT 85
           M+ LD VKTR Q      + P+YK +    + I  +EG +R LY G  + +L   P  A 
Sbjct: 69  MHSLDTVKTRQQ---GAPMTPKYKNMTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAI 125

Query: 86  KFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQ-------- 137
            F   +  ++    + G       LS  +G       +FV VP E++K RLQ        
Sbjct: 126 FFGTYEWCKRKMIGDLGFNDTVSHLS--AGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNP 183

Query: 138 --DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGII--FQVRALLPE 193
                 +Y+     +R I+  EGV A++ G ++TL R   ++A  FG    F+  A   E
Sbjct: 184 FFQSGYNYRSLRTAIRIIVNTEGVKALFFGYKATLARDLPFSALQFGFYEKFRQTAFKLE 243

Query: 194 AKSKSQQTR---NDLIAGSIGGTIGSLMSTPFDVVKSRIQ--------NTAVVAGG--AR 240
            K  ++      N++  G+I G +  +++TP DV+K+R+Q        N+A   G   A+
Sbjct: 244 KKDITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIKTRLQTQQADINPNSATTVGAISAK 303

Query: 241 KYNWSWP-----SIFT----IYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
               S P     SIF     +Y+ EG    + G  P+ +       I+L+++
Sbjct: 304 TNKKSRPIVLSNSIFRSLKLVYQSEGVIGFFSGVGPRFVWTSVQSSIMLLLY 355

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 64/135 (47%), Gaps = 9/135 (6%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQ--VSGGL---GPQYKGVVDCIKQIVAKEGAS 66
             +AG +       V  P +V+KTR+QLQ  V+      G  Y+ +   I+ IV  EG  
Sbjct: 149 HLSAGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFFQSGYNYRSLRTAIRIIVNTEGVK 208

Query: 67  RLYKGISSPVLMEAPKRATKFACNDEFQ----KIYKREFGVEKLTQSLSILSGASAGCCE 122
            L+ G  + +  + P  A +F   ++F+    K+ K++     L+    I +GA AG   
Sbjct: 209 ALFFGYKATLARDLPFSALQFGFYEKFRQTAFKLEKKDITKHNLSIPNEIFTGAIAGGLA 268

Query: 123 AFVVVPFELVKIRLQ 137
             +  P +++K RLQ
Sbjct: 269 GIITTPMDVIKTRLQ 283

>Scas_379.2
          Length = 301

 Score = 83.6 bits (205), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 73/292 (25%), Positives = 128/292 (43%), Gaps = 23/292 (7%)

Query: 8   PFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASR 67
           P  +Q  AGA AGI E  VM+P+D +KTR+Q   +         ++  + +I   EG+  
Sbjct: 22  PLSHQLLAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTS----NMLSQMAKISTAEGSLA 77

Query: 68  LYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVV 127
           L+KG+ S +L   P  A  FA  +  +K    E  ++      + LSG  A      ++ 
Sbjct: 78  LWKGVQSVILGAGPAHAVYFATYEYTKKYLIDEKDMQTHQPLKTALSGTVATIAADALMN 137

Query: 128 PFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQV 187
           PF+ +K R+Q  +++     +V ++I   EG  A Y    +TL  +  + A  F I    
Sbjct: 138 PFDTLKQRMQLNTNT--TVWNVTKQIYKNEGFSAFYYSYPTTLAMNIPFAAFNFMIY--- 192

Query: 188 RALLPEAKSKSQQTRND------LIAGSIGGTIGSLMSTPFDVVKSRIQ---NTAVVAGG 238
                E+ +K     ND       ++G + G   + ++TP D +K+ +Q   + +V    
Sbjct: 193 -----ESATKFFNPTNDYNPLVHCLSGGLSGATCAAITTPLDCIKTVLQVRGSESVSLQV 247

Query: 239 ARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFF 290
            ++ N    +   IY+  G +  ++G  P+V    P   I    +     F 
Sbjct: 248 MKEANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAIAWTAYECAKHFL 299

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 43/93 (46%), Gaps = 9/93 (9%)

Query: 191 LPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIF 250
           LP++   S Q    L+AG+  G +   +  P D +K+RIQ+T+     A+  +     + 
Sbjct: 17  LPDSAPLSHQ----LLAGAFAGIMEHSVMFPIDALKTRIQSTS-----AKSTSNMLSQMA 67

Query: 251 TIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
            I   EG  AL+KG    +L  GP   +    +
Sbjct: 68  KISTAEGSLALWKGVQSVILGAGPAHAVYFATY 100

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 83.6 bits (205), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 71/288 (24%), Positives = 125/288 (43%), Gaps = 20/288 (6%)

Query: 2   TDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQ--VSGGLGPQYKGVVDCIKQI 59
           T A+ +  F  F AG +A    + V  P++++K RMQLQ  +S      YK  +  +  I
Sbjct: 15  TAAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVI 74

Query: 60  VAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQS-----LSILS 114
              EG   L KG+++  + +     ++    +  +    + F  ++         +++ S
Sbjct: 75  FKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFS 134

Query: 115 GASAGCCEAFVVVPFELVKIRLQDVS--------SSYKGPIDVVRKIIAQEGVLAMYNGL 166
           GA++G   A +  P  LVK RLQ  S        + Y G  + +  I   EGV  ++ G+
Sbjct: 135 GAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGI 194

Query: 167 ESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVK 226
           ++ + R G  ++    I    + +L +           L A +I G   +++  P+DV+ 
Sbjct: 195 DAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVIL 254

Query: 227 SRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGP 274
           +RI N          Y      +    + EG  ALYKGF  +V R+ P
Sbjct: 255 TRIYNQK-----GDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAP 297

 Score = 80.1 bits (196), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 98/202 (48%), Gaps = 15/202 (7%)

Query: 104 EKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQ---DVSSS----YKGPIDVVRKIIAQ 156
           +K+++  S ++G  A C    V  P EL+KIR+Q   ++S+S    YK PI  +  I   
Sbjct: 18  QKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKN 77

Query: 157 EGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALL-----PEAK-SKSQQTRNDLIAGSI 210
           EG+  +  GL +        N    G    +R+ L     P+ +  K Q    ++ +G+ 
Sbjct: 78  EGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAA 137

Query: 211 GGTIGSLMSTPFDVVKSRIQNTA--VVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPK 268
            G IG+++ +P  +VK+R+Q+ +  +  G    Y   W  + TI+K EG + L++G    
Sbjct: 138 SGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAA 197

Query: 269 VLRLGPGGGILLVVFTGCMDFF 290
           +LR G G  + L ++    +  
Sbjct: 198 ILRTGAGSSVQLPIYNTAKNIL 219

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 83.2 bits (204), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 77/280 (27%), Positives = 130/280 (46%), Gaps = 15/280 (5%)

Query: 8   PFFYQFAAGAVAGISEILVMYPLDVVKTRMQ----LQVSGGLGPQYKGVVDCIKQIVAKE 63
           P  +Q  AGA AGI+E  V++PLD +KTR+Q    +  +GG  P    ++  +  I A+E
Sbjct: 17  PLAHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGG-QPIPSTMLRQLSSISAQE 75

Query: 64  GASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKRE-FGVEKLTQSLSILSGASAGCCE 122
           G+  L+KG+ S +L   P  A  FA  +  +     E     K     +  SGA+A    
Sbjct: 76  GSMVLWKGVQSVLLGAGPAHAVYFATYEMVKSFLIDEATSTSKYHFFKTAFSGATATIAA 135

Query: 123 AFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFG 182
             ++ PF+++K R+Q   ++     D  ++I ++EG  A Y+   +TL  +  + A  FG
Sbjct: 136 DALMNPFDVIKQRIQ--LNTNISVWDTAKRIYSKEGFQAFYSSYPTTLAINIPFAAFNFG 193

Query: 183 II-FQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQ---NTAVVAGG 238
           I     R   P   S         + G I G   + ++TP D +K+ +Q   +  V    
Sbjct: 194 IYDTATRYFNP---SGVYNPFIHCLCGGISGAACAGLTTPLDCIKTALQVRGSEKVSMEV 250

Query: 239 ARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGI 278
            ++ +    +   IY+  G+R  + G  P++L   P   I
Sbjct: 251 FKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPATAI 290

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 39/93 (41%), Gaps = 2/93 (2%)

Query: 193 EAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVA--GGARKYNWSWPSIF 250
           EA        + L+AG+  G     +  P D +K+R+Q    ++  GG    +     + 
Sbjct: 10  EALPDHAPLAHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQLS 69

Query: 251 TIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
           +I  +EG   L+KG    +L  GP   +    +
Sbjct: 70  SISAQEGSMVLWKGVQSVLLGAGPAHAVYFATY 102

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 83.6 bits (205), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 80/305 (26%), Positives = 127/305 (41%), Gaps = 30/305 (9%)

Query: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGI 72
           F AG VAG     V+ P + VK  +Q+Q S       +G+   I+Q+  +EG   L++G 
Sbjct: 26  FLAGGVAGAVSRTVVSPFERVKILLQVQSS--TTSYNRGIFSSIRQVYHEEGTKGLFRGN 83

Query: 73  SSPVLMEAPKRATKF----ACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVP 128
               +   P  A +F    AC  +   +     G E+LT +  + SGA  G C      P
Sbjct: 84  GLNCIRIFPYSAVQFVVYEACKKKLFHVNGNN-GQEQLTNTQRLFSGALCGGCSVVATYP 142

Query: 129 FELVKIRLQ----DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTL--WRHGVWNAG--- 179
            +L+K RL     ++SS  +     + K      +L+    LE  L     GVW      
Sbjct: 143 LDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPTSLGV 202

Query: 180 --YFGIIFQVRALLPE-------AKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQ 230
             Y  + F V   L E       A+   +     L  G+I G +   ++ PFD+++ R Q
Sbjct: 203 VPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQ 262

Query: 231 NTAVVAGGAR---KYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCM 287
             A+  GG     +Y   W ++ TI + EG    YKG    + ++ P   +  +V+    
Sbjct: 263 VLAM--GGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYEVVC 320

Query: 288 DFFRT 292
           D  R 
Sbjct: 321 DSVRN 325

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 88/201 (43%), Gaps = 16/201 (7%)

Query: 105 KLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSS--SY-KGPIDVVRKIIAQEGVLA 161
           K   +++ L+G  AG     VV PFE VKI LQ  SS  SY +G    +R++  +EG   
Sbjct: 19  KQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKG 78

Query: 162 MYNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTR----NDLIAGSIGGTIGSL 217
           ++ G      R   ++A  F +    +  L      + Q +      L +G++ G    +
Sbjct: 79  LFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVV 138

Query: 218 MSTPFDVVKSRIQ-NTAVVAGGARKYNWS-------WPSIFTIYK-EEGFRALYKGFVPK 268
            + P D++K+R+   TA ++   R    S       W  +   Y+ E G R LY+G  P 
Sbjct: 139 ATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPT 198

Query: 269 VLRLGPGGGILLVVFTGCMDF 289
            L + P   +   V+    +F
Sbjct: 199 SLGVVPYVALNFAVYEQLREF 219

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 4/90 (4%)

Query: 2   TDARPL--PFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGG--LGPQYKGVVDCIK 57
           +DA+P      Y+   GA++G     + YP D+++ R Q+   GG  LG +Y  V D + 
Sbjct: 224 SDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALV 283

Query: 58  QIVAKEGASRLYKGISSPVLMEAPKRATKF 87
            I   EG S  YKG+++ +    P  A  +
Sbjct: 284 TIGRAEGVSGYYKGLAANLFKVVPSTAVSW 313

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 84.0 bits (206), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 116/254 (45%), Gaps = 25/254 (9%)

Query: 48  QYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLT 107
           ++ G ++   +I + EG + L++GIS  +LM  P     F+  +  + +         L 
Sbjct: 101 KFNGTLEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGYEYIRDVSPIASTYPTLN 160

Query: 108 QSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGP---------IDVVRKIIAQEG 158
               +  GA A    A  + P ELVK +LQ +  S K           ++  R+ +   G
Sbjct: 161 P---LFCGAIARVFAATSIAPLELVKTKLQSIPRSSKSTKTWMMVKDLLNETRQEMKMVG 217

Query: 159 -VLAMYNGLESTLWRHGVWNAGYFGI--IFQVRALLPEAKSKSQQTR-----NDLIAGSI 210
              A++ GLE TLWR   ++A Y+    + + R  L   +  S+        N   +G I
Sbjct: 218 PSRALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTRFASKDANWVHFINSFASGCI 277

Query: 211 GGTIGSLMSTPFDVVKSRIQ----NTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFV 266
            G I ++ + PFDV K+R Q    N +   GG R  N  +  + TI++ EG  ALY G  
Sbjct: 278 SGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRN-MFKFLETIWRTEGLAALYTGLA 336

Query: 267 PKVLRLGPGGGILL 280
            +V+++ P   I++
Sbjct: 337 ARVIKIRPSCAIMI 350

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 53/110 (48%), Gaps = 9/110 (8%)

Query: 3   DARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQ----YKGVVDCIKQ 58
           DA  + F   FA+G ++G+   +  +P DV KTR Q+ +     P+     + +   ++ 
Sbjct: 262 DANWVHFINSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLET 321

Query: 59  IVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQ 108
           I   EG + LY G+++ V+   P  A   +  +    I K+ FG  KL Q
Sbjct: 322 IWRTEGLAALYTGLAARVIKIRPSCAIMISSYE----ISKKVFG-NKLHQ 366

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 56/284 (19%), Positives = 111/284 (39%), Gaps = 59/284 (20%)

Query: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGI 72
            +AGA + ++  L++ P+DVV+ R+Q         Q + + DC     + +GA+ +   +
Sbjct: 17  LSAGAGSVLTS-LILTPMDVVRIRLQ---------QQQMIPDC-----SCDGAAEVPNAV 61

Query: 73  SSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELV 132
           SS   M+             F  +  +     K+           + C +          
Sbjct: 62  SSGSKMKT------------FTNVGGQNLNNAKIFWE--------SACFQ---------- 91

Query: 133 KIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLP 192
           ++  ++ S  + G ++   KI + EG+ +++ G+  TL      N  YF     +R + P
Sbjct: 92  ELHCKNSSLKFNGTLEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGYEYIRDVSP 151

Query: 193 EAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTI 252
            A   +  T N L  G+I     +    P ++VK+++Q+    +   +    +W  +  +
Sbjct: 152 IA--STYPTLNPLFCGAIARVFAATSIAPLELVKTKLQSIPRSSKSTK----TWMMVKDL 205

Query: 253 YKEEG--------FRALYKGFVPKVLRLGPGGGILLVVFTGCMD 288
             E           RAL+KG    + R  P   I    +  C +
Sbjct: 206 LNETRQEMKMVGPSRALFKGLEITLWRDVPFSAIYWSSYELCKE 249

 Score = 31.6 bits (70), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 69/194 (35%), Gaps = 42/194 (21%)

Query: 4   ARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQ----LQVSGGLGPQYKGVVDCIKQI 59
           A   P       GA+A +     + PL++VKT++Q       S       K +++  +Q 
Sbjct: 153 ASTYPTLNPLFCGAIARVFAATSIAPLELVKTKLQSIPRSSKSTKTWMMVKDLLNETRQE 212

Query: 60  VAKEGASR-LYKGISSPVLMEAPKRA-----------------TKFACNDEFQKIYKREF 101
           +   G SR L+KG+   +  + P  A                 T+FA  D     +   F
Sbjct: 213 MKMVGPSRALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTRFASKDANWVHFINSF 272

Query: 102 GVEKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGP---------IDVVRK 152
                       SG  +G   A    PF++ K R Q    +   P            +  
Sbjct: 273 A-----------SGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLET 321

Query: 153 IIAQEGVLAMYNGL 166
           I   EG+ A+Y GL
Sbjct: 322 IWRTEGLAALYTGL 335

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 82.8 bits (203), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 71/286 (24%), Positives = 123/286 (43%), Gaps = 20/286 (6%)

Query: 4   ARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQ--YKGVVDCIKQIVA 61
           A+ +  F  F AG +A    + V  P++VVK RMQLQ       Q  Y      +  +  
Sbjct: 13  AQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFR 72

Query: 62  KEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQS-----LSILSGA 116
            EG   L KG+ +  + +     ++    +  + +  + F  ++ +       +++ +GA
Sbjct: 73  NEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGA 132

Query: 117 SAGCCEAFVVVPFELVKIRLQDVSSS--------YKGPIDVVRKIIAQEGVLAMYNGLES 168
           ++G   A +  P  LVK RLQ  S++        Y G  + ++ I   EGV  ++ G+++
Sbjct: 133 ASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDA 192

Query: 169 TLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSR 228
            + R G  ++    I    +  L             L A +I G   +++  P+DV+ +R
Sbjct: 193 AILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTR 252

Query: 229 IQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGP 274
           I N          Y      +    K EG  ALYKGF  +V R+GP
Sbjct: 253 IYNQK-----GDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGP 293

 Score = 80.1 bits (196), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 96/202 (47%), Gaps = 15/202 (7%)

Query: 104 EKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQ---DVSSS----YKGPIDVVRKIIAQ 156
           +K+++  S  +G  A C    V  P E+VKIR+Q   ++ ++    Y  P   +  +   
Sbjct: 14  QKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRN 73

Query: 157 EGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALL-----PEAKS-KSQQTRNDLIAGSI 210
           EG+  +  GL +        N    G    +RA++     P+ +S K Q    ++ AG+ 
Sbjct: 74  EGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAA 133

Query: 211 GGTIGSLMSTPFDVVKSRIQN--TAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPK 268
            G IG++M +P  +VK+R+Q+   A+  G    Y   W  + TIY  EG + L++G    
Sbjct: 134 SGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAA 193

Query: 269 VLRLGPGGGILLVVFTGCMDFF 290
           +LR G G  + L ++    +F 
Sbjct: 194 ILRTGAGSSVQLPIYNTAKNFL 215

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 83.6 bits (205), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 91/323 (28%), Positives = 144/323 (44%), Gaps = 62/323 (19%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQ---LQVSGGL------------GPQYKGVVDCIKQI 59
           +GA+AG    +++ PLDV KTR+Q   LQ++G +            G  Y G+   +  I
Sbjct: 109 SGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTLTTI 168

Query: 60  VAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFG-VEKLTQSLSILSGASA 118
           V  E    LYKGI   VL   P     F+  +  +  Y R F   E L+ S+S L+   A
Sbjct: 169 VRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRYFNNSEFLSHSMSALT---A 225

Query: 119 GCCEAFVVVPFELVKIRLQDVS-------SSYKGPIDVVRKIIAQEGVLAMYNGLESTLW 171
           G     +  P  +VK RL   S       + YK  +D   KI   EG+ + Y+GL  +L+
Sbjct: 226 GAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYSGLIPSLF 285

Query: 172 RHGVWN-AGYFGIIFQVRALL---PEAKSKSQQTRN------------------DLIAGS 209
             G+ + A +F +  +++ +L   P  +  +Q+T N                   LI  S
Sbjct: 286 --GLLHVAIHFPVYEKLKKVLHCYPSGR-PNQETMNVNGNSNPQTTGSTNFQLGRLIVAS 342

Query: 210 IGGT-IGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPK 268
            G   I S ++ P +++++R+Q  + +    +        I T Y +EG R  Y GF+  
Sbjct: 343 CGSKMIASTLTYPHEILRTRLQLKSDMKPSIKSI------IRTTYAKEGIRGFYSGFLTN 396

Query: 269 VLRLGPGGGILLVVFTGCMDFFR 291
           + R  P   I LV F    ++FR
Sbjct: 397 MFRTVPASAITLVSF----EYFR 415

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 79/195 (40%), Gaps = 23/195 (11%)

Query: 99  REFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPID---------- 148
           RE G    T+ ++ LSGA AG     +V P ++ K RLQ       GP+           
Sbjct: 95  REEGHFNDTE-ITALSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTF 153

Query: 149 ----------VVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSKS 198
                      +  I+  E +  +Y G+   +  +      YF +  + +   P   + S
Sbjct: 154 GGKYYSGIWGTLTTIVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRYFNNS 213

Query: 199 QQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQ-NTAVVAGGARKYNWSWPSIFTIYKEEG 257
           +   + + A +  G I + ++ P  VVK+R+   +     G   Y  +  +   IYK EG
Sbjct: 214 EFLSHSMSALT-AGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEG 272

Query: 258 FRALYKGFVPKVLRL 272
            ++ Y G +P +  L
Sbjct: 273 IKSFYSGLIPSLFGL 287

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 14/95 (14%)

Query: 206 IAGSIGGTIGSLMSTPFDVVKSRIQ--------------NTAVVAGGARKYNWSWPSIFT 251
           ++G++ G +  ++  P DV K+R+Q               +     G + Y+  W ++ T
Sbjct: 108 LSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTLTT 167

Query: 252 IYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGC 286
           I ++E  R LYKG VP VL   P   I   V+  C
Sbjct: 168 IVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERC 202

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/186 (20%), Positives = 68/186 (36%), Gaps = 23/186 (12%)

Query: 9   FFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLG--PQYKGVVDCIKQIVAKEGAS 66
           F     +   AG     +  P+ VVKTR+ LQ    +     YK  +D   +I   EG  
Sbjct: 215 FLSHSMSALTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIK 274

Query: 67  RLYKGISSPVLMEAPKRATKFACNDEFQKIYK--------------------REFGVEKL 106
             Y G+  P L      A  F   ++ +K+                      +  G    
Sbjct: 275 SFYSGL-IPSLFGLLHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNF 333

Query: 107 TQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGL 166
                I++   +    + +  P E+++ RLQ  S        ++R   A+EG+   Y+G 
Sbjct: 334 QLGRLIVASCGSKMIASTLTYPHEILRTRLQLKSDMKPSIKSIIRTTYAKEGIRGFYSGF 393

Query: 167 ESTLWR 172
            + ++R
Sbjct: 394 LTNMFR 399

 Score = 35.0 bits (79), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 35/73 (47%), Gaps = 5/73 (6%)

Query: 26  VMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRAT 85
           + YP ++++TR+QL+    + P  K +   I+   AKEG    Y G  + +    P  A 
Sbjct: 352 LTYPHEILRTRLQLK--SDMKPSIKSI---IRTTYAKEGIRGFYSGFLTNMFRTVPASAI 406

Query: 86  KFACNDEFQKIYK 98
                + F+K +K
Sbjct: 407 TLVSFEYFRKHFK 419

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 81.6 bits (200), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/266 (26%), Positives = 121/266 (45%), Gaps = 20/266 (7%)

Query: 29  PLDVVKTRMQLQVS----GGLGPQYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRA 84
           P++ VK  MQ Q      G L  +YKG++DC K+    EG    ++G ++ VL   P +A
Sbjct: 33  PIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTATHEGIVSFWRGNTANVLRYFPTQA 92

Query: 85  TKFACNDEFQKI--YKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKIRL-QDVSS 141
             FA  D+ + +  Y RE        + ++ SG +AG      V   +  + RL  D   
Sbjct: 93  LNFAFKDKIKSLLSYDRERDGYAKWFAGNLFSGGAAGGLSLLFVYSLDYARTRLAADARG 152

Query: 142 S-------YKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLPEA 194
           S       + G +DV +K +  +G+L +Y G   ++    V+   YFG+    + +L   
Sbjct: 153 SKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFVPSVLGIIVYRGLYFGLYDSFKPVLLTG 212

Query: 195 KSKSQQTRNDLIAGSIGGTIG-SLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIY 253
             +     + L+   I  T+G S  S P D V+ R+  T   +G   KY+ +   +  I 
Sbjct: 213 ALEGSFVASFLLGWVI--TMGASTASYPLDTVRRRMMMT---SGQTIKYDGALDCLRKIV 267

Query: 254 KEEGFRALYKGFVPKVLRLGPGGGIL 279
           ++EG  +L+KG    + R     G++
Sbjct: 268 QKEGAYSLFKGCGANIFRGVAAAGVI 293

>Scas_715.45
          Length = 305

 Score = 81.3 bits (199), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 70/259 (27%), Positives = 122/259 (47%), Gaps = 26/259 (10%)

Query: 29  PLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRATKFA 88
           PLD++K R+Q+  +      Y+     I QI+ KEG  +L+ G+ +  +  + + A K+ 
Sbjct: 36  PLDLIKCRLQVDPT-----LYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYG 90

Query: 89  CNDEFQKIY-----KREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSSY 143
             + F+++Y     K E    K   S+ +LS A+A      ++ PFE +K++ Q     +
Sbjct: 91  GYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPW 150

Query: 144 -KGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFG----IIFQVRALLPEAKSKS 198
               I+  +K+ A+EG+   Y G+     R   +    F     I+  + A LP  KS+ 
Sbjct: 151 CNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEM 210

Query: 199 ---QQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWP-SIFTIYK 254
              QQ     + G + G + +++S P DV+ S+I N        RK N S   ++  IY 
Sbjct: 211 SALQQISVSFVGGYMAGILCAIVSHPADVMVSKINN-------ERKVNESMNVALKRIYS 263

Query: 255 EEGFRALYKGFVPKVLRLG 273
             GF  L+ G   ++L +G
Sbjct: 264 RIGFVGLWNGLPVRILMIG 282

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 66/155 (42%), Gaps = 11/155 (7%)

Query: 126 VVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFG--- 182
           V P +L+K RLQ   + Y+     + +I+ +EG+  ++ G+ +T   + +  AG +G   
Sbjct: 34  VTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYE 93

Query: 183 ---IIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGA 239
               ++    +  EA +   +T   L++ +       +M  PF+ +K + Q T       
Sbjct: 94  LFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNN 153

Query: 240 RKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGP 274
               W       +Y +EG    YKG  P   R  P
Sbjct: 154 VIEGWK-----KMYAKEGLNGFYKGITPLWCRQIP 183

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 81.6 bits (200), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/244 (27%), Positives = 113/244 (46%), Gaps = 21/244 (8%)

Query: 3   DARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAK 62
           D    P ++ F AG V GI     M+ LD VKTR Q         +YK ++   + +  +
Sbjct: 47  DYEHSPIWHCFLAGGVGGIIGDSAMHSLDTVKTRQQ---GAPNVHKYKHMLQAYRTMFIE 103

Query: 63  EGASR-LYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCC 121
           EG  R LY G  + +L   P  A  F+  +  ++    ++ +      L+  +G      
Sbjct: 104 EGFRRGLYGGYCAAMLGSFPSAAIFFSTYEFTKRTMINDYHLNDTFSHLT--AGFLGDFF 161

Query: 122 EAFVVVPFELVKIRLQ----------DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLW 171
            +FV VP E++K RLQ          +   +YK   + +  I   EGV A++ G ++TL 
Sbjct: 162 SSFVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKATLA 221

Query: 172 RHGVWNAGYFGIIFQVR--ALLPEAKSKSQQT---RNDLIAGSIGGTIGSLMSTPFDVVK 226
           R   ++A  F    + R  A L E K   +      N+++ G+  G +  +++TP DVVK
Sbjct: 222 RDLPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEIVTGACAGGLAGILTTPLDVVK 281

Query: 227 SRIQ 230
           +R+Q
Sbjct: 282 TRVQ 285

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 80.9 bits (198), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 118/246 (47%), Gaps = 19/246 (7%)

Query: 1   MTDARP---LPFFYQFA-AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCI 56
           M+ A P   L  + +FA AGA+   +    M P+DVVKTR+QL+ +       KG++   
Sbjct: 1   MSAAIPDYSLSDYAKFALAGAIGCGTTHSAMVPIDVVKTRIQLEPT----VYNKGMISSF 56

Query: 57  KQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGA 116
           KQI++ EGA  L  G    +L  + + + KF   + F+K++    G ++     + +   
Sbjct: 57  KQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGYEVFKKLFIDVLGYDQAVNYKNSIYIG 116

Query: 117 SAGCCEAF---VVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRH 173
           SA   E F    + P E  +IRL    +   G +    +I+ +EG  + YNG    L++ 
Sbjct: 117 SAAIAEFFADIALCPLEATRIRLVSQPTFANGLVGGFSRILKEEGAGSFYNGFTPILFKQ 176

Query: 174 GVWNAGYFGIIFQVRALL-------PEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVK 226
             +N   F ++F+  A +        E+ S +  T  +L++G   G   +++S P D + 
Sbjct: 177 IPYNIAKF-LVFERAAEVYFGMAGPKESLSTASTTGINLLSGLTAGLAAAIVSQPADTLL 235

Query: 227 SRIQNT 232
           S++  T
Sbjct: 236 SKVNKT 241

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 68/167 (40%), Gaps = 11/167 (6%)

Query: 113 LSGASAGCCEAFVVVPFELVKIRLQDVSSSY-KGPIDVVRKIIAQEGVLAMYNGLESTLW 171
           L+GA         +VP ++VK R+Q   + Y KG I   ++II+ EG  A+  G   TL 
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLTGFGPTLL 77

Query: 172 RHGVWNAGYFGIIFQVRALLPEAKSKSQQT--RNDLIAGS--IGGTIGSLMSTPFDVVKS 227
            + +  +  FG     + L  +     Q    +N +  GS  I      +   P +  + 
Sbjct: 78  GYSLQGSFKFGGYEVFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRI 137

Query: 228 RIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGP 274
           R+ +    A      N        I KEEG  + Y GF P + +  P
Sbjct: 138 RLVSQPTFA------NGLVGGFSRILKEEGAGSFYNGFTPILFKQIP 178

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 80.5 bits (197), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/286 (25%), Positives = 129/286 (45%), Gaps = 36/286 (12%)

Query: 6   PLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYK-GVVDCIKQIVAKEG 64
           P P  Y +  G   GI   +  +PLD+ K R+Q        P  K  +V    QI+  EG
Sbjct: 5   PEPVKYPWWYGGFGGIVACVATHPLDLAKVRLQ------TAPAPKPTLVRMASQILRNEG 58

Query: 65  ASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSL--SILSGASAGCCE 122
              LY G+++ +L +      +F   D  ++ Y  +  +  +   L  S+ SGA  G   
Sbjct: 59  VPGLYSGLTAAILRQCTYTTARFGVYDFVKERYIPKEYLNSMLYLLPCSMFSGAVGG--- 115

Query: 123 AFVVVPFELVKIRLQDVSS-------SYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGV 175
             +  P ++V IR+Q+ SS       +YK   D + KI + EGV  ++ G +  L R G+
Sbjct: 116 -LIGNPADVVNIRMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVR-GI 173

Query: 176 WNAGYFGIIFQ------VRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRI 229
                  + +       V+ +  +  +KS    + L+AG +  T+ S    P DV+K+R+
Sbjct: 174 LMTSSQVVTYDIAKNYLVQNVGLDKDNKSTHFASSLLAGLVATTVCS----PADVIKTRV 229

Query: 230 QNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPG 275
            N          ++ +   +    K+EG   +++G++P  +RLGP 
Sbjct: 230 MN-----AHKHSHDSAVRILLDAVKQEGPSFMFRGWLPSFVRLGPN 270

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 80.1 bits (196), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 76/286 (26%), Positives = 128/286 (44%), Gaps = 28/286 (9%)

Query: 8   PFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYK---GVVDCIKQIVAKEG 64
           P  YQ AAGA AGI E  +M+P+D +KTRMQ   + G     +    ++  I +I   EG
Sbjct: 16  PLVYQLAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEG 75

Query: 65  ASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVE--KLTQSL-SILSGASAGCC 121
           +  L+KG+ S VL   P  A  FA    ++    R    E  +  Q L + LSG  A   
Sbjct: 76  SLALWKGVQSVVLGAGPAHAVYFA---TYEMCKSRLIDPEDRQTHQPLKTALSGTLATVA 132

Query: 122 EAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYF 181
              ++ PF+ +K RLQ   S       V  ++  +EG+ A +    +T+      N  + 
Sbjct: 133 ADALMNPFDTIKQRLQLHPSDSMTKCAV--RMYQREGIAAFFYSYPTTI----AMNIPFA 186

Query: 182 GIIFQVRALLPEAKSKSQQTRND------LIAGSIGGTIGSLMSTPFDVVKSRIQ---NT 232
            + F +     E+ +K     N+       + G I G   + ++TP D VK+ +Q     
Sbjct: 187 ALNFVIY----ESSTKIFNPSNNYNPWIHCLCGGISGATCAAITTPLDCVKTVLQIRGAD 242

Query: 233 AVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGI 278
           +V +   ++ +    +   I+K  G+   ++G  P+++   P   I
Sbjct: 243 SVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISNMPATAI 288

 Score = 35.4 bits (80), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 35/84 (41%), Gaps = 2/84 (2%)

Query: 205 LIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGA--RKYNWSWPSIFTIYKEEGFRALY 262
           L AG+  G +   +  P D +K+R+Q  +     A  R  +     I  I   EG  AL+
Sbjct: 21  LAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEGSLALW 80

Query: 263 KGFVPKVLRLGPGGGILLVVFTGC 286
           KG    VL  GP   +    +  C
Sbjct: 81  KGVQSVVLGAGPAHAVYFATYEMC 104

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 80.5 bits (197), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 78/291 (26%), Positives = 131/291 (45%), Gaps = 32/291 (10%)

Query: 26  VMYPLDVVKTRMQLQVSGGLGP-QYKGVVDCIKQIVAKEGASR-LYKGISSPVLMEAPKR 83
           VM+ LD VKTR Q    G  G  +Y+ ++   + +  +EG  R LY G  + +L   P  
Sbjct: 70  VMHSLDTVKTRQQ----GAPGEVKYRHMISAYRTLALEEGVRRGLYGGYGAAMLGSFPSA 125

Query: 84  ATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQ------ 137
           A  F   +  ++    E+ + +    L+  +G       + V VP E++K RLQ      
Sbjct: 126 AVFFGTYEWVKRQMINEWQIHETYSHLA--AGFLGDLFSSVVYVPSEVLKTRLQLQGCYN 183

Query: 138 ----DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVR--ALL 191
                   +Y+G  D VR I+  EGV A++ G ++TL R   ++A  F    + R  A L
Sbjct: 184 NRHFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAFYERFRKWAFL 243

Query: 192 PEAKSKSQQTR--NDLIAGSIGGTIGSLMSTPFDVVKSRIQN-------TAVVAGGARKY 242
            E K          +++ G+  G +  +++TP DVVK+RIQ        T   +  AR  
Sbjct: 244 LERKPVDGHLSFTAEVVTGASAGGLAGIITTPLDVVKTRIQTQPRGSAGTPDASAPARLN 303

Query: 243 NWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRTL 293
              + S+  + + EG    + G  P+ +       I+L+++   +   RTL
Sbjct: 304 GSIFRSLLVVLRYEGLGGAFSGVGPRFIWTSIQSSIMLLLYQTAL---RTL 351

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 73/148 (49%), Gaps = 8/148 (5%)

Query: 10  FYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGG-----LGPQYKGVVDCIKQIVAKEG 64
           +   AAG +  +   +V  P +V+KTR+QLQ          G  Y+G+ D ++ IV  EG
Sbjct: 149 YSHLAAGFLGDLFSSVVYVPSEVLKTRLQLQGCYNNRHFQSGYNYRGLSDAVRTIVRTEG 208

Query: 65  ASRLYKGISSPVLMEAPKRATKFACNDEFQK---IYKREFGVEKLTQSLSILSGASAGCC 121
            S L+ G  + +  + P  A +FA  + F+K   + +R+     L+ +  +++GASAG  
Sbjct: 209 VSALFFGYKATLSRDLPFSALQFAFYERFRKWAFLLERKPVDGHLSFTAEVVTGASAGGL 268

Query: 122 EAFVVVPFELVKIRLQDVSSSYKGPIDV 149
              +  P ++VK R+Q       G  D 
Sbjct: 269 AGIITTPLDVVKTRIQTQPRGSAGTPDA 296

 Score = 32.3 bits (72), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 22/40 (55%)

Query: 7   LPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLG 46
           L F  +   GA AG    ++  PLDVVKTR+Q Q  G  G
Sbjct: 253 LSFTAEVVTGASAGGLAGIITTPLDVVKTRIQTQPRGSAG 292

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 79.7 bits (195), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 113/239 (47%), Gaps = 16/239 (6%)

Query: 10  FYQFA-AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRL 68
           + +FA AGA+   S    M P+DVVKTR+QL+ +       KG+V   KQI+A EGA  L
Sbjct: 17  YMKFALAGAIGCGSTHSSMVPIDVVKTRIQLEPT----VYNKGMVGSFKQIIAGEGAGAL 72

Query: 69  YKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVE---KLTQSLSILSGASAGCCEAFV 125
             G    +L  + + A KF   + F+K +    G +   +   S+ + S A A       
Sbjct: 73  LTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIA 132

Query: 126 VVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIF 185
           + P E  +IRL        G +    +I+ +EG+ + Y+G    L++   +N   F ++F
Sbjct: 133 LCPLEATRIRLVSQPQFANGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKF-LVF 191

Query: 186 QVRALL------PEAK-SKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAG 237
           +  +        P+ K S +  T  +L++G   G   +++S P D + S++  T    G
Sbjct: 192 ERASEFYYGFAGPKEKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPG 250

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 76/175 (43%), Gaps = 21/175 (12%)

Query: 126 VVPFELVKIRLQDVSSSY-KGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFG-- 182
           +VP ++VK R+Q   + Y KG +   ++IIA EG  A+  G   TL  + +  A  FG  
Sbjct: 35  MVPIDVVKTRIQLEPTVYNKGMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGAFKFGGY 94

Query: 183 IIFQVRALLPEAKSKSQQTRNDLIAGS--IGGTIGSLMSTPFDVVKSRIQN-----TAVV 235
            +F+   +       + + +N +  GS  +   +  +   P +  + R+ +       +V
Sbjct: 95  EVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIALCPLEATRIRLVSQPQFANGLV 154

Query: 236 AGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFF 290
            G +R           I KEEG  + Y GF P + +  P      +VF    +F+
Sbjct: 155 GGFSR-----------ILKEEGIGSFYSGFTPILFKQIPYNIAKFLVFERASEFY 198

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 80.5 bits (197), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 71/315 (22%), Positives = 137/315 (43%), Gaps = 39/315 (12%)

Query: 2   TDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVA 61
           +D    P ++   +G + G      M+ LD VKTR Q         +Y+ ++   + I  
Sbjct: 46  SDEDLSPIWHCVVSGGIGGKIGDSAMHSLDTVKTRQQ---GAPNVKKYRNMISAYRTIWL 102

Query: 62  KEGASR-LYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGC 120
           +EG  R LY G  + +L   P  A  F   +  ++    ++ +      LS  +G     
Sbjct: 103 EEGVRRGLYGGYMAAMLGSFPSAAIFFGTYEYTKRTMIEDWQINDTITHLS--AGFLGDF 160

Query: 121 CEAFVVVPFELVKIRLQDVSSSYKGPI-----------DVVRKIIAQEGVLAMYNGLEST 169
             +FV VP E++K RLQ +   +  P            + ++ +I +EG  +++ G ++T
Sbjct: 161 ISSFVYVPSEVLKTRLQ-LQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKAT 219

Query: 170 LWRHGVWNAGYFGIIFQVRALLPEAKSKSQQT-----RNDLIAGSIGGTIGSLMSTPFDV 224
           L R   ++A  F    + R L  + + K  +       N+++ G+  G +  +++TP DV
Sbjct: 220 LARDLPFSALQFAFYEKFRQLAFKIEQKDGRDGELSIPNEILTGACAGGLAGIITTPMDV 279

Query: 225 VKSRIQNTAVVAGGARKYNWSWP----------------SIFTIYKEEGFRALYKGFVPK 268
           VK+R+Q     +   + Y+ + P                S+ T+Y+ EG    + G  P+
Sbjct: 280 VKTRVQTQQPPSQSNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVLGFFSGVGPR 339

Query: 269 VLRLGPGGGILLVVF 283
            +       I+L+++
Sbjct: 340 FVWTSVQSSIMLLLY 354

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 79.3 bits (194), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 72/292 (24%), Positives = 117/292 (40%), Gaps = 40/292 (13%)

Query: 16  GAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQ-YKGVVDCIKQIVAKEGASR-LYKGIS 73
           G++AG    ++ YP D VK R+Q Q     G   +     CI      EG  +  ++GI+
Sbjct: 20  GSIAGALGKVIEYPFDTVKVRLQTQ-----GRHVFPDTWSCITYTYKNEGIIKGFFQGIA 74

Query: 74  SPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVK 133
           SP+   A + A  F   ++  K  +    V  LT  L  +SGA AG C +FV+ P EL+K
Sbjct: 75  SPLAGAAIENAALFLSYNQCSKFLQHYTNVSDLTNIL--ISGAFAGSCASFVLTPVELIK 132

Query: 134 IRLQ---------------DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNA 178
            +LQ                V+  +   I  ++ +I   G + ++ G   T  R      
Sbjct: 133 CKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFIRESFGGV 192

Query: 179 GYFGIIFQVRALLPEAKS-------KSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQN 231
            +F     ++  L    +          +T   L +G+  G   +    P D VKS +Q 
Sbjct: 193 AWFATYELMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPADTVKSMMQT 252

Query: 232 TAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
             +    A K          I+ E+G R  Y+G    ++R  P    +  V+
Sbjct: 253 EHLGLKTAIK---------KIFVEKGLRGFYRGLGITLIRAIPANATVFYVY 295

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 79.0 bits (193), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 79/298 (26%), Positives = 129/298 (43%), Gaps = 43/298 (14%)

Query: 9   FFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGL--GPQYKGVVDCIKQIVAKEGAS 66
           F     +GA AG S  LV +P+D +KTR  LQ  GG      Y+GV              
Sbjct: 5   FLISLLSGAAAGTSTDLVFFPIDTLKTR--LQAKGGFFRNGGYRGV-------------- 48

Query: 67  RLYKGISSPVLMEAPKRATKF----ACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCE 122
             Y+G+ S V+  AP  +  F     C  E +  ++       +   ++ +  +S G   
Sbjct: 49  --YRGLGSAVVASAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVTHMFSSSMGEIA 106

Query: 123 AFVV-VPFELVKIRLQDVSSSYKGPIDVVRKIIAQE---GVL-AMYNGLESTLWRHGVWN 177
           A +V VP E+VK R Q  +S      + +R+I+  E   GV   +Y G  +T+ R   + 
Sbjct: 107 ACMVRVPAEVVKQRSQTHAS--HSSWETLREILKNENGEGVRRNLYRGWSTTIMREIPFT 164

Query: 178 AGYFGIIFQVRALLPE-AKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQ--NTAV 234
              F +   ++ +  E  +S   +     + GSI G I +  +TP D +K+R+     ++
Sbjct: 165 CIQFPLYEYMKKVWAELDESDRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRLMLCKKSI 224

Query: 235 VAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRT 292
             G           + TIYKEEGF+  + G  P+ + +  GG I L ++        T
Sbjct: 225 PLGTL---------VSTIYKEEGFKVFFSGVGPRTMWISAGGAIFLGIYETVHSLLST 273

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 40/94 (42%), Gaps = 21/94 (22%)

Query: 204 DLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYK 263
            L++G+  GT   L+  P D +K+R+Q      GG              ++  G+R +Y+
Sbjct: 8   SLLSGAAAGTSTDLVFFPIDTLKTRLQ----AKGG-------------FFRNGGYRGVYR 50

Query: 264 GFVPKVLRLGPGGGILLVVFTGC----MDFFRTL 293
           G    V+   PG  +  + +  C      FFR L
Sbjct: 51  GLGSAVVASAPGASLFFITYDTCKAETRGFFRGL 84

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 79.0 bits (193), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 69/270 (25%), Positives = 123/270 (45%), Gaps = 22/270 (8%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74
           AGAV+G+    +  P+D +K R+QL  + GL P    V++  + ++  EG    +KG   
Sbjct: 22  AGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIP 81

Query: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKI 134
             L+     + +F+    F + Y   FG+E    SL +  GA AG   + V  PF++++ 
Sbjct: 82  GSLLYVTYGSAQFSSYSLFNR-YLTPFGLEARLHSLVV--GAFAGITSSIVSYPFDVLRT 138

Query: 135 RLQDVSSSYKGPID-VVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLPE 193
           RL   +  +   I   VR I   EG+   + G  +++    +  +  FG    +R    E
Sbjct: 139 RLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDE 198

Query: 194 ------AKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQ-----------NTAVVA 236
                 A  K +    +  AG+IGG I  +++ P + ++ R+Q             + V 
Sbjct: 199 NEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVY 258

Query: 237 GGARKYNWSWPSIFTIYKEEGFRALYKGFV 266
           G  + Y ++   +  I K+EG  +LY+G +
Sbjct: 259 GSYKGYGFARIGL-QILKQEGVSSLYRGIL 287

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 79/179 (44%), Gaps = 20/179 (11%)

Query: 111 SILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGP-----IDVVRKIIAQEGVLAMYNG 165
           ++L+GA +G     +  P + +KIRLQ   ++   P     ++V R +I  EG+ + + G
Sbjct: 19  TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKG 78

Query: 166 -LESTLWRHGVWNAGYFGIIFQVRALLP---EAKSKSQQTRNDLIAGSIGGTIGSLMSTP 221
            +  +L      +A +       R L P   EA+  S      L+ G+  G   S++S P
Sbjct: 79  NIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHS------LVVGAFAGITSSIVSYP 132

Query: 222 FDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILL 280
           FDV+++R+     VA            +  I+K EG    +KG +  +  +     I+ 
Sbjct: 133 FDVLRTRL-----VANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMF 186

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 73/181 (40%), Gaps = 31/181 (17%)

Query: 10  FYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLY 69
            +    GA AGI+  +V YP DV++TR+              +   ++ I   EG    +
Sbjct: 113 LHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQ----MHSMSITREVRDIWKLEGLPGFF 168

Query: 70  KG-ISSPV-------LMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCC 121
           KG I+S         +M       +  C DE +K        E  T + S  +G   G  
Sbjct: 169 KGSIASMTTITLTASIMFGTYETIRIYC-DENEKTTAAHKKWELATLNHS--AGTIGGVI 225

Query: 122 EAFVVVPFELVKIRLQDVSS--------------SYKGP--IDVVRKIIAQEGVLAMYNG 165
              +  P E ++ R+Q ++S              SYKG     +  +I+ QEGV ++Y G
Sbjct: 226 AKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRG 285

Query: 166 L 166
           +
Sbjct: 286 I 286

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 41/86 (47%), Gaps = 12/86 (13%)

Query: 205 LIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIF-TIYKEEGFRALYK 263
           L+AG++ G +   ++ P D +K R+Q T   A G + +      +  ++ K EG R+ +K
Sbjct: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTP--ANGLKPFGSQVMEVARSMIKNEGIRSFWK 77

Query: 264 GFVPKVLRLGPGGGILLVVFTGCMDF 289
           G +P         G LL V  G   F
Sbjct: 78  GNIP---------GSLLYVTYGSAQF 94

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 78.6 bits (192), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 74/275 (26%), Positives = 118/275 (42%), Gaps = 31/275 (11%)

Query: 17  AVAGISEILVMYPLDVVKTR-MQLQVSGGLGPQYKGVV--DCIKQIVAKEGASRLYKGIS 73
           A AGI EI V +P+D +  R M        G Q   V+  D   +   K     L+ G+ 
Sbjct: 18  ASAGILEIGVFHPVDTISKRLMSNHTKITSGAQLNSVIFRDHAAEAFGKR-VFTLFPGLG 76

Query: 74  SPVLMEAPKRATKFA--------CNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFV 125
              + +  +R  K+          N  F+K +   FG +      S  +G+  G  E  V
Sbjct: 77  YAAVYKILQRVYKYGGQPFANEFLNKHFKKDFDSAFGDKTGKALRSATAGSLIGIGE-IV 135

Query: 126 VVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIF 185
           ++P +++KI+ Q    ++KG      KI+  EG+  +Y G   T  R+   +   FG   
Sbjct: 136 LLPLDVLKIKRQTNPEAFKG--RGFLKILKDEGIFNLYRGWGWTAARNAPGSFALFGGNA 193

Query: 186 QVRALLPEAKSKSQQT-RNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNW 244
             +  +   +  SQ T   + I+  +G +   ++S P DV+K+RIQN           N+
Sbjct: 194 FAKEYILGLQDYSQATWSQNFISSIVGASASLIVSAPLDVIKTRIQNR----------NF 243

Query: 245 SWPS-----IFTIYKEEGFRALYKGFVPKVLRLGP 274
             P      +    K EGF A +KG  PK+L  GP
Sbjct: 244 DNPESGFKIVKNTLKNEGFTAFFKGLTPKLLTTGP 278

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 4/78 (5%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKG 71
            F +  V   + ++V  PLDV+KTR+Q +        +K     +K  +  EG +  +KG
Sbjct: 213 NFISSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFK----IVKNTLKNEGFTAFFKG 268

Query: 72  ISSPVLMEAPKRATKFAC 89
           ++  +L   PK    FA 
Sbjct: 269 LTPKLLTTGPKLVFSFAL 286

>Scas_721.129
          Length = 323

 Score = 78.6 bits (192), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 98/212 (46%), Gaps = 15/212 (7%)

Query: 94  QKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQ---DVSSS----YKGP 146
           QK    +   +K+++  S ++G  A C       P ELVKIR+Q   ++++     Y+ P
Sbjct: 7   QKKEIEKTAAQKVSKFGSFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNP 66

Query: 147 IDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLP------EAKSKSQQ 200
           I  +  I   EG+  +  GL +        N    G    +R  L       E   K Q+
Sbjct: 67  IQGMGVIFRNEGIRGLQKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQK 126

Query: 201 TRNDLIAGSIGGTIGSLMSTPFDVVKSRIQN--TAVVAGGARKYNWSWPSIFTIYKEEGF 258
              ++ AG+  G IG+++ +P  +VK+R+Q+   A+  G    Y   W  + TI + EGF
Sbjct: 127 VSINVAAGASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGF 186

Query: 259 RALYKGFVPKVLRLGPGGGILLVVFTGCMDFF 290
           + L++G    +LR G G  + L ++    +F 
Sbjct: 187 KGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 218

 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 78/312 (25%), Positives = 128/312 (41%), Gaps = 38/312 (12%)

Query: 2   TDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVS-GGLGPQ-YKGVVDCIKQI 59
           T A+ +  F  F AG +A    +    P+++VK RMQLQ     +G + Y+  +  +  I
Sbjct: 14  TAAQKVSKFGSFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVI 73

Query: 60  VAKEGASRLYKGISSPVLME-----------APKR---ATKFACNDEFQKIYKREFGVEK 105
              EG   L KG+ +  + +            P R    + F  N+E  KI K       
Sbjct: 74  FRNEGIRGLQKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQK------- 126

Query: 106 LTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVS--------SSYKGPIDVVRKIIAQE 157
              S+++ +GAS+G   A +  P  LVK R+Q  S        + Y+   + +  I   E
Sbjct: 127 --VSINVAAGASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTE 184

Query: 158 GVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSL 217
           G   ++ G+++ + R G  ++    I    +  L +           L A +I G   ++
Sbjct: 185 GFKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLKNDLMKDGPGLHLTASTISGLGVAV 244

Query: 218 MSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGG 277
           +  P+DV+ +RI N          Y           + EG  ALYKGF  ++LR+ P   
Sbjct: 245 VMNPWDVILTRIYNQK-----GNLYKGPVDCFVKTVRTEGISALYKGFQAQILRIAPHTI 299

Query: 278 ILLVVFTGCMDF 289
           I L      M  
Sbjct: 300 ICLTFMEQTMKL 311

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 79.0 bits (193), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 76/280 (27%), Positives = 128/280 (45%), Gaps = 28/280 (10%)

Query: 27  MYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASR-LYKGISSPVLMEAPKRAT 85
           M+ LD VKTR Q   S     +YK ++   + I+ +EG  + LY G S  +L   P  A 
Sbjct: 73  MHSLDTVKTRQQGAPST---VKYKNMIGAYRTIILEEGLRKGLYGGYSGAMLGSFPSAAI 129

Query: 86  KFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQ-------- 137
            FA  +  ++    E+G+ +    L+  +G       +FV VP E++K RLQ        
Sbjct: 130 FFATYEYTKRKMIGEWGINETFSHLT--AGFLGDFISSFVYVPSEVLKTRLQLQGRYNNP 187

Query: 138 --DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLPEAK 195
                 +YK   D V  I+ +EG   ++ G ++TL R   ++   F    + R L    +
Sbjct: 188 FFRSGYNYKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPFSGLQFAFYEKFRQLAFAVE 247

Query: 196 SKS----QQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQ--------NTAVVAGGARKYN 243
           +K+        N++I G+  G +  +++TP DVVK+RIQ        N++         N
Sbjct: 248 NKTFDEDLSLSNEIITGAAAGGLAGIITTPLDVVKTRIQTQLPDIPENSSQNLKQQTLTN 307

Query: 244 WSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
                + T+YK EG   L+ G  P+ +       I+L+++
Sbjct: 308 SITKGMMTVYKTEGLAGLFSGVGPRFIWTSIQSSIMLLLY 347

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 78.2 bits (191), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/277 (25%), Positives = 125/277 (45%), Gaps = 30/277 (10%)

Query: 11  YQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVV-DCIKQIVAKEGASRLY 69
           Y +  G  AGI   +V +PLD+ K R+Q        P  K  +   ++ I+A EG   LY
Sbjct: 15  YPWWYGGAAGIFATMVTHPLDLAKVRLQ------AAPMPKPTLFRMLESILANEGVVGLY 68

Query: 70  KGISSPVLMEAPKRATKFACNDEFQK--IYKREFGVEKLTQSLSILSGASAGCCEAFVVV 127
            G+S+ VL +      +F   D  ++  I + +          S+ SGA  G    F   
Sbjct: 69  SGLSAAVLRQCTYTTVRFGAYDLLKENVIPREQLTNMAYLLPCSMFSGAIGGLAGNFA-- 126

Query: 128 PFELVKIRLQDVSS-------SYKGPIDVVRKIIAQEGVL-AMYNGLESTLWRHGVWNAG 179
             ++V IR+Q+ S+       +YK  ID V KI   EG L  ++ G +  + R G+    
Sbjct: 127 --DVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVR-GILMTA 183

Query: 180 YFGIIFQV--RALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAG 237
              + + V    L+ +    + +    L A  + G + + + +P DV+K+RI N      
Sbjct: 184 SQVVTYDVFKNYLVTKLDFDASKNYTHLTASLLAGLVATTVCSPADVMKTRIMN------ 237

Query: 238 GARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGP 274
           G+  +  +   +    ++EG   +++G++P   RLGP
Sbjct: 238 GSGDHQPALKILADAVRKEGPSFMFRGWLPSFTRLGP 274

 Score = 32.3 bits (72), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 5/62 (8%)

Query: 10  FYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLY 69
           +    A  +AG+    V  P DV+KTR+ +  SG   P  K + D ++    KEG S ++
Sbjct: 208 YTHLTASLLAGLVATTVCSPADVMKTRI-MNGSGDHQPALKILADAVR----KEGPSFMF 262

Query: 70  KG 71
           +G
Sbjct: 263 RG 264

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 78.6 bits (192), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 120/297 (40%), Gaps = 56/297 (18%)

Query: 29  PLDVVKTRMQLQVSGGLGP---------------QYKGVVDCIKQIVAKEGASRLYKGIS 73
           P DVVKTR+Q  V  G                   ++  V  I+ +  +EG   L+KG+ 
Sbjct: 69  PFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGLG 128

Query: 74  SPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVK 133
             ++   P R+  F      +    R     +    +  L+GA+AG   +    P  LVK
Sbjct: 129 PNLVGVIPARSINFFTYGVTKDTASRLLNDGQEAPWIHFLAGATAGWATSTATNPIWLVK 188

Query: 134 IRLQ------DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQV 187
            RLQ        S  YK   D ++ ++  EG+L +Y GL          +A Y G +  +
Sbjct: 189 TRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGL----------SASYLGSVESI 238

Query: 188 --------------RALLPEAKSKSQQTRNDLI--------AGSIGGT--IGSLMSTPFD 223
                         +  + E    S++ +   +        +GS G      S+++ P +
Sbjct: 239 LQWVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAAKLFASILTYPHE 298

Query: 224 VVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILL 280
           VV++R++  A    G  KY   + S   I KEEGF ++Y G  P ++R  P   I+ 
Sbjct: 299 VVRTRLRQ-APKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVPNSIIMF 354

 Score = 35.4 bits (80), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 36/74 (48%), Gaps = 1/74 (1%)

Query: 14  AAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGIS 73
           +AGA    + IL  YP +VV+TR++         +Y G+      I+ +EG + +Y G++
Sbjct: 282 SAGAAKLFASILT-YPHEVVRTRLRQAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLT 340

Query: 74  SPVLMEAPKRATKF 87
             ++   P     F
Sbjct: 341 PHLMRTVPNSIIMF 354

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 77.8 bits (190), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 86/277 (31%), Positives = 126/277 (45%), Gaps = 36/277 (12%)

Query: 17  AVAGISEILVMYPLDVVKTR-MQLQVSGGLGPQYKGVVDCIKQIVAKEGASR---LYKGI 72
           A AGI EI V +P+D +  R M      G   Q   V+   ++  A+  + R   L+ G+
Sbjct: 17  ASAGILEIGVFHPVDTISKRLMSNHTKIGSSSQLNSVI--FREHAAEPLSKRVFTLFPGL 74

Query: 73  SSPVLMEAPKRATKFA--------CNDEFQKIYKREFGVEKLTQSL-SILSGASAGCCEA 123
                 +  +R  K+          N  F+  +   FG EK  ++L S  +G+  G  E 
Sbjct: 75  GYAATYKILQRVYKYGGQPFANEFLNRNFKADFDNTFG-EKTGKALRSATAGSMIGIGE- 132

Query: 124 FVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGI 183
            V++P +++KI+ Q    ++KG   V  KI+  EG L +Y G   T  R+   +   FG 
Sbjct: 133 IVLLPLDVLKIKRQTNPEAFKGRGFV--KILKDEG-LGLYRGWGWTAARNAPGSFALFGG 189

Query: 184 IFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLM-STPFDVVKSRIQNTAVVAGGARKY 242
               +  +   K  SQ T +     SI G   SL+ S P DV+K+RIQN           
Sbjct: 190 NAFAKEYILGLKDYSQATWSQNFVSSIVGASASLIISAPLDVIKTRIQNK---------- 239

Query: 243 NWSWP-SIFTI----YKEEGFRALYKGFVPKVLRLGP 274
           N+  P S FTI     K EGF A +KG  PK+L  GP
Sbjct: 240 NFENPESGFTIVKNTLKNEGFSAFFKGLTPKLLTTGP 276

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 4/78 (5%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKG 71
            F +  V   + +++  PLDV+KTR+Q +      P+    +  +K  +  EG S  +KG
Sbjct: 211 NFVSSIVGASASLIISAPLDVIKTRIQNK--NFENPESGFTI--VKNTLKNEGFSAFFKG 266

Query: 72  ISSPVLMEAPKRATKFAC 89
           ++  +L   PK    FA 
Sbjct: 267 LTPKLLTTGPKLVFSFAL 284

>Kwal_23.3529
          Length = 395

 Score = 78.6 bits (192), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 75/279 (26%), Positives = 130/279 (46%), Gaps = 26/279 (9%)

Query: 26  VMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASR-LYKGISSPVLMEAPKRA 84
           VM+ LD VKTR Q        P+Y+ ++   ++I  +EG  R LY G ++ +L   P  A
Sbjct: 102 VMHSLDTVKTRQQ---GAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAA 158

Query: 85  TKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQ------- 137
             F   +  ++    ++GV +    L+  +G S     + V VP E++K RLQ       
Sbjct: 159 IFFGTYELTKRKLIDDWGVNETLSHLT--AGLSGDLVSSVVYVPSEVLKTRLQLQGCYNN 216

Query: 138 ---DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVR--ALLP 192
                  +Y+   D +  I+  EG   ++ G ++TL R   ++A  F    + R  A   
Sbjct: 217 PHFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFRQWAFTL 276

Query: 193 EAKSKSQQTR--NDLIAGSIGGTIGSLMSTPFDVVKSRIQNT--AVVAGGA----RKYNW 244
           E K+ SQ     N+L+ G+  G +  +++TP DV+K+RIQ    + VA  +    R  N 
Sbjct: 277 EGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQMPSTVASDSTRLVRIENS 336

Query: 245 SWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
               +  +Y+ EG    + G  P+ +       I+L+++
Sbjct: 337 LIKGLTAVYRSEGTLGFFSGVGPRFIWTSIQSSIMLLLY 375

>Kwal_33.15597
          Length = 305

 Score = 77.4 bits (189), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 71/269 (26%), Positives = 125/269 (46%), Gaps = 20/269 (7%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74
           AGA+   +    M P+DVVKTR+QL+ +       KG++   KQI++ EGA  L  G   
Sbjct: 19  AGAIGCGTTHSAMVPIDVVKTRIQLEPT----VYNKGMISSFKQIISSEGAGALLTGFGP 74

Query: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAF---VVVPFEL 131
            +L  + + + KF   + F+K++    G ++     + +   SA   E F    + P E 
Sbjct: 75  TLLGYSLQGSFKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEA 134

Query: 132 VKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALL 191
            +IRL    +   G +    +I+ +EG+ + YNG    L++   +N   F ++F+  A +
Sbjct: 135 TRIRLVSQPTFANGLVGGFSRILKEEGLSSFYNGFTPILFKQIPYNIAKF-LVFERAAEV 193

Query: 192 -------PEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNW 244
                   E  S S  T  +L++G   G   +++S P D + S++ N A  A G      
Sbjct: 194 YFGMAGPKETLSTSTTTGLNLLSGLTAGLAAAIVSQPADTLLSKV-NKAKKAPGQSTIGL 252

Query: 245 SWPSIFTIYKEEGFRALYKGFVPKVLRLG 273
               +  + KE GF   + G   +++ +G
Sbjct: 253 ----LGQLAKELGFVGSFAGLPTRLVMVG 277

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 68/167 (40%), Gaps = 11/167 (6%)

Query: 113 LSGASAGCCEAFVVVPFELVKIRLQDVSSSY-KGPIDVVRKIIAQEGVLAMYNGLESTLW 171
           L+GA         +VP ++VK R+Q   + Y KG I   ++II+ EG  A+  G   TL 
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLTGFGPTLL 77

Query: 172 RHGVWNAGYFGIIFQVRALLPEAKSKSQQT--RNDLIAGS--IGGTIGSLMSTPFDVVKS 227
            + +  +  FG     + L  +     Q    +N +  GS  I      +   P +  + 
Sbjct: 78  GYSLQGSFKFGGYEVFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRI 137

Query: 228 RIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGP 274
           R+ +    A      N        I KEEG  + Y GF P + +  P
Sbjct: 138 RLVSQPTFA------NGLVGGFSRILKEEGLSSFYNGFTPILFKQIP 178

>Scas_721.27
          Length = 374

 Score = 78.2 bits (191), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 70/307 (22%), Positives = 128/307 (41%), Gaps = 62/307 (20%)

Query: 25  LVMYPLDVVKTRMQLQVSGGL-----------------------GPQYKGVVDCIKQIVA 61
           +V  P D+VKTR+Q  +   +                       G  +K     +  +  
Sbjct: 68  VVTCPFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGTHFKETFGILGNVYK 127

Query: 62  KEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCC 121
           +EG   L+KG+   ++   P R+  F      ++IY + F   + T  + ++S A+AG  
Sbjct: 128 REGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKAFNNGQETPLIHLMSAATAGWA 187

Query: 122 EAFVVVPFELVKIRLQ----DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWN 177
            +    P  ++K R+Q      +  YK   D ++ ++  EG+  +Y GL          +
Sbjct: 188 TSTATNPIWMIKTRVQLDKAGTTRKYKNSWDCLKTVLKSEGIYGLYRGL----------S 237

Query: 178 AGYFGII---------FQVRALLPE-------AKSKSQQTRNDLI------AGSIGGT-- 213
           A Y G I          Q++ L+ +        + +  ++R + I      +GS G    
Sbjct: 238 ASYLGSIEGILQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEWCQRSGSAGVAKF 297

Query: 214 IGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLG 273
           I S+++ P +VV++R++    +  G  KY     S   I KEEG  ++Y G  P ++R  
Sbjct: 298 IASIVTYPHEVVRTRLRQMP-MENGKPKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTV 356

Query: 274 PGGGILL 280
           P   I+ 
Sbjct: 357 PNSIIMF 363

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 3/75 (4%)

Query: 14  AAGAVAGISEILVMYPLDVVKTRM-QLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGI 72
           +AG    I+ I V YP +VV+TR+ Q+ +  G  P+Y G+V   + I+ +EG + +Y G+
Sbjct: 291 SAGVAKFIASI-VTYPHEVVRTRLRQMPMENG-KPKYTGLVQSFRVIIKEEGLASMYSGL 348

Query: 73  SSPVLMEAPKRATKF 87
           +  ++   P     F
Sbjct: 349 TPHLMRTVPNSIIMF 363

>Scas_673.17
          Length = 314

 Score = 77.4 bits (189), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 68/247 (27%), Positives = 115/247 (46%), Gaps = 21/247 (8%)

Query: 2   TDARPLPFF-----YQFA-AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDC 55
           TDA  +P +     ++FA AGA+   +    + P+DVVKTR+QL+ +       KG+V  
Sbjct: 7   TDAHKIPDYAASDYFKFALAGAIGCGTTHSSLVPVDVVKTRIQLEPT----VYNKGMVGS 62

Query: 56  IKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQ---SLSI 112
            K+I+A EGA  L  G    +L  + + A KF   + F+K+     G E       S+ +
Sbjct: 63  FKKIIADEGAGALLTGFGPTLLGYSVQGAFKFGGYEVFKKLSIDTIGYENAVHYKNSVYM 122

Query: 113 LSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWR 172
            S A A       + P E  +IRL    +   G +    +I+ +EGV + Y+G    L++
Sbjct: 123 GSAAVAEFLADIALCPLEATRIRLVSQPTFANGLVGGFSRILKEEGVGSFYSGFTPILFK 182

Query: 173 HGVWNAGYFGIIFQVRALL-------PEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVV 225
              +N   F ++F+  + +        E  S    T  +L++G   G   + +S P D +
Sbjct: 183 QIPYNIAKF-LVFERASEVYYGIVGAKETLSDMTNTGINLLSGLTAGFAAAFVSQPADTL 241

Query: 226 KSRIQNT 232
            S++  T
Sbjct: 242 LSKVNKT 248

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 67/154 (43%), Gaps = 11/154 (7%)

Query: 126 VVPFELVKIRLQDVSSSY-KGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFG-- 182
           +VP ++VK R+Q   + Y KG +   +KIIA EG  A+  G   TL  + V  A  FG  
Sbjct: 38  LVPVDVVKTRIQLEPTVYNKGMVGSFKKIIADEGAGALLTGFGPTLLGYSVQGAFKFGGY 97

Query: 183 IIFQVRALLPEAKSKSQQTRNDLIAGS--IGGTIGSLMSTPFDVVKSRIQNTAVVAGGAR 240
            +F+  ++       +   +N +  GS  +   +  +   P +  + R+ +    A    
Sbjct: 98  EVFKKLSIDTIGYENAVHYKNSVYMGSAAVAEFLADIALCPLEATRIRLVSQPTFA---- 153

Query: 241 KYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGP 274
             N        I KEEG  + Y GF P + +  P
Sbjct: 154 --NGLVGGFSRILKEEGVGSFYSGFTPILFKQIP 185

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 77.0 bits (188), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 80/295 (27%), Positives = 128/295 (43%), Gaps = 27/295 (9%)

Query: 8   PFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASR 67
           P   Q  AGA AGI E  +M+P+D +KTR  +Q +G       G++  I +I   EG+  
Sbjct: 22  PLHSQLLAGAFAGIMEHSLMFPIDALKTR--VQAAGLNKAASTGMISQISKISTMEGSMA 79

Query: 68  LYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSI---LSGASAGCCEAF 124
           L+KG+ S +L   P  A  F    EF K   R    E +     +   LSG  A      
Sbjct: 80  LWKGVQSVILGAGPAHAVYFG-TYEFCK--ARLISPEDMQTHQPMKTALSGTIATIAADA 136

Query: 125 VVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGII 184
           ++ PF+ VK RLQ + ++ +   +V ++I   EG  A Y    +TL      N  +    
Sbjct: 137 LMNPFDTVKQRLQ-LDTNLR-VWNVTKQIYQNEGFAAFYYSYPTTL----AMNIPFAAFN 190

Query: 185 FQVRALLPEAKSK---SQQTRNDLI---AGSIGGTIGSLMSTPFDVVKSRIQ---NTAVV 235
           F +     E+ SK    Q + N LI    G I G   + ++TP D +K+ +Q   +  V 
Sbjct: 191 FMIY----ESASKFFNPQNSYNPLIHCLCGGISGATCAALTTPLDCIKTVLQVRGSETVS 246

Query: 236 AGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFF 290
               +  N    +   I +  G++  ++G  P+++   P   I    +     F 
Sbjct: 247 IEIMKDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPATAISWTAYECAKHFL 301

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 39/98 (39%), Gaps = 11/98 (11%)

Query: 193 EAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQ----NTAVVAGGARKYNWSWPS 248
           EA        + L+AG+  G +   +  P D +K+R+Q    N A   G   +       
Sbjct: 15  EALPSHAPLHSQLLAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAASTGMISQ------- 67

Query: 249 IFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGC 286
           I  I   EG  AL+KG    +L  GP   +    +  C
Sbjct: 68  ISKISTMEGSMALWKGVQSVILGAGPAHAVYFGTYEFC 105

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 76.6 bits (187), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 73/296 (24%), Positives = 133/296 (44%), Gaps = 40/296 (13%)

Query: 1   MTDARPLPFFYQ--FAAGAVAGISEILVMY----PLDVVKTRMQLQVSGGLGPQ-YKGVV 53
           M+  +P+P F    +AA  + G+      +    PLD+VK R+Q+       PQ Y+  +
Sbjct: 1   MSTKQPIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVN------PQLYRSNL 54

Query: 54  DCIKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVE---KLTQSL 110
           D  K IV  EG S+++ G+ +  +  + + A K+   + F++ Y      E   +   ++
Sbjct: 55  DGWKTIVRSEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPETAHRHRTAV 114

Query: 111 SILSGASAGCCEAFVVVPFELVKIRLQDVSSSY-KGPIDVVRKIIAQEGVLAMYNGLEST 169
            + + ASA      ++ P+E +K++ Q     + K  ++   KI A EG+  +Y G+   
Sbjct: 115 YLCASASAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPL 174

Query: 170 LWRHGVWNAGYFG----IIFQVRALLPEAK---SKSQQTRNDLIAGSIGGTIGSLMSTPF 222
             R   +    F     I+  + A LP +K   S SQQ     + G + G + +++S P 
Sbjct: 175 WCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPA 234

Query: 223 DVVKSRI-----QNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLG 273
           DV+ S++     Q  ++V    R           IY   GF  L+ G   ++  +G
Sbjct: 235 DVMVSKVNADRKQGESMVEASKR-----------IYSRIGFGGLWNGLPVRIFMIG 279

>Scas_714.18
          Length = 305

 Score = 76.3 bits (186), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 71/300 (23%), Positives = 119/300 (39%), Gaps = 44/300 (14%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASR-LYK 70
           +  AG++AG     + YP D VK R+Q Q +      +     CIK     EG     Y+
Sbjct: 15  EILAGSIAGAIGKFIEYPFDTVKVRLQTQEA----YMFPSTWSCIKYTYENEGILEGFYQ 70

Query: 71  GISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSIL-SGASAGCCEAFVVVPF 129
           GI SP++  A + A  F   ++            + +  L IL S   AG C +FV+ P 
Sbjct: 71  GIESPLIGAALENAILFLAYNQCSSFLN---AFTEFSAFLIILISAGFAGSCASFVLTPV 127

Query: 130 ELVKIRLQDVSSSYKGP--------------------------IDVVRKIIAQEGVLAMY 163
           EL+K +LQ  +  Y                             I  ++ II ++G+  ++
Sbjct: 128 ELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGLFGLW 187

Query: 164 NGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFD 223
            G  ST  R  + +  +F     ++  L + KS+   T   LI+G+  G   +    P D
Sbjct: 188 QGQSSTFIRESIGSVVWFATYELMKQTLRDPKSEVNTTWQLLISGATAGLAFNGSVFPAD 247

Query: 224 VVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
            VKS +Q   +             ++ +I + +G    Y+G    +LR  P    +   +
Sbjct: 248 TVKSIMQTEHLAL---------METVRSILERDGVAGFYRGLGITLLRAVPSNAAVFYTY 298

>Kwal_27.12081
          Length = 369

 Score = 77.0 bits (188), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 74/301 (24%), Positives = 125/301 (41%), Gaps = 57/301 (18%)

Query: 25  LVMYPLDVVKTRMQLQV-----------------SGGLGPQYKGVVDCIKQIVAKEGASR 67
           +V  P DVVKTR+Q  V                 S G+   ++     I  +   EG   
Sbjct: 68  IVTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIR-HFRETFGIISNLYKLEGFRS 126

Query: 68  LYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVV 127
           L+KG+   ++   P R+  F      ++IY R F   +    + ++S A+AG   +    
Sbjct: 127 LFKGLGPNLVGVIPARSINFFTYGTTKQIYSRAFNNGEEAPWIHLISAATAGWATSTATN 186

Query: 128 PFELVKIRLQ----DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGI 183
           P  L+K RLQ      +  YK   D ++ II +EG   +Y GL          +A Y G 
Sbjct: 187 PIWLIKTRLQLDKAGHTRQYKNSWDCLKHIIQKEGFFGLYKGL----------SASYLGS 236

Query: 184 I---------------FQVRAL-----LPEAKSKSQQTRNDLI--AGSIG--GTIGSLMS 219
           +                ++R++     + E +  + +   +    +GS G    + S+++
Sbjct: 237 VEGILQWLLYEQMKQMIKMRSIEKFGHISEGEKNTSEKIKEWCQRSGSAGLAKFLASIVT 296

Query: 220 TPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGIL 279
            P +VV++R++  A +     KY     S   I KEEG  ++Y G  P +LR  P   I+
Sbjct: 297 YPHEVVRTRLRQ-APLENDKLKYTGLIQSFRVIIKEEGLASMYGGLTPHLLRTVPNSIIM 355

Query: 280 L 280
            
Sbjct: 356 F 356

 Score = 71.2 bits (173), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 89/190 (46%), Gaps = 22/190 (11%)

Query: 2   TDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVA 61
            +    P+ +  +A A AG +      P+ ++KTR+QL  +G    QYK   DC+K I+ 
Sbjct: 161 NNGEEAPWIHLISA-ATAGWATSTATNPIWLIKTRLQLDKAGHTR-QYKNSWDCLKHIIQ 218

Query: 62  KEGASRLYKGISSP-----------VLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSL 110
           KEG   LYKG+S+            +L E  K+  K    ++F  I + E    +  +  
Sbjct: 219 KEGFFGLYKGLSASYLGSVEGILQWLLYEQMKQMIKMRSIEKFGHISEGEKNTSEKIKEW 278

Query: 111 SILSGASAGCCE---AFVVVPFELVKIR-----LQDVSSSYKGPIDVVRKIIAQEGVLAM 162
              SG SAG  +   + V  P E+V+ R     L++    Y G I   R II +EG+ +M
Sbjct: 279 CQRSG-SAGLAKFLASIVTYPHEVVRTRLRQAPLENDKLKYTGLIQSFRVIIKEEGLASM 337

Query: 163 YNGLESTLWR 172
           Y GL   L R
Sbjct: 338 YGGLTPHLLR 347

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 38/74 (51%), Gaps = 3/74 (4%)

Query: 19  AGISEIL---VMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSP 75
           AG+++ L   V YP +VV+TR++         +Y G++   + I+ +EG + +Y G++  
Sbjct: 285 AGLAKFLASIVTYPHEVVRTRLRQAPLENDKLKYTGLIQSFRVIIKEEGLASMYGGLTPH 344

Query: 76  VLMEAPKRATKFAC 89
           +L   P     F  
Sbjct: 345 LLRTVPNSIIMFGT 358

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 75.9 bits (185), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 77/275 (28%), Positives = 123/275 (44%), Gaps = 31/275 (11%)

Query: 17  AVAGISEILVMYPLDVVKTRM---QLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGIS 73
           A AGI EI V +P+D +  R+     +++ G         D   + + K   + L+ G+ 
Sbjct: 18  ASAGIMEIAVFHPVDTISKRLMSNHTKITSGQELNRVIFRDHFSEPLGKRLFT-LFPGLG 76

Query: 74  SPVLMEAPKRATKFA----CNDEFQKIYKREFGV---EKLTQSL-SILSGASAGCCEAFV 125
                +  +R  K+      N+   K YK++F     EK  +++ S  +G+  G  E  V
Sbjct: 77  YAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAMRSAAAGSLIGIGE-IV 135

Query: 126 VVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIF 185
           ++P +++KI+ Q    S+KG   +  KI+  EG+  +Y G   T  R+   +   FG   
Sbjct: 136 LLPLDVLKIKRQTNPESFKGRGFI--KILRDEGLFNLYRGWGWTAARNAPGSFALFGGNA 193

Query: 186 QVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLM-STPFDVVKSRIQNTAVVAGGARKYNW 244
             +  +   K  SQ T +     SI G   SL+ S P DV+K+RIQN           N+
Sbjct: 194 FAKEYILGLKDYSQATWSQNFISSIVGACSSLIVSAPLDVIKTRIQNR----------NF 243

Query: 245 SWPS-----IFTIYKEEGFRALYKGFVPKVLRLGP 274
             P      +    K EG  A +KG  PK+L  GP
Sbjct: 244 DNPESGLRIVKNTLKNEGVTAFFKGLTPKLLTTGP 278

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 4/78 (5%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKG 71
            F +  V   S ++V  PLDV+KTR+Q +      P+    +  +K  +  EG +  +KG
Sbjct: 213 NFISSIVGACSSLIVSAPLDVIKTRIQNRNFD--NPE--SGLRIVKNTLKNEGVTAFFKG 268

Query: 72  ISSPVLMEAPKRATKFAC 89
           ++  +L   PK    FA 
Sbjct: 269 LTPKLLTTGPKLVFSFAL 286

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 75.9 bits (185), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 120/276 (43%), Gaps = 30/276 (10%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIV----AKEGASR 67
             AAGAV G+  +L  +P D++K R Q         Q  G VD +++I+    A+ G S 
Sbjct: 50  SLAAGAVGGVCAVLTGHPFDLLKVRCQSN-------QASGTVDAVRKILVEARAQSGLSA 102

Query: 68  L------YKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCC 121
           +      YKG+  P+L   P  A  F   D  +K+        KLT +    +G  +   
Sbjct: 103 VNMMRGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTWNDNSGKLTTAQLATAGFISAIP 162

Query: 122 EAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYF 181
              V+ P E VK+ LQ  S+   G     + I+A  GV +++ G  +TL R G  +A YF
Sbjct: 163 TTLVMAPTERVKVVLQTQSNHSLG--SAAKHILATGGVRSLFRGSLATLARDGPGSALYF 220

Query: 182 GIIFQVRALLPEAKSKSQQ--TRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGA 239
                 +A L  A+S + +   +N  +AG + G    +   P D +K+ +Q++       
Sbjct: 221 ASYEATKAYL-NARSGTNELSIKNVCLAGGMAGVSMWVGVFPIDTIKTELQSS------- 272

Query: 240 RKYNWSWPSIFTIYKEE-GFRALYKGFVPKVLRLGP 274
                   +   IY    G +  + G  P +LR  P
Sbjct: 273 NTRQTMMEATRKIYNTRGGIKGFFPGIGPALLRSFP 308

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 79/185 (42%), Gaps = 23/185 (12%)

Query: 111 SILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKII----AQEGVLAM---- 162
           S+ +GA  G C      PF+L+K+R Q  S+   G +D VRKI+    AQ G+ A+    
Sbjct: 50  SLAAGAVGGVCAVLTGHPFDLLKVRCQ--SNQASGTVDAVRKILVEARAQSGLSAVNMMR 107

Query: 163 --YNG-LESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMS 219
             Y G +   L    ++   ++G     + +     S    T     AG I     +L+ 
Sbjct: 108 GFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTWNDNSGKLTTAQLATAGFISAIPTTLVM 167

Query: 220 TPFDVVKSRIQNTAVVA-GGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGI 278
            P + VK  +Q  +  + G A K+         I    G R+L++G +  + R GPG  +
Sbjct: 168 APTERVKVVLQTQSNHSLGSAAKH---------ILATGGVRSLFRGSLATLARDGPGSAL 218

Query: 279 LLVVF 283
               +
Sbjct: 219 YFASY 223

 Score = 32.3 bits (72), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 32/77 (41%), Gaps = 2/77 (2%)

Query: 200 QTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAV--VAGGARKYNWSWPSIFTIYKEEG 257
           +    L AG++GG    L   PFD++K R Q+          RK      +   +     
Sbjct: 46  ENAKSLAAGAVGGVCAVLTGHPFDLLKVRCQSNQASGTVDAVRKILVEARAQSGLSAVNM 105

Query: 258 FRALYKGFVPKVLRLGP 274
            R  YKG +P +L + P
Sbjct: 106 MRGFYKGVIPPLLGVTP 122

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 74.3 bits (181), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 84/297 (28%), Positives = 131/297 (44%), Gaps = 58/297 (19%)

Query: 9   FFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQ--YKGVVDCIKQIVAKEGAS 66
           F    A+GA AG S  L  +P+D +KTR  LQ  GG      YKGV              
Sbjct: 6   FLVSLASGAAAGTSTDLAFFPIDTLKTR--LQAKGGFFANGGYKGV-------------- 49

Query: 67  RLYKGISSPVLMEAPKRATKFACNDEFQKIYKREF------GVEKLTQSLSILSGASAGC 120
             Y+G+ S V+  AP  +  F   D   K+Y +           ++  +LS +  +S G 
Sbjct: 50  --YRGLGSAVIASAPSASLFFVSYDSM-KVYSKPVISKYVTSNNQMADTLSHMFSSSIGE 106

Query: 121 CEAFVV-VPFELVKIRLQ--DVSSSYKGPIDVVRKIIAQEGVL-AMYNGLESTLWRHGVW 176
             A +V VP E++K R Q    +SS++    +++     EGVL  +Y G  +T+ R    
Sbjct: 107 VSACLVRVPAEVIKQRTQTHKTNSSWQTFTKILQNENG-EGVLRNLYRGWNTTIMRE--- 162

Query: 177 NAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSL-------MSTPFDVVKSRI 229
              +  I F +   L   K+ +++   D +A   G   GS+        +TP DV+K+R+
Sbjct: 163 -IPFTCIQFPLYEFL--KKTWAKRNGQDHVAPWQGSVCGSVAGAIAAATTTPLDVLKTRL 219

Query: 230 ---QNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
                +  VA  A+           IY EEGF+  + G  P+ + +  GG I L V+
Sbjct: 220 MLSHKSIPVAQLAKN----------IYAEEGFKVFFSGVGPRTMWISAGGAIFLGVY 266

>Scas_558.2
          Length = 289

 Score = 73.9 bits (180), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 77/293 (26%), Positives = 124/293 (42%), Gaps = 45/293 (15%)

Query: 9   FFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRL 68
           F     +GA AG S  LV +P+D +KTR  LQ  GG                   G   +
Sbjct: 6   FVMSLLSGAAAGTSTDLVFFPIDTLKTR--LQAKGGF--------------FQNGGYHGI 49

Query: 69  YKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQS------------LSILSGA 116
           Y+G+ S V+  AP  +  F   D   K+  R   VE++  S            + +++ +
Sbjct: 50  YRGLGSAVVASAPSASLFFVTYDSM-KVRVRPH-VERVINSSGTRSPHSVDTIVHMIASS 107

Query: 117 SAGCCEAFVVVPFELVKIRLQ--DVSSSYKGPIDVVRKIIAQEGVL-AMYNGLESTLWRH 173
                   V VP E++K R Q    +SS++     + K   QEG++  +Y G  +T+ R 
Sbjct: 108 MGELAACLVRVPAEVIKQRTQVHSTNSSWQ-TFRTILKNENQEGIIRNLYRGWSTTIMRE 166

Query: 174 GVWNAGYFGI--IFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQ- 230
             +    F +    +    L + +    +     I GSI G I +  +TP D +K+R+  
Sbjct: 167 IPFTCIQFPLYEFMKKEWALYDNEVGHLKPWKGAICGSIAGGIAAATTTPLDFLKTRLML 226

Query: 231 NTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
           N   +   +   N        IYKEEGF+  + G  P+ + +  GG I L V+
Sbjct: 227 NKDSIPIKSLIRN--------IYKEEGFKIFFSGIYPRTMWISAGGAIFLGVY 271

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 73.9 bits (180), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 74/300 (24%), Positives = 129/300 (43%), Gaps = 41/300 (13%)

Query: 8   PFFYQFAAGAVAGISEILVMYPLDVVKTRMQ---------------LQVSGGLGPQYKGV 52
           P  YQ  AGA AGI E  +M+P+D +KTRMQ                  +   G     +
Sbjct: 19  PLSYQLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTL 78

Query: 53  VDCIKQIVAKEGASRLYKGISSPVLMEAPKRATKFA----CNDEFQKIYKREFGVEKLTQ 108
           +  I +I + EG+  L++G+ S V+   P  A  FA    C +  Q I  ++F   +  +
Sbjct: 79  LQQISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKE--QLIDAKDFNTHQPLK 136

Query: 109 SLSILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPI-DVVRKIIAQEGVLAMYNGLE 167
             + +SG +A      ++ PF+ +K RLQ  S S    +  +   I   EG +A +    
Sbjct: 137 --TAVSGVAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAFNIYKNEGPMAFFYSYP 194

Query: 168 STLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRN------DLIAGSIGGTIGSLMSTP 221
           +TL      N  +  + F    ++ E+ +K     N        + G I G   + ++TP
Sbjct: 195 TTL----AMNIPFAALNF----VIYESSTKFFNPTNAYNPWIHCLCGGIAGATCAAVTTP 246

Query: 222 FDVVKSRIQ---NTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGI 278
            D +K+ +Q   +  V     +  N    +   I++  G++  ++G  P+V+   P   I
Sbjct: 247 LDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPRVISNIPATAI 306

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 83/205 (40%), Gaps = 28/205 (13%)

Query: 109 SLSILSGASAGCCEAFVVVPFELVKIRLQDVSS--------------------SYKGPID 148
           S  +++GA AG  E  ++ P + +K R+Q VS                          + 
Sbjct: 21  SYQLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLLQ 80

Query: 149 VVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKS-KSQQTRNDLIA 207
            + +I + EG LA++ G++S +   G  +A YF      +  L +AK   + Q     ++
Sbjct: 81  QISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDFNTHQPLKTAVS 140

Query: 208 GSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVP 267
           G         +  PFD +K R+Q  +  +  +      W   F IYK EG  A +  + P
Sbjct: 141 GVAATVAADALMNPFDTIKQRLQLQSKSSDSSM-----WRMAFNIYKNEGPMAFFYSY-P 194

Query: 268 KVLRLG-PGGGILLVVFTGCMDFFR 291
             L +  P   +  V++     FF 
Sbjct: 195 TTLAMNIPFAALNFVIYESSTKFFN 219

>Kwal_23.4731
          Length = 314

 Score = 73.6 bits (179), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 79/301 (26%), Positives = 128/301 (42%), Gaps = 30/301 (9%)

Query: 8   PFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDC-IKQIVAKEGAS 66
           P   +  AG  AG    +  +PLD+VK R+QL V+      YK V+   I+   A     
Sbjct: 12  PLQREIIAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVIKTIIRDSKADSNVF 71

Query: 67  R-LYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKL---TQ-----------SLS 111
           R  Y+G+   ++  +      F     F K     +GV ++   TQ           SL 
Sbjct: 72  REAYRGLGVNLIGNSIAWGLYFGLY-RFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLY 130

Query: 112 ILSGASAGCCEAFVVVPFELVKIRLQDVSSS----YKGPIDVVRKIIAQEGVLAMYNGLE 167
           + S A +G   A +  P  ++K R+   SS     YK   D +RK+ A EG    + GL 
Sbjct: 131 LASAALSGLGTAILTNPIWVIKTRIMSTSSQASERYKTTWDGIRKVYAHEGFSGFWRGLV 190

Query: 168 STLWRHGVWN-AGYFGIIFQVRALLPEAKSKSQQTR----NDLIAGSIGGTIGSLMSTPF 222
            +L+  GV   A YF I   +R      +  ++  +     ++   S+   +      PF
Sbjct: 191 PSLF--GVAQGAIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSVSKMLSVTAVYPF 248

Query: 223 DVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVV 282
            ++KS +Q+ A V    R     W  + +I+++EG + LYKG    +LR  P   I   +
Sbjct: 249 QLLKSNLQSFAAVE--KRDSYRFWNLVKSIHQKEGLQGLYKGLSANLLRAIPSTCITFCI 306

Query: 283 F 283
           +
Sbjct: 307 Y 307

>Scas_562.12
          Length = 300

 Score = 73.6 bits (179), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 71/278 (25%), Positives = 129/278 (46%), Gaps = 37/278 (13%)

Query: 17  AVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASR--------L 68
           A AGI EI V +P+D +  R+ +     +G  ++     + +++ +E  S         L
Sbjct: 18  ASAGILEIGVFHPVDTISKRL-MSNHTKIGNSHE-----LNRVIFREHFSEPLGKRLFTL 71

Query: 69  YKGISSPVLMEAPKRATKFA----CNDEFQKIYKREFGV---EKLTQSL-SILSGASAGC 120
           + G+      +  +R  K+      N+   K YK++F     EK  +++ S  +G+  G 
Sbjct: 72  FPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDSAFGEKTGKAMRSATAGSLIGI 131

Query: 121 CEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGY 180
            E  V++P +++KI+ Q    ++KG   V  KI+  EG+  +Y G   T  R+   +   
Sbjct: 132 GE-IVLLPLDVLKIKRQTNPEAFKGRGFV--KILKDEGIFNLYRGWGWTAARNAPGSFAL 188

Query: 181 FGIIFQVRALLPEAKSKSQQT-RNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGA 239
           FG     +  +   +  SQ +   + I+  +G +   ++S P DV+K+RIQN        
Sbjct: 189 FGGNAFAKEYILGLEDYSQASWSQNFISSIVGASCSLIVSAPLDVIKTRIQN-------- 240

Query: 240 RKYNWSWPSIFTI---YKEEGFRALYKGFVPKVLRLGP 274
           R ++     +  +   +K EG  A +KG  PK+L  GP
Sbjct: 241 RSFDNPETGLTIVKNTFKNEGITAFFKGLTPKLLTTGP 278

 Score = 35.4 bits (80), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 36/78 (46%), Gaps = 4/78 (5%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKG 71
            F +  V     ++V  PLDV+KTR+Q +      P+    +  +K     EG +  +KG
Sbjct: 213 NFISSIVGASCSLIVSAPLDVIKTRIQNRSFD--NPETG--LTIVKNTFKNEGITAFFKG 268

Query: 72  ISSPVLMEAPKRATKFAC 89
           ++  +L   PK    FA 
Sbjct: 269 LTPKLLTTGPKLVFSFAL 286

>Kwal_23.3965
          Length = 307

 Score = 73.6 bits (179), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 70/300 (23%), Positives = 125/300 (41%), Gaps = 23/300 (7%)

Query: 5   RPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEG 64
           + +P F    AG ++GIS  +V  PLD +K R+QLQ++     QY G++   K++V +EG
Sbjct: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQLAN--EAQYGGILVTFKRLVRQEG 67

Query: 65  ASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAF 124
              L+KG    + M     +T+F       K+  +    +   Q  + + GA +G C A 
Sbjct: 68  VRALWKGNVPAMAMYILYGSTQFTSYAILNKLLSKS---QLPAQIHTGMVGALSGTCSAI 124

Query: 125 VVVPFELVKIR-LQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGI 183
              P ++++ R + + S      +   ++I   EG    + G+ S++    V  +     
Sbjct: 125 ASYPCDVLRTRFIANHSRELSTMLSTAQEIWRHEGFRGFFKGVSSSIVSIAVATSSILAT 184

Query: 184 IFQVRALLPEAKSKSQQTRNDLIAGS---IGGTIGSLMSTPFDVVKSRIQ---------- 230
              V+ +  E +     +   L+  S   I G +   +  P D V+ R Q          
Sbjct: 185 YESVK-IFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHP 243

Query: 231 ---NTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCM 287
              N A  A  +            I ++EG  ALY G+   + +  P   + L V+  C+
Sbjct: 244 GHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYEWCL 303

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 72.0 bits (175), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/283 (25%), Positives = 123/283 (43%), Gaps = 38/283 (13%)

Query: 11  YQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYK-GVVDCIKQIVAKEGASRLY 69
           Y +  G  AGI  ++  +PLD+ K R+Q        P  K  +V  ++ I+  EG   LY
Sbjct: 8   YPWWYGGAAGIFAVMNTHPLDLTKVRLQ------AAPIPKPTIVQMLRSILKNEGIVGLY 61

Query: 70  KGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQ-----SLSILSGASAGCCEAF 124
            G+S+ +L +      +F   D  +   +     +KLT        S++SGA  G    F
Sbjct: 62  AGLSASLLRQCTYTTARFGMYDALK---EHVIPRDKLTNMWYLLGASMVSGALGGLAGNF 118

Query: 125 VVVPFELVKIRLQDVSS-------SYKGPIDVVRKIIAQEGVLAMY-NGLESTLWRHGVW 176
                +L+ IR+Q+ S+       +YK  ID + KI   EG  +++  G +  + R  + 
Sbjct: 119 A----DLINIRMQNDSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLM 174

Query: 177 NAGYFGII-----FQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQN 231
            A           F V     + K  S    + L+AG +  T+ S    P DV+K+ + N
Sbjct: 175 TASQVVTYDMFKNFLVTKYNMDPKKNSTHLTSSLLAGFVATTVCS----PADVIKTIVMN 230

Query: 232 TAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGP 274
                G    ++ S+  +     +EG   +++G+VP   RL P
Sbjct: 231 AHKKPG--HNHDSSFKILMEAINKEGPSFMFRGWVPSFTRLAP 271

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 72.0 bits (175), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 76/296 (25%), Positives = 132/296 (44%), Gaps = 28/296 (9%)

Query: 10  FYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLY 69
           F  F AG V G     V+ P++ VK  +Q+Q S        G+V  +KQ+  +EG   L+
Sbjct: 17  FIAFVAGGVGGAVSRTVVSPVERVKILLQVQSS--TTAYNGGLVHAVKQVYKEEGVKGLF 74

Query: 70  KGISSPVLMEAPKRATKFACNDEFQK---IYKREFGVEKLTQSLSILSGASAGCCEAFVV 126
           +G     L   P  A ++A   EF K    +  + G E+L     ++ GA  G     V 
Sbjct: 75  RGNGINCLRIFPYSAVQYAVY-EFCKTRVFHVGQSGHEQLRSWERLVGGALGGGASVLVT 133

Query: 127 VPFELVKIRLQDVSSSYK--------------GPIDVVRKIIAQEGVL-AMYNGLESTLW 171
            P +LV+ RL   +++                G ++++R+I  +EG L   Y G+  T  
Sbjct: 134 YPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSL 193

Query: 172 RHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQN 231
               + A  F +  +++AL+P            L  G++ G I   +  PFD+++ R Q 
Sbjct: 194 GVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLLRRRFQ- 252

Query: 232 TAVVAGGARKYNWSWPSI----FTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
             V+  G  +  + + S+    +TI ++EG R  YKG    ++++ P   +   V+
Sbjct: 253 --VLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVY 306

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 9/90 (10%)

Query: 202 RND----LIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSW-PSIFTIYKEE 256
           +ND     +AG +GG +   + +P + VK  +Q    V      YN     ++  +YKEE
Sbjct: 13  KNDGFIAFVAGGVGGAVSRTVVSPVERVKILLQ----VQSSTTAYNGGLVHAVKQVYKEE 68

Query: 257 GFRALYKGFVPKVLRLGPGGGILLVVFTGC 286
           G + L++G     LR+ P   +   V+  C
Sbjct: 69  GVKGLFRGNGINCLRIFPYSAVQYAVYEFC 98

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 71.6 bits (174), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 61/277 (22%), Positives = 121/277 (43%), Gaps = 22/277 (7%)

Query: 16  GAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSP 75
           G V G++  +V+ P D++KTR+Q      L    K +    KQ+      S L   I S 
Sbjct: 14  GFVGGLTSAIVLQPFDLLKTRLQQNKDTTLWGTLKEI-RSPKQLWRGALPSSLRTSIGSA 72

Query: 76  VLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKIR 135
           + +             + Q +      + +LT   ++ SGA       F+ +P  ++K+R
Sbjct: 73  LYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTRGVVGFITMPITIIKVR 132

Query: 136 LQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQ-----VRAL 190
            +    SYK   +  R I + EG+   +NG  +T+ R   + AG + ++++     V  +
Sbjct: 133 YESTMYSYKSLGEATRHIYSTEGIRGFFNGCGATVMRDAPY-AGLYVLLYEKAKLLVPMM 191

Query: 191 LPEAK---------SKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARK 241
           LP +          +    T  + I+  +  ++ + +++PFD +K+R+Q          K
Sbjct: 192 LPSSTISYDEAGMFTTYTSTVVNSISAFMSASLATTITSPFDTIKTRMQLDPT------K 245

Query: 242 YNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGI 278
           ++  + ++  I  +E F+ L+ G   ++ R     GI
Sbjct: 246 FSGFYKTLVLIVSKEKFKNLFDGLTLRLTRKAFSAGI 282

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/191 (20%), Positives = 80/191 (41%), Gaps = 23/191 (12%)

Query: 104 EKLTQSLSILSGASAGCCEAFVVVPFELVKIRL-QDVSSSYKGPIDVVRKIIAQEGVLAM 162
           E+   S  ++ G   G   A V+ PF+L+K RL Q+  ++  G +  +R          +
Sbjct: 3   ERPKTSSHLIGGFVGGLTSAIVLQPFDLLKTRLQQNKDTTLWGTLKEIR------SPKQL 56

Query: 163 YNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSKS---------QQTR-NDLIAGSIGG 212
           + G   +  R  + +A Y   +   R  + + K+++         Q T   +L +G+   
Sbjct: 57  WRGALPSSLRTSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTR 116

Query: 213 TIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRL 272
            +   ++ P  ++K R ++T         Y     +   IY  EG R  + G    V+R 
Sbjct: 117 GVVGFITMPITIIKVRYESTMY------SYKSLGEATRHIYSTEGIRGFFNGCGATVMRD 170

Query: 273 GPGGGILLVVF 283
            P  G+ ++++
Sbjct: 171 APYAGLYVLLY 181

 Score = 35.8 bits (81), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 15/93 (16%)

Query: 200 QTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFR 259
           +T + LI G +GG   +++  PFD++K+R+Q          K    W ++  I      +
Sbjct: 6   KTSSHLIGGFVGGLTSAIVLQPFDLLKTRLQQ--------NKDTTLWGTLKEIRSP---K 54

Query: 260 ALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRT 292
            L++G +P  LR   G  + L      ++ FRT
Sbjct: 55  QLWRGALPSSLRTSIGSALYL----STLNVFRT 83

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 71.2 bits (173), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 69/271 (25%), Positives = 123/271 (45%), Gaps = 24/271 (8%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGP-QYK-GVVDCIKQIVAKEGASRLYKGI 72
           AGA+   +    M P+DVVKTR+QL+      P +Y  G+V   ++IV +EGA+ L  G 
Sbjct: 21  AGAIGCGATHSAMVPIDVVKTRIQLE------PLKYSSGMVGSFRKIVGEEGAAALLTGF 74

Query: 73  SSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAF---VVVPF 129
              +L  + + A KF   + F+K +    G E   Q  + +   SA   E F    + P 
Sbjct: 75  GPTLLGYSMQGAFKFGGYEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFFADIALCPL 134

Query: 130 ELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRA 189
           E  +IRL    +   G +    +I+ +EG+ + YNG    L++   +N   F ++F+  A
Sbjct: 135 EATRIRLVSQPTFANGLVGGFARILKEEGIGSFYNGFTPILFKQIPYNIAKF-VVFEHAA 193

Query: 190 LLPEAKSKSQQTRNDLIAGSIG-------GTIGSLMSTPFDVVKSRIQNTAVVAGGARKY 242
                 + S++  +   A  I        G   +++S P D + S++  T    G     
Sbjct: 194 NAYFGLAGSKENLSTTAATGINLLAGLTAGLAAAVISQPADTLLSKVNKTKKAPG----- 248

Query: 243 NWSWPSIFTIYKEEGFRALYKGFVPKVLRLG 273
             ++  +  + K+ GF   + G   +++ +G
Sbjct: 249 QSTFGLLMQLAKQLGFVGSFAGLPTRLVMVG 279

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 73/181 (40%), Gaps = 21/181 (11%)

Query: 113 LSGASAGCCEAFVVVPFELVKIRLQDVSSSYK-GPIDVVRKIIAQEGVLAMYNGLESTLW 171
           L+GA         +VP ++VK R+Q     Y  G +   RKI+ +EG  A+  G   TL 
Sbjct: 20  LAGAIGCGATHSAMVPIDVVKTRIQLEPLKYSSGMVGSFRKIVGEEGAAALLTGFGPTLL 79

Query: 172 RHGVWNAGYFG--IIFQVRALLPEAKSKSQQTRNDLIAGS--IGGTIGSLMSTPFDVVKS 227
            + +  A  FG   +F+   +       + Q R  +  GS  I      +   P +  + 
Sbjct: 80  GYSMQGAFKFGGYEVFKKAFVDALGYETACQYRTPIYIGSAAIAEFFADIALCPLEATRI 139

Query: 228 RIQN-----TAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVV 282
           R+ +       +V G AR           I KEEG  + Y GF P + +  P      VV
Sbjct: 140 RLVSQPTFANGLVGGFAR-----------ILKEEGIGSFYNGFTPILFKQIPYNIAKFVV 188

Query: 283 F 283
           F
Sbjct: 189 F 189

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 71.2 bits (173), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 81/276 (29%), Positives = 119/276 (43%), Gaps = 34/276 (12%)

Query: 17  AVAGISEILVMYPLDVVKTR-MQLQVSGGLGPQYKGVV--DCIKQIVAKEGASRLYKGIS 73
           A AGI EI V +P+D +  R M          Q   V+  D   + + +   S L+ G+ 
Sbjct: 18  ASAGILEIGVFHPVDTISKRLMSNHTKIASTSQLNSVIFRDFASEPLGRRLLS-LFPGLG 76

Query: 74  SPVLMEAPKRATKFA--------CNDEFQKIYKREFGVEKLTQSL-SILSGASAGCCEAF 124
                +  +R  K+          N  F+  + + FG EK  ++L S  +G+  G  E  
Sbjct: 77  YAAAYKILQRVYKYGGQPFANEFLNKNFKGDFDQAFG-EKTGKALRSATAGSLIGIGE-I 134

Query: 125 VVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGII 184
           V++P +++KI+ Q    S+KG      KII  EG   +Y G   T  R+   +   FG  
Sbjct: 135 VLLPLDVLKIKRQTNPESFKG--RGFLKIIKDEG-FGLYRGWGWTAARNAPGSFALFGGN 191

Query: 185 FQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLM-STPFDVVKSRIQNTAVVAGGARKYN 243
              +  +   K   Q T +     SI G   SL+ S P DV+K+RIQN           N
Sbjct: 192 AFAKEYILGLKDYGQATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNR----------N 241

Query: 244 WSWPS-----IFTIYKEEGFRALYKGFVPKVLRLGP 274
           +  P      I    K EGF A +KG  PK+L  GP
Sbjct: 242 FDNPESGFKIIKNTLKNEGFTAFFKGLTPKLLTTGP 277

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 4/78 (5%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKG 71
            F +  V   + ++V  PLDV+KTR+Q +        +K     IK  +  EG +  +KG
Sbjct: 212 NFVSSIVGASASLIVSAPLDVIKTRIQNRNFDNPESGFK----IIKNTLKNEGFTAFFKG 267

Query: 72  ISSPVLMEAPKRATKFAC 89
           ++  +L   PK    FA 
Sbjct: 268 LTPKLLTTGPKLVFSFAL 285

>Scas_702.10
          Length = 302

 Score = 70.9 bits (172), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 74/288 (25%), Positives = 126/288 (43%), Gaps = 31/288 (10%)

Query: 1   MTDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVV-DCIKQI 59
           MTD+      Y +  G  AGI   ++ +PLD+ K R+Q        P  K  +   +  I
Sbjct: 1   MTDSPTKQIKYPWWYGGAAGIFACVMTHPLDLAKVRLQ------AAPLPKPTLGRMLTTI 54

Query: 60  VAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSL--SILSGAS 117
           +  E    LY G+S+ VL +      +F   D  ++    +  +  +   L  S+ SGA 
Sbjct: 55  LRNENVMGLYSGLSAAVLRQCTYTTVRFGAYDLMKENLIPQGHINDMVYLLPCSMFSGAI 114

Query: 118 AGCCEAFVVVPFELVKIRLQDVSS-------SYKGPIDVVRKIIAQE-GVLAMYNGLEST 169
            G    F     ++V IR+Q+ S+       +Y+  ID V KI   E G+  +  G +  
Sbjct: 115 GGLVGNFA----DVVNIRMQNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPN 170

Query: 170 LWRHGVWNAGYFGIIFQV--RALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKS 227
           + R GV       + + V    L+ +     ++    L A  + G + + + +P DV+K+
Sbjct: 171 MVR-GVLMTASQVVTYDVFKNYLVTKLSFDPKKNSTHLSASLLAGLVATTICSPADVIKT 229

Query: 228 RIQNTAVVAGGARKYNWSWPSIFT-IYKEEGFRALYKGFVPKVLRLGP 274
           RI N        +  + S   I T   K+EG   +++G++P   RLGP
Sbjct: 230 RIMN------AHKTESESAIKILTSAIKKEGPSFMFRGWLPIFTRLGP 271

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 71.2 bits (173), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 74/307 (24%), Positives = 123/307 (40%), Gaps = 61/307 (19%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQL------QVSGGLGPQYKGVVDCIKQIVAKEGASRL 68
           AG +AG     ++ PLD +K   Q       Q +G +G    G+V   K I+A +G    
Sbjct: 25  AGGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGSMG----GLVRASKYIMAHDGPRGF 80

Query: 69  YKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVP 128
           ++G S+ +L   P  A KF   ++ + +    +  E   + L  LSG+ AG C  FV  P
Sbjct: 81  FQGHSATLLRIFPYAAIKFIAYEQIRSVVIPTWRHESHWRRL--LSGSLAGLCSVFVTYP 138

Query: 129 FELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRH-------GVWNAGYF 181
            +LV++RL  V+  +      VRKI+A      +YN   S   R          W+  Y 
Sbjct: 139 LDLVRVRLAYVTERHDAK---VRKIMA-----CIYNERPSEALRKWYIPQWFAHWSNFYR 190

Query: 182 GIIFQVRALLPEA----------------------------------KSKSQQTRNDLIA 207
           G    V  ++P A                                  ++   +T   L+A
Sbjct: 191 GYTPTVIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDRTVPLKTWAQLVA 250

Query: 208 GSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVP 267
           G + G      + PF++++ R+Q +A+     R +         IY E G+R  + G   
Sbjct: 251 GGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIYTEGGWRGFFVGLSI 310

Query: 268 KVLRLGP 274
             +++ P
Sbjct: 311 GYIKVTP 317

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 84/202 (41%), Gaps = 30/202 (14%)

Query: 113 LSGASAGCCEAFVVVPFELVKIRLQ-------DVSSSYKGPIDVVRKIIAQEGVLAMYNG 165
           L+G  AG C   +V P + +KI  Q         + S  G +   + I+A +G    + G
Sbjct: 24  LAGGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPRGFFQG 83

Query: 166 LESTLWRHGVWNAGYFGIIFQVRAL-LPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDV 224
             +TL R   + A  F    Q+R++ +P  + +S   R  L++GS+ G     ++ P D+
Sbjct: 84  HSATLLRIFPYAAIKFIAYEQIRSVVIPTWRHESHWRR--LLSGSLAGLCSVFVTYPLDL 141

Query: 225 VKSRI------QNTAVVAGGARKYN---------WSWPSIFTIYKEEGFRALYKGFVPKV 269
           V+ R+       +  V    A  YN         W  P  F  +        Y+G+ P V
Sbjct: 142 VRVRLAYVTERHDAKVRKIMACIYNERPSEALRKWYIPQWFAHWSN-----FYRGYTPTV 196

Query: 270 LRLGPGGGILLVVFTGCMDFFR 291
           + + P  G+       C D FR
Sbjct: 197 IGMIPYAGVSFFAHDLCQDIFR 218

 Score = 34.7 bits (78), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 41/85 (48%), Gaps = 5/85 (5%)

Query: 6   PLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVV--DCIKQIVAKE 63
           PL  + Q  AG +AG++     YP ++++ R  LQVS    P  +  V  + I +I+  E
Sbjct: 241 PLKTWAQLVAGGLAGMASQTAAYPFEIIRRR--LQVSAITDPTRRHFVGINEIAKIIYTE 298

Query: 64  GASR-LYKGISSPVLMEAPKRATKF 87
           G  R  + G+S   +   P  A  F
Sbjct: 299 GGWRGFFVGLSIGYIKVTPMVACSF 323

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 70.9 bits (172), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 67/300 (22%), Positives = 122/300 (40%), Gaps = 27/300 (9%)

Query: 8   PFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASR 67
           P   +  +G  AG    +  +PLD+VK R+QL  +    PQ  G  D +K+IV       
Sbjct: 7   PVQKEMISGLTAGTITTVSTHPLDLVKVRLQLLATNK-KPQ--GYYDVVKRIVKDSKQHS 63

Query: 68  L----YKGISSPVL------------MEAPKRATKFACNDEFQKIYKREFGVEKLTQSLS 111
                Y+G+   +L              A K      CN + ++        +++T  + 
Sbjct: 64  FFRETYRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLMY 123

Query: 112 ILSGASAGCCEAFVVVPFELVKIRLQDVS----SSYKGPIDVVRKIIAQEGVLAMYNGLE 167
           +L+ A +G   + +  P  ++K R+   S     SY+  +D ++K+   EG+   + GL 
Sbjct: 124 LLAAAMSGVATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGIKKLYRIEGLAGFWRGLV 183

Query: 168 STLW---RHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDV 224
            +L+   +  ++   Y  + +   A     K K       +   S+   +      P  +
Sbjct: 184 PSLFGVSQGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLSKMVSVTAVYPLQL 243

Query: 225 VKSRIQNTAV-VAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
           +KS +Q+  V      +  +  W  I TIY  +G   LYKG +  ++R  P   I   V+
Sbjct: 244 LKSNLQSFEVSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANLIRAVPSTCITFCVY 303

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 80/183 (43%), Gaps = 14/183 (7%)

Query: 1   MTDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIV 60
           M + + +       A A++G++  ++  P+ V+KTR+ +  S      Y+  VD IK++ 
Sbjct: 112 MNNDKEMTSLMYLLAAAMSGVATSVLTNPIWVIKTRI-MSTSFVDSRSYRSTVDGIKKLY 170

Query: 61  AKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGC 120
             EG +  ++G+  P L    + A  F   D  +  Y     V+K  + LS L   +   
Sbjct: 171 RIEGLAGFWRGL-VPSLFGVSQGAIYFTVYDTLKYHYFAAKHVDK-KKKLSNLEYITITS 228

Query: 121 CEAFV----VVPFELVKIRLQDVS-SSYKGP------IDVVRKIIAQEGVLAMYNGLEST 169
               V    V P +L+K  LQ    S+   P        ++  I  ++GV  +Y GL + 
Sbjct: 229 LSKMVSVTAVYPLQLLKSNLQSFEVSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLAN 288

Query: 170 LWR 172
           L R
Sbjct: 289 LIR 291

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 70.1 bits (170), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 129/295 (43%), Gaps = 41/295 (13%)

Query: 9   FFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQ--YKGVVDCIKQIVAKEGAS 66
           F     +GA AG S  +V +P+D +KTR  LQ  GG      Y+G+              
Sbjct: 5   FLASLVSGAAAGTSTDVVFFPIDTLKTR--LQAKGGFFHNGGYRGI-------------- 48

Query: 67  RLYKGISSPVLMEAPKRATKFACNDEFQK----IYKREFGVEKLTQSLSILSGASAGCCE 122
             Y+G+ S V+  AP  +  F   D  ++    +  R    E+L + L+ +  +S G   
Sbjct: 49  --YRGLGSAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMS 106

Query: 123 AFVV-VPFELVKIRLQ--DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAG 179
           A +V VP E++K R Q    +SS +    ++R    +  V  +Y G  +T+ R   +   
Sbjct: 107 ACLVRVPAEVIKQRTQTHHTNSSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREIPFTCI 166

Query: 180 YFGII-FQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRI---QNTAVV 235
            F +  +  +     A+ +        + GS+ G I +  +TP DV+K+R+   +    +
Sbjct: 167 QFPLYEYLKKKWAAYAEIERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMMLHERRVPM 226

Query: 236 AGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFF 290
              AR          T+++EEG R  ++G  P+ + +  GG I L V+      F
Sbjct: 227 LHLAR----------TLFREEGARVFFRGIGPRTMWISAGGAIFLGVYEAVHSLF 271

>Scas_697.47
          Length = 328

 Score = 70.1 bits (170), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 75/285 (26%), Positives = 119/285 (41%), Gaps = 38/285 (13%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGA------ 65
              AG V G+  +L  +P D++K R Q   SG    Q    +  IK I+    A      
Sbjct: 39  SLVAGGVGGVCAVLTGHPFDLIKVRCQ---SG----QASSTIHAIKIILKDARAIPTSNM 91

Query: 66  -----SRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGC 120
                   YKG+  P+L   P  A  F   D  +KI  R    +  +  L++   A+AG 
Sbjct: 92  LVNSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTRS---DSSSAQLTMGQMAAAGF 148

Query: 121 CEA----FVVVPFELVKIRLQDVSSSYKGP-IDVVRKIIAQEGVLAMYNGLESTLWRHGV 175
             A     V  P E +K+ LQ   ++ K   I   + I+   GV +++ G  +TL R G 
Sbjct: 149 ISAIPTTLVTAPTERIKVVLQTAGANSKTSFIGAAKNIVKDGGVKSLFKGSLATLARDGP 208

Query: 176 WNAGYFGI------IFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRI 229
            +A YF            R    E+K+      N  +AG I G    L+  P D +K+++
Sbjct: 209 GSALYFASYEISKKFLNDRNATAESKTGEVNIANVCLAGGIAGMSMWLVVFPIDTIKTKL 268

Query: 230 QNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGP 274
           Q+++    G++    +   I+   K  G +  + G  P +LR  P
Sbjct: 269 QSSS----GSQSMVAATREIYV--KRGGIKGFFPGLGPALLRSFP 307

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 44/86 (51%), Gaps = 7/86 (8%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASR-LYKGIS 73
           AG +AG+S  LV++P+D +KT+  LQ S G     + +V   ++I  K G  +  + G+ 
Sbjct: 246 AGGIAGMSMWLVVFPIDTIKTK--LQSSSG----SQSMVAATREIYVKRGGIKGFFPGLG 299

Query: 74  SPVLMEAPKRATKFACNDEFQKIYKR 99
             +L   P  A  F   +    ++K+
Sbjct: 300 PALLRSFPANAATFLGVELTHSLFKK 325

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 39/181 (21%), Positives = 73/181 (40%), Gaps = 20/181 (11%)

Query: 111 SILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLEST- 169
           S+++G   G C      PF+L+K+R Q  S      I  ++ I+     +   N L ++ 
Sbjct: 39  SLVAGGVGGVCAVLTGHPFDLIKVRCQ--SGQASSTIHAIKIILKDARAIPTSNMLVNSV 96

Query: 170 -----------LWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDL-IAGSIGGTIGSL 217
                      L    ++   ++G     + +     S +Q T   +  AG I     +L
Sbjct: 97  KGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTRSDSSSAQLTMGQMAAAGFISAIPTTL 156

Query: 218 MSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGG 277
           ++ P + +K  +Q       GA        +   I K+ G ++L+KG +  + R GPG  
Sbjct: 157 VTAPTERIKVVLQT-----AGANSKTSFIGAAKNIVKDGGVKSLFKGSLATLARDGPGSA 211

Query: 278 I 278
           +
Sbjct: 212 L 212

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 69.3 bits (168), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 100/221 (45%), Gaps = 15/221 (6%)

Query: 27  MYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRATK 86
           M P+DVVKTR+QL+ +       KG+V   KQI++ EGA  L  G    +L  + + + K
Sbjct: 31  MVPIDVVKTRIQLEPT----VYNKGMVSSFKQIISSEGAGALLTGFGPTLLGYSLQGSFK 86

Query: 87  FACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAF---VVVPFELVKIRLQDVSSSY 143
           F   + F+K+     G +      + +   SA   E F    + P E  +IRL    +  
Sbjct: 87  FGGYELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIALCPLEATRIRLVSQPTFA 146

Query: 144 KGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALL-------PEAKS 196
            G      +I+ +EGV + YNG    L++   +N   F  +F+  A          E  S
Sbjct: 147 NGLFGGFSRILKEEGVGSFYNGFTPILFKQIPYNIAKF-FVFEHAANAYFGLAGPKETMS 205

Query: 197 KSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAG 237
           ++  T  +L AG   G   +++S P D + S++  T    G
Sbjct: 206 ETTHTAINLAAGLTAGLAAAVVSQPADTLLSKVNKTKKAPG 246

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 67/154 (43%), Gaps = 11/154 (7%)

Query: 126 VVPFELVKIRLQDVSSSY-KGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFG-- 182
           +VP ++VK R+Q   + Y KG +   ++II+ EG  A+  G   TL  + +  +  FG  
Sbjct: 31  MVPIDVVKTRIQLEPTVYNKGMVSSFKQIISSEGAGALLTGFGPTLLGYSLQGSFKFGGY 90

Query: 183 IIFQVRALLPEAKSKSQQTRNDLIAGS--IGGTIGSLMSTPFDVVKSRIQNTAVVAGGAR 240
            +F+  A+       +   +N +  GS  I      +   P +  + R+ +    A G  
Sbjct: 91  ELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIALCPLEATRIRLVSQPTFANGL- 149

Query: 241 KYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGP 274
                +     I KEEG  + Y GF P + +  P
Sbjct: 150 -----FGGFSRILKEEGVGSFYNGFTPILFKQIP 178

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 31/66 (46%), Gaps = 7/66 (10%)

Query: 206 IAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIF-TIYKEEGFRALYKG 264
           +AG+IG  I      P DVVK+RIQ    V      YN    S F  I   EG  AL  G
Sbjct: 18  LAGAIGCGITHSSMVPIDVVKTRIQLEPTV------YNKGMVSSFKQIISSEGAGALLTG 71

Query: 265 FVPKVL 270
           F P +L
Sbjct: 72  FGPTLL 77

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 69.3 bits (168), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 77/305 (25%), Positives = 126/305 (41%), Gaps = 46/305 (15%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASR------- 67
           AG V G+  +L  +P D++K R Q         Q K  +D +  I+ KE  S        
Sbjct: 27  AGGVGGVCAVLTGHPFDLIKVRCQSN-------QAKSTMDAV-SIILKEARSLSTVNGSL 78

Query: 68  ------------LYKGISSPVLMEAPKRATKFACNDEFQKIYK-REFGVEKLTQSLSILS 114
                        YKG+  P++   P  A  F   D  +++   ++     LT +    +
Sbjct: 79  TTSLFFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRLVTWKQASDAPLTTAQMATA 138

Query: 115 GASAGCCEAFVVVPFELVKIRLQDVSSSYKGP-IDVVRKIIAQEGVLAMYNGLESTLWRH 173
           G  +      V  P E +K+ LQ  +S +KG  I   + I++  GV +++NG  +TL R 
Sbjct: 139 GFISAIPTTLVTAPTERIKVVLQ-TNSEFKGSFIKAAKHIVSTGGVKSLFNGSLATLARD 197

Query: 174 GVWNAGYFGIIFQVRALLPEAKSKSQQTRNDL----IAGSIGGTIGSLMSTPFDVVKSRI 229
           G  +A YF      +A L ++ +K  +   +L    +AG I G    L+  P D +K+R+
Sbjct: 198 GPGSALYFASYELSKAFLNKSVAKKDKDEVNLANVCLAGGIAGMSMWLVVFPIDTIKTRL 257

Query: 230 Q--NTAVVAGGARKYNWSWPSIFTIYKEE-GFRALYKGFVPKVLRLGPGGGILLVVFTGC 286
           Q   T +    A K          IY +  G +  + G  P +LR  P      +     
Sbjct: 258 QVATTPISMVQATK---------DIYIQRGGIKGFFPGLGPALLRSFPANAATFLGVELT 308

Query: 287 MDFFR 291
             FF+
Sbjct: 309 HAFFK 313

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 76/191 (39%), Gaps = 34/191 (17%)

Query: 111 SILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNG-LEST 169
           ++++G   G C      PF+L+K+R Q  S+  K  +D V  I+ +   L+  NG L ++
Sbjct: 24  ALVAGGVGGVCAVLTGHPFDLIKVRCQ--SNQAKSTMDAVSIILKEARSLSTVNGSLTTS 81

Query: 170 LWRHGVWNAGYFGIIFQVRALLP-------------------EAKSKSQQTRNDLIAGSI 210
           L+        Y G+I  +  + P                   +A      T     AG I
Sbjct: 82  LFFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRLVTWKQASDAPLTTAQMATAGFI 141

Query: 211 GGTIGSLMSTPFDVVKSRIQNTAVVAGG---ARKYNWSWPSIFTIYKEEGFRALYKGFVP 267
                +L++ P + +K  +Q  +   G    A K+         I    G ++L+ G + 
Sbjct: 142 SAIPTTLVTAPTERIKVVLQTNSEFKGSFIKAAKH---------IVSTGGVKSLFNGSLA 192

Query: 268 KVLRLGPGGGI 278
            + R GPG  +
Sbjct: 193 TLARDGPGSAL 203

 Score = 34.7 bits (78), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 41/86 (47%), Gaps = 10/86 (11%)

Query: 199 QQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNT---------AVVAGGARKYNWSWPSI 249
           ++    L+AG +GG    L   PFD++K R Q+          +++   AR  +    S+
Sbjct: 19  RENMKALVAGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAVSIILKEARSLSTVNGSL 78

Query: 250 FT-IYKEEGFRALYKGFVPKVLRLGP 274
            T ++ +   +  YKG +P ++ + P
Sbjct: 79  TTSLFFKNSVKGFYKGVIPPLIGVTP 104

>Kwal_0.232
          Length = 274

 Score = 68.6 bits (166), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 75/292 (25%), Positives = 119/292 (40%), Gaps = 48/292 (16%)

Query: 9   FFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRL 68
           F     AGA AG S  L  +P+D +KTR  LQ +GG                A  G   +
Sbjct: 6   FITSLLAGAAAGTSTDLFFFPIDTLKTR--LQAAGGF--------------FANGGYLGV 49

Query: 69  YKGISSPVLMEAPKRATKFACNDEFQKIYKREFG---------VEKLTQSLSILSGASAG 119
           Y+G+ S V+  AP  +  F   D  +   +  F           E  T   S  +G  A 
Sbjct: 50  YRGLGSAVVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSSSAGEIAA 109

Query: 120 CCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEG----VLAMYNGLESTLWRHGV 175
           C    V VP E++K R Q   S     +  ++K++  E        +Y G  +T+ R   
Sbjct: 110 C---MVRVPAEVIKQRTQTHKS--DSSLQTLKKLLQNENGEGIRRNLYRGWSTTVMREIP 164

Query: 176 WNAGYFGIIFQVRALLPEAKSKSQ-QTRNDLIAGSIGGTIGSLMSTPFDVVKSR--IQNT 232
           +    F +   ++     +  + Q         G + G I +  +TP DV+K+R  + +T
Sbjct: 165 FTCIQFPLYEFLKKQWAISGGREQVAPWQGAFCGCVAGGIAAATTTPLDVLKTRLMLSHT 224

Query: 233 AV-VAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
           +V V   AR+          IY  EG++  + G  P+ + +  GG I L V+
Sbjct: 225 SVPVLHLARQ----------IYATEGWKVFFSGVGPRTVWISAGGAIFLGVY 266

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 68.9 bits (167), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 65/297 (21%), Positives = 125/297 (42%), Gaps = 33/297 (11%)

Query: 16  GAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQI--------VAKEGASR 67
           G   G+S  + + PLD++KTR Q Q  GG   Q    +D   Q+        +     S 
Sbjct: 11  GFAGGLSSAVALQPLDLLKTRFQ-QTKGGTLWQTVKSLDTPWQLWRGTLPSAIRTSVGSA 69

Query: 68  LYKGISSPVLME-APKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVV 126
           LY  +SS  LM  A  +  +F   D    +  +   + +L+   ++++GA A     ++ 
Sbjct: 70  LY--LSSLNLMRTALAKRKQFDTADSV--VTGKSSNLPQLSMYENLVTGAFARGTVGYIT 125

Query: 127 VPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQ 186
           +P  ++K+R +    +YK   +  + I AQEG+   + G   T  R   ++  Y  +  +
Sbjct: 126 MPITIIKVRYESTLYNYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSGLYVLLYEK 185

Query: 187 VRALLPEAKSKS-------------QQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTA 233
           ++  LP    KS               T  +  +  +  ++ + ++ PFD +K+R+Q   
Sbjct: 186 LKHTLPTILPKSLLQLDSEGRYTAYTSTAINSTSAILSASMATTVTAPFDTIKTRMQLEP 245

Query: 234 VVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFF 290
                  K+   W ++ TI  +E    ++ G   ++ R     GI   ++   +  F
Sbjct: 246 T------KFKTFWSTLTTIVTQEHPIKIFSGLSMRLTRKALSAGIAWGIYEELIKHF 296

>Kwal_26.7972
          Length = 358

 Score = 69.3 bits (168), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 69/310 (22%), Positives = 120/310 (38%), Gaps = 61/310 (19%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQY-------KGVVDCIKQIVAKEGASR 67
           AG +AG     ++ PLD +K   Q        P Y        G++     I A +G   
Sbjct: 33  AGGIAGSCAKTLIAPLDRIKILFQTS-----NPHYLKYSGSTMGLIRAGAHINAHDGIRG 87

Query: 68  LYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGV---EKLTQSLSILSGASAGCCEAF 124
            Y+G S+ ++   P  A KF   ++      R F +   E  T +  + SG+ AG C  F
Sbjct: 88  FYQGHSATLIRIFPYAAIKFIAYEQI-----RHFMIPSKEYETHARRLASGSMAGLCSVF 142

Query: 125 VVVPFELVKIRLQDVSSSYK-GPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGI 183
           +  P +L+++RL  V+   +   + V+++I  +    ++ +      W    W   Y G 
Sbjct: 143 MTYPLDLIRVRLAYVTDRSRIKMLPVIKQIYTERASESLTSKSYVPRW-FAHWCNFYRGF 201

Query: 184 IFQVRALLPEA----------------------------------KSKSQQTR-----ND 204
              V  ++P A                                  +SK Q +R      +
Sbjct: 202 TPTVLGMIPYAGVSFFAHDLCGDILRSGALSPYSVLPISDEELTIRSKKQSSRPLKTWAE 261

Query: 205 LIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKG 264
           L+AG + G      S PF++++ R+Q + V       +      I  IYKE G+R  + G
Sbjct: 262 LVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDMIRIIYKERGWRGFFVG 321

Query: 265 FVPKVLRLGP 274
                +++ P
Sbjct: 322 LSIGYIKVTP 331

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 80/203 (39%), Gaps = 29/203 (14%)

Query: 113 LSGASAGCCEAFVVVPFELVKIRLQDVSSSY-------KGPIDVVRKIIAQEGVLAMYNG 165
           L+G  AG C   ++ P + +KI  Q  +  Y        G I     I A +G+   Y G
Sbjct: 32  LAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFYQG 91

Query: 166 LESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVV 225
             +TL R   + A  F    Q+R  +  +K      R  L +GS+ G     M+ P D++
Sbjct: 92  HSATLIRIFPYAAIKFIAYEQIRHFMIPSKEYETHARR-LASGSMAGLCSVFMTYPLDLI 150

Query: 226 KSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRAL----------------YKGFVPKV 269
           + R+   A V   +R      P I  IY E    +L                Y+GF P V
Sbjct: 151 RVRL---AYVTDRSRIKML--PVIKQIYTERASESLTSKSYVPRWFAHWCNFYRGFTPTV 205

Query: 270 LRLGPGGGILLVVFTGCMDFFRT 292
           L + P  G+       C D  R+
Sbjct: 206 LGMIPYAGVSFFAHDLCGDILRS 228

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 41/86 (47%), Gaps = 1/86 (1%)

Query: 3   DARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLG-PQYKGVVDCIKQIVA 61
            +RPL  + +  AG +AG++     YP ++++ R+Q+ V        ++ + D I+ I  
Sbjct: 252 SSRPLKTWAELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDMIRIIYK 311

Query: 62  KEGASRLYKGISSPVLMEAPKRATKF 87
           + G    + G+S   +   P  A  F
Sbjct: 312 ERGWRGFFVGLSIGYIKVTPMVACSF 337

 Score = 35.8 bits (81), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 42/200 (21%), Positives = 74/200 (37%), Gaps = 49/200 (24%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRL--- 68
           + A+G++AG+  + + YPLD+++ R+              ++  IKQI  +  +  L   
Sbjct: 129 RLASGSMAGLCSVFMTYPLDLIRVRLAYVTDRSR----IKMLPVIKQIYTERASESLTSK 184

Query: 69  -------------YKGISSPVLMEAPKRATKFACND--------------EFQKIYKREF 101
                        Y+G +  VL   P     F  +D                  I   E 
Sbjct: 185 SYVPRWFAHWCNFYRGFTPTVLGMIPYAGVSFFAHDLCGDILRSGALSPYSVLPISDEEL 244

Query: 102 GVEKLTQS-------LSILSGASAGCCEAFVVVPFELVKIRLQDVS-------SSYKGPI 147
            +    QS         +++G  AG        PFE+++ RLQ VS        +++   
Sbjct: 245 TIRSKKQSSRPLKTWAELVAGGLAGMASQTASYPFEIIRRRLQ-VSVVSPTSIHNFQTIP 303

Query: 148 DVVRKIIAQEGVLAMYNGLE 167
           D++R I  + G    + GL 
Sbjct: 304 DMIRIIYKERGWRGFFVGLS 323

>Kwal_23.5757
          Length = 307

 Score = 68.6 bits (166), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 114/258 (44%), Gaps = 25/258 (9%)

Query: 29  PLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRATKFA 88
           PLD+VK R Q+  S      YK  +D  +QIV  EGA++++ G+ +  +  + + A K+ 
Sbjct: 39  PLDLVKCRRQVDAS-----LYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYG 93

Query: 89  CNDEFQKIYKREFGVEKLTQ---SLSILSGASAGCCEAFVVVPFELVKIRLQDVSSS--Y 143
             + F+  Y +    E        + + + ASA       + P+E +K+R Q        
Sbjct: 94  GYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVPPPFA 153

Query: 144 KGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFG----IIFQVRALLPEAK---S 196
           +   D   K++  EG  ++Y G+    +R   +    F     I+  + A LP  K   S
Sbjct: 154 RNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMS 213

Query: 197 KSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWS-WPSIFTIYKE 255
           +  Q       G + G + +++S P DV+ S++ N        RK   S   +   IY +
Sbjct: 214 QLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNE-------RKSGESTLQATSRIYGK 266

Query: 256 EGFRALYKGFVPKVLRLG 273
            GF  L+ G   ++L +G
Sbjct: 267 IGFPGLWNGLAVRILMIG 284

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 71/157 (45%), Gaps = 16/157 (10%)

Query: 126 VVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNA----GYF 181
           V P +LVK R Q  +S YK  +D  R+I+  EG   ++ G+ +T   + +  A    GY 
Sbjct: 37  VTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGAFKYGGYE 96

Query: 182 GIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARK 241
               Q   L+    + S +T   L A +    I  +   P++ +K R Q TAV    AR 
Sbjct: 97  FFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVR-QQTAVPPPFAR- 154

Query: 242 YNWSWPSIFTIYKE----EGFRALYKGFVPKVLRLGP 274
                 ++F  Y +    EGF +LYKG  P   R  P
Sbjct: 155 ------NVFDAYSKMVGAEGFASLYKGITPLWFRQIP 185

 Score = 28.5 bits (62), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 39/82 (47%), Gaps = 5/82 (6%)

Query: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGI 72
           FA G +AGI   +V +P DV+ +++  +   G     +  +    +I  K G   L+ G+
Sbjct: 222 FAGGYLAGILCAVVSHPADVMVSKVNNERKSG-----ESTLQATSRIYGKIGFPGLWNGL 276

Query: 73  SSPVLMEAPKRATKFACNDEFQ 94
           +  +LM     + ++   D F+
Sbjct: 277 AVRILMIGTLTSFQWLIYDSFK 298

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 68.6 bits (166), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 80/280 (28%), Positives = 123/280 (43%), Gaps = 42/280 (15%)

Query: 17  AVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASR--------L 68
           A AGI EI V +P+D +  R+    +     Q       +  +V +E AS+        L
Sbjct: 17  ASAGILEIGVFHPVDTISKRLMSNHTKITNAQ------QLNDVVFREHASKPFGQRLFTL 70

Query: 69  YKGISSPVLMEAPKRATKFA--------CNDEFQKIYKREFGVEKLTQSL-SILSGASAG 119
           + G+      +  +R  K+          N  F+  +   FG EK  ++L S  +G+  G
Sbjct: 71  FPGLGYAATYKIFQRVYKYGGQPFANEFLNKHFKADFDGAFG-EKTGKALRSATAGSLIG 129

Query: 120 CCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAG 179
             E  V++P +++KI+ Q    S++G      +I+  EG + +Y G   T  R+   +  
Sbjct: 130 IGE-IVLLPLDVLKIKRQTNPESFRG--RGFLRILRDEG-MGLYRGWGWTAARNAPGSFA 185

Query: 180 YFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLM-STPFDVVKSRIQNTAVVAGG 238
            FG     +  +   K  SQ T       SI G   SL+ S P DV+K+RIQ        
Sbjct: 186 LFGGNAFAKEYILGLKDYSQATWGQNFVSSIFGASASLIVSAPLDVIKTRIQ-------- 237

Query: 239 ARKYNWSWPSIFTI----YKEEGFRALYKGFVPKVLRLGP 274
           +R +  S  S FTI     K EG  A +KG  PK+L  GP
Sbjct: 238 SRNFE-SAESGFTIVKNTLKNEGATAFFKGLTPKLLTTGP 276

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 36/78 (46%), Gaps = 4/78 (5%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKG 71
            F +      + ++V  PLDV+KTR+Q   S        G    +K  +  EGA+  +KG
Sbjct: 211 NFVSSIFGASASLIVSAPLDVIKTRIQ---SRNFESAESGFT-IVKNTLKNEGATAFFKG 266

Query: 72  ISSPVLMEAPKRATKFAC 89
           ++  +L   PK    FA 
Sbjct: 267 LTPKLLTTGPKLVFSFAI 284

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 68.2 bits (165), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 70/308 (22%), Positives = 124/308 (40%), Gaps = 63/308 (20%)

Query: 25  LVMYPLDVVKTRMQLQVSGGL------------------------GPQYKGVVDCIKQIV 60
           +V  P D+VKTR+Q  +   +                           +K  V  I  + 
Sbjct: 72  VVTCPFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTLQAATHFKETVSIIGNVY 131

Query: 61  AKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGC 120
            +EG   L+KG+   ++   P R+  F      + IY + F   +    + +++ A+AG 
Sbjct: 132 RQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDIYSKAFNNGQEAPWIHLMAAATAGW 191

Query: 121 CEAFVVVPFELVKIRLQ----DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVW 176
             A    P  +VK R+Q      + +YK   D ++ I+  EG+  +Y GL          
Sbjct: 192 ATATATNPIWMVKTRVQLDKAGKTRTYKNSYDCLKSILRNEGIYGLYRGL---------- 241

Query: 177 NAGYFG---------IIFQVRALLPE-------AKSKSQQTRNDLI--------AGSIGG 212
           +A Y G         +  Q++ L+ +       A  +S  T  D I           +  
Sbjct: 242 SASYLGSVEGILQWLLYEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWCQRSGGAGLAK 301

Query: 213 TIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRL 272
            + S+++ P +VV++R++ +  +  G  KY     S   I KEEG  ++Y G  P ++R 
Sbjct: 302 FMASIVTYPHEVVRTRLRQSP-LENGKVKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRT 360

Query: 273 GPGGGILL 280
            P   I+ 
Sbjct: 361 VPNSIIMF 368

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 43/88 (48%), Gaps = 1/88 (1%)

Query: 1   MTDARPLPFFYQFAAGA-VAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQI 59
           MT    +  + Q + GA +A     +V YP +VV+TR++         +Y G+V   + I
Sbjct: 281 MTTTDKIKQWCQRSGGAGLAKFMASIVTYPHEVVRTRLRQSPLENGKVKYTGLVQSFRVI 340

Query: 60  VAKEGASRLYKGISSPVLMEAPKRATKF 87
           + +EG + +Y G++  ++   P     F
Sbjct: 341 IKEEGLASMYSGLTPHLMRTVPNSIIMF 368

 Score = 35.8 bits (81), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 41/97 (42%), Gaps = 23/97 (23%)

Query: 217 LMSTPFDVVKSRIQ-----NTAVVAGGARKYNWSWPSIFT------------------IY 253
           +++ PFD+VK+R+Q     N       A   N + P I                    +Y
Sbjct: 72  VVTCPFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTLQAATHFKETVSIIGNVY 131

Query: 254 KEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFF 290
           ++EGFR+L+KG  P ++ + P   I    +    D +
Sbjct: 132 RQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDIY 168

>Scas_662.12
          Length = 308

 Score = 67.8 bits (164), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 63/298 (21%), Positives = 126/298 (42%), Gaps = 24/298 (8%)

Query: 8   PFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIV--AKEGA 65
           P   +  +G  AG    L+++PLD++K R+QL  +       KG    I +++  +K+  
Sbjct: 6   PIQKEIISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKMG 65

Query: 66  SR---------LYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGA 116
           S+          Y+G+   +L  A   +  F   +  +    +   +     ++ + SG 
Sbjct: 66  SQGPIYNLIKESYRGLPINLLGNAVAWSLYFTIYNSTKDYMFQNNYLHNNNTTIFLTSGL 125

Query: 117 SAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRK----IIAQEGVLAMYNGLESTLWR 172
            +G     +  P  ++K R+   S  +K     +R     ++ +EG  A++ GL  +L  
Sbjct: 126 ISGISTTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKSLLTKEGPKAIWMGLLPSLL- 184

Query: 173 HGVWNAGYFGIIFQVRAL---LPEAKSKSQQTRNDL---IAGSIGGTIGSLMSTPFDVVK 226
            GV     + +I+    L   +   KSK      +L   +  S+   +  +   PF ++K
Sbjct: 185 -GVSQGAIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLSVMSVYPFQLLK 243

Query: 227 SRIQNTAVVAGGARKYNWSWPSIF-TIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
           S +Q    V     + ++ + ++   IY++ G + LYKG    +LR  P   I   ++
Sbjct: 244 SNLQTFRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAIPSTCITFCIY 301

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/81 (20%), Positives = 38/81 (46%), Gaps = 2/81 (2%)

Query: 16  GAVAGISEILVMYPLDVVKTRMQL--QVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGIS 73
            +++ +  ++ +YP  ++K+ +Q    V+  +       +  I++I    G   LYKG+S
Sbjct: 225 SSLSKMLSVMSVYPFQLLKSNLQTFRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLS 284

Query: 74  SPVLMEAPKRATKFACNDEFQ 94
           + +L   P     F   + F+
Sbjct: 285 ANLLRAIPSTCITFCIYENFK 305

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 67.4 bits (163), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 76/310 (24%), Positives = 127/310 (40%), Gaps = 65/310 (20%)

Query: 25  LVMYPLDVVKTRMQ------------LQVSGG------------LGPQYKGVVDCIKQIV 60
           +V  P D+VKTR+Q            + +S G             G  +K  +  I  + 
Sbjct: 68  VVTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTHFKETLGIIGNVY 127

Query: 61  AKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGC 120
            +EG   L+KG+   ++   P R+  F      + +Y + F   + T  + +++ A+AG 
Sbjct: 128 KQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAKAFNNGQETPMIHLMAAATAGW 187

Query: 121 CEAFVVVPFELVKIRLQ------DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHG 174
             A    P  L+K R+Q           YK   D ++ +I  EG   +Y GL        
Sbjct: 188 ATATATNPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFTGLYKGL-------- 239

Query: 175 VWNAGYFG---------IIFQVRALLPE------------AKSKSQQTRNDLI-AGSIG- 211
             +A Y G         +  Q++ L+ E             KS S++ +     +GS G 
Sbjct: 240 --SASYLGSVEGILQWLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEWCQRSGSAGL 297

Query: 212 -GTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVL 270
              + S+ + P +VV++R++ T     G RKY     S   I KEEG  ++Y G  P ++
Sbjct: 298 AKFVASIATYPHEVVRTRLRQTP-KENGKRKYTGLVQSFKVIIKEEGLFSMYSGLTPHLM 356

Query: 271 RLGPGGGILL 280
           R  P   I+ 
Sbjct: 357 RTVPNSIIMF 366

 Score = 35.0 bits (79), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 42/97 (43%), Gaps = 23/97 (23%)

Query: 217 LMSTPFDVVKSRIQN-----------TAVVAGGAR------------KYNWSWPSIFTIY 253
           +++ PFD+VK+R+Q+             +  G  R             +  +   I  +Y
Sbjct: 68  VVTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTHFKETLGIIGNVY 127

Query: 254 KEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFF 290
           K+EGFR+L+KG  P ++ + P   I    +    D +
Sbjct: 128 KQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMY 164

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 65.1 bits (157), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 79/297 (26%), Positives = 125/297 (42%), Gaps = 43/297 (14%)

Query: 9   FFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQ--YKGVVDCIKQIVAKEGAS 66
           F     +GA AG S  L  +P+D +KTR  LQ  GG      YKGV              
Sbjct: 6   FIASLVSGAAAGTSTDLAFFPIDTLKTR--LQAKGGFFANGGYKGV-------------- 49

Query: 67  RLYKGISSPVLMEAPKRATKFACNDEFQKIYKREF-------GVEKLTQSLSILSGASAG 119
             Y+G+ S V+  AP  +  F   D   K + R         G ++   +LS +  +S G
Sbjct: 50  --YRGLGSAVVASAPSASLFFVAYDSM-KCWSRPVIGQLLPKGEDQTADTLSHMVSSSFG 106

Query: 120 CCEAFVV-VPFELVKIRLQD--VSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVW 176
              A +V VP E++K R Q    +SS +    ++R    +     +Y G  +T+ R   +
Sbjct: 107 EISACMVRVPAEVIKQRTQTHRTNSSLQTLQALLRNENGEGLRRNLYRGWSTTIMREIPF 166

Query: 177 NAGYFGIIFQVRALLPEAKSKSQQTR-NDLIAGSIGGTIGSLMSTPFDVVKSRI--QNTA 233
               F +   ++    E + K +       + G I G I +  +TP DV+K+RI   + +
Sbjct: 167 TCIQFPLYEYMKKRWAEVQGKERAAPWQGSVCGCIAGGIAAAATTPLDVLKTRIMLHHKS 226

Query: 234 VVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFF 290
           V A    K         T+ +EEG +  + G  P+ + +  GG I L V+      F
Sbjct: 227 VSALHLAK---------TMLQEEGVKVFFSGVGPRTMWISAGGAIFLGVYETVHSLF 274

 Score = 28.5 bits (62), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 34/86 (39%), Gaps = 17/86 (19%)

Query: 198 SQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEG 257
           SQ     L++G+  GT   L   P D +K+R+Q      GG              +   G
Sbjct: 3   SQMFIASLVSGAAAGTSTDLAFFPIDTLKTRLQ----AKGG-------------FFANGG 45

Query: 258 FRALYKGFVPKVLRLGPGGGILLVVF 283
           ++ +Y+G    V+   P   +  V +
Sbjct: 46  YKGVYRGLGSAVVASAPSASLFFVAY 71

>Kwal_23.2913
          Length = 320

 Score = 65.5 bits (158), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 122/295 (41%), Gaps = 54/295 (18%)

Query: 10  FYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIV----AKEGA 65
           F   AAG V G+  +L  +P D++K R Q         Q  G +D I +++    +K G 
Sbjct: 29  FESLAAGGVGGVCAVLTGHPFDLLKVRCQSN-------QASGTLDAISRVLHEAKSKSGP 81

Query: 66  SRL------YKGISSPVLMEAPKRATKFACNDEFQK-----------IYKREFGVEKLTQ 108
             L      Y+G+  P+L   P  A  F   D  ++           I      +  LT 
Sbjct: 82  LPLNQIKGFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKLTPLTT 141

Query: 109 SLSILSGASAGCCEAFVVVPFELVKIRLQDVSS-SYKGPIDVVRKIIAQEGVLAMYNGLE 167
           S   L+G  +      +  P E VK+ LQ   S S+ G     R +I + GV +++ G  
Sbjct: 142 SQLALAGFFSAIPTTLITAPTERVKVVLQTSESGSFLG---AARTLIREGGVRSLFQGTL 198

Query: 168 STLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTR-----NDLIAGSIGGTIGSLMSTPF 222
           +TL R G  +A YF      +  L    S++Q T      +  +AG + G    +   P 
Sbjct: 199 ATLARDGPGSALYFASYEVSKRFL----SRNQDTDALSVVSICVAGGVAGMSMWIGVFPI 254

Query: 223 DVVKSRIQNTA---VVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGP 274
           D +K+++Q+++    +   AR+          IY   G R  + G  P ++R  P
Sbjct: 255 DTIKTKLQSSSRSQSMVQAARE----------IYTRAGLRGFFPGLGPALMRSFP 299

>Kwal_27.11626
          Length = 299

 Score = 64.7 bits (156), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 80/276 (28%), Positives = 120/276 (43%), Gaps = 34/276 (12%)

Query: 17  AVAGISEILVMYPLDVVKTR-MQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYK---GI 72
           A AGI EI V +P+D V  R M          Q   V+   ++   +    RL+    G+
Sbjct: 17  ASAGILEIGVFHPVDTVSKRLMSNHTKISSSAQLNSVI--FREHAGEALGKRLFTLFPGL 74

Query: 73  SSPVLMEAPKRATKFA--------CNDEFQKIYKREFGVEKLTQSL-SILSGASAGCCEA 123
                 +  +R  K+          N  F+  +   FG EK  ++L S  +G+  G  E 
Sbjct: 75  GYAASYKILQRVYKYGGQPFANEFLNKNFKADFDNAFG-EKTGKALRSATAGSLIGIGE- 132

Query: 124 FVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGI 183
            V++P +++KI+ Q    S+KG   +  KI+  EG   +Y G   T  R+   +   FG 
Sbjct: 133 IVLLPLDVLKIKRQTNPESFKGRGFI--KILKDEG-FGLYRGWGWTAARNAPGSFALFGG 189

Query: 184 IFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLM-STPFDVVKSRIQNTAVVAGGARKY 242
               +  +   K  S  T +     SI G   SL+ S P DV+K+RIQN        R +
Sbjct: 190 NAFAKEYILGLKDYSSATWSQNFVSSIVGASASLIVSAPLDVIKTRIQN--------RHF 241

Query: 243 NWSWPSIFTI----YKEEGFRALYKGFVPKVLRLGP 274
           + +  S F I     K EG  A +KG  PK+L  GP
Sbjct: 242 D-NPESGFRIVQNTLKNEGITAFFKGLTPKLLTTGP 276

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 4/78 (5%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKG 71
            F +  V   + ++V  PLDV+KTR+Q +        ++ V + +K     EG +  +KG
Sbjct: 211 NFVSSIVGASASLIVSAPLDVIKTRIQNRHFDNPESGFRIVQNTLKN----EGITAFFKG 266

Query: 72  ISSPVLMEAPKRATKFAC 89
           ++  +L   PK    FA 
Sbjct: 267 LTPKLLTTGPKLVFSFAL 284

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 84/321 (26%), Positives = 131/321 (40%), Gaps = 55/321 (17%)

Query: 1   MTDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIV 60
           M D +  P   +  +G  AG    LV++PLD++K R+QL  +      Y G    IK+I+
Sbjct: 1   MVDHQWTPLQKEVISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHY-GPFMVIKEII 59

Query: 61  ---AKEGAS---RLYKGISSPVLMEAPKRATKFACNDEFQK-IYK----------REFGV 103
              A  G S    LY+G+S  +   A      F      ++ IYK          +  G 
Sbjct: 60  RSSANSGRSVTNELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGN 119

Query: 104 EKLTQSLSILS-GASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAM 162
           +    SL  LS GAS+G   A +  P  ++K R+   S   KG         AQ    +M
Sbjct: 120 DHKMNSLIYLSAGASSGLMTAILTNPIWVIKTRIMSTS---KG---------AQGAYTSM 167

Query: 163 YNGLESTLWR---HGVWNA---GYFGI-----IFQVRALLPEAKSKSQQTR--------- 202
           YNG++  L      G+W       FG+      F V   L + K + ++           
Sbjct: 168 YNGVQQLLRTDGFQGLWKGLVPALFGVSQGALYFAVYDTLKQRKLRRKRENGLDIHLTNL 227

Query: 203 NDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALY 262
             +   S+G  +   +  PF ++KS +Q+        +K+   +P I  I   +GF  LY
Sbjct: 228 ETIEITSLGKMVSVTLVYPFQLLKSNLQS---FRANEQKFRL-FPLIKLIIANDGFVGLY 283

Query: 263 KGFVPKVLRLGPGGGILLVVF 283
           KG    ++R  P   I   V+
Sbjct: 284 KGLSANLVRAIPSTCITFCVY 304

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 66/279 (23%), Positives = 119/279 (42%), Gaps = 27/279 (9%)

Query: 29  PLDVVKTRMQLQ--VSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRATK 86
           P++ VKTR+QLQ  +  G+   Y G    +  I   EG   L +G++     +     ++
Sbjct: 31  PIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILLNGSR 90

Query: 87  FACNDEFQKIY-------KREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDV 139
               D  +          +R +G   L  + +  + A      A +  P +LVK R+Q +
Sbjct: 91  LGLYDPLRAALGGCVLSDRRTYGTAALAVNATAGAAAGMI--GAALGSPLQLVKTRMQAL 148

Query: 140 SSSYKGPID--VVRKIIA---QEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLPEA 194
           +     P+   + R+++A     GV  +Y G+++ L R GV +A    +    +    EA
Sbjct: 149 APRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQLAVYSHAK----EA 204

Query: 195 KSKSQQTRNDL--IAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTI 252
            S+       L  +A ++      +   PFDV  +R+ +     GG   Y      +   
Sbjct: 205 LSRHVPDGMALYTLASALSSVAVCIAMNPFDVAMTRMYHHR---GGL--YRGPLDCLCKT 259

Query: 253 YKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFR 291
            ++EGF ALYKG + ++LR+ P   + L +    +   R
Sbjct: 260 VRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVR 298

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 39/68 (57%), Gaps = 4/68 (5%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74
           A A++ ++  + M P DV  TRM     GGL   Y+G +DC+ + V +EG S LYKG  +
Sbjct: 219 ASALSSVAVCIAMNPFDVAMTRM-YHHRGGL---YRGPLDCLCKTVRQEGFSALYKGHLA 274

Query: 75  PVLMEAPK 82
            +L  AP 
Sbjct: 275 QLLRIAPH 282

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 68/284 (23%), Positives = 113/284 (39%), Gaps = 38/284 (13%)

Query: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAK-------EGA 65
           F AG V G+  +   +P D++K R Q   +G        + + IK+   +          
Sbjct: 39  FVAGGVGGVCAVFTGHPFDLIKVRCQ---NGQANSTVHAITNIIKEAKTQVKGTLFTNSV 95

Query: 66  SRLYKGISSPVLMEAPKRATKFACNDEFQKIY---KREFGVEKLTQSLSILSGASAGCCE 122
              YKG+  P+L   P  A  F   D  +K+     ++ G  +LT      +G  +    
Sbjct: 96  KGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQMAAAGFISAIPT 155

Query: 123 AFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFG 182
             V  P E VK+ LQ  +SS    I   + I+ + G+ +++ G  +TL R G  +A YF 
Sbjct: 156 TLVTAPTERVKVVLQ--TSSKGSFIQAAKTIVKEGGIASLFKGSLATLARDGPGSALYFA 213

Query: 183 IIFQVRALLPEAKSKSQQTRND------------LIAGSIGGTIGSLMSTPFDVVKSRIQ 230
                +  L      S+Q R D             +AG I G    L   P D +K+++Q
Sbjct: 214 SYEISKNYL-----NSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKLQ 268

Query: 231 NTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGP 274
            ++       + N    +     +  G +  + G  P +LR  P
Sbjct: 269 ASST------RQNMLSATKEIYLQRGGIKGFFPGLGPALLRSFP 306

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 83/192 (43%), Gaps = 15/192 (7%)

Query: 111 SILSGASAGCCEAFVVVPFELVKIRLQD--VSSSYKGPIDVVRKIIAQ-------EGVLA 161
           S ++G   G C  F   PF+L+K+R Q+   +S+     +++++   Q         V  
Sbjct: 38  SFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEAKTQVKGTLFTNSVKG 97

Query: 162 MYNG-LESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMST 220
            Y G +   L    ++   ++G  + V   L    +K Q   N+L  G +    G + + 
Sbjct: 98  FYKGVIPPLLGVTPIFAVSFWG--YDVGKKLVTFNNK-QGGSNELTMGQMAAA-GFISAI 153

Query: 221 PFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILL 280
           P  +V +  +   VV   + K ++   +  TI KE G  +L+KG +  + R GPG  +  
Sbjct: 154 PTTLVTAPTERVKVVLQTSSKGSFIQAAK-TIVKEGGIASLFKGSLATLARDGPGSALYF 212

Query: 281 VVFTGCMDFFRT 292
             +    ++  +
Sbjct: 213 ASYEISKNYLNS 224

 Score = 35.4 bits (80), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 42/86 (48%), Gaps = 7/86 (8%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASR-LYKGIS 73
           AG +AG+S  L ++P+D +KT++Q   +       + ++   K+I  + G  +  + G+ 
Sbjct: 245 AGGIAGMSMWLAVFPIDTIKTKLQASST------RQNMLSATKEIYLQRGGIKGFFPGLG 298

Query: 74  SPVLMEAPKRATKFACNDEFQKIYKR 99
             +L   P  A  F   +    ++K+
Sbjct: 299 PALLRSFPANAATFLGVEMTHSLFKK 324

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 38/92 (41%), Gaps = 22/92 (23%)

Query: 197 KSQQTRNDL---IAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIY 253
           KS   R ++   +AG +GG        PFD++K R QN         + N +  +I  I 
Sbjct: 28  KSNPVRENIKSFVAGGVGGVCAVFTGHPFDLIKVRCQNG--------QANSTVHAITNII 79

Query: 254 KE-----------EGFRALYKGFVPKVLRLGP 274
           KE              +  YKG +P +L + P
Sbjct: 80  KEAKTQVKGTLFTNSVKGFYKGVIPPLLGVTP 111

>Scas_716.29
          Length = 316

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 72/299 (24%), Positives = 125/299 (41%), Gaps = 29/299 (9%)

Query: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVS-GGLGPQYKGVVDCIKQIVAKEGASR-LYK 70
             AG+V+G+    V+ PLD +K R+QL+ S  G  P   G++  +K ++  EG  R  +K
Sbjct: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAP--SGLLKMMKGMILNEGGLRSFWK 83

Query: 71  GISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFE 130
           G     +M       +F+    +  ++     +    QSL +  GA AG   +FV  P +
Sbjct: 84  GNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVV--GALAGMTSSFVSYPTD 141

Query: 131 LVKIRL---QDV--SSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIF 185
           +++ R    QDV  SS   G     ++I   EG+   + G  ++++   +  +  FG   
Sbjct: 142 VLRTRFIANQDVALSSLSHG----CKEIWNMEGIPGFFRGCTASMFTITLSASILFGTYE 197

Query: 186 QVRALLPEAKSKSQQTRN-DLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNW 244
            ++    E   +S  T      A SI G    +++ P D ++ RIQ    V       N 
Sbjct: 198 SIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENK 257

Query: 245 SWPSIFTIYK-------------EEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFF 290
               I+  YK             +EG  +LY+G    + +  P   + L  +   M  +
Sbjct: 258 IVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/102 (21%), Positives = 47/102 (46%), Gaps = 14/102 (13%)

Query: 10  FYQFAAGAVAGISEILVMYPLDVVKTRMQLQVS------------GGLGPQYKGV--VDC 55
           + +++A +++G++  +V YPLD ++ R+Q++ S              +   YKG   +  
Sbjct: 215 YLRYSASSISGVTSKMVTYPLDTIRRRIQVRNSVYVQHNVENKIVTEIYQSYKGASFIRM 274

Query: 56  IKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIY 97
              I+ +EG   LY+G+S  +    P         +   ++Y
Sbjct: 275 GLNILRQEGLLSLYQGVSMSLCKTVPSTVVSLWAYETVMRLY 316

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 34/82 (41%), Gaps = 13/82 (15%)

Query: 195 KSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIF---- 250
           K +  +    L+AGS+ G +   +  P D +K R+Q      G A       PS      
Sbjct: 16  KGEDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQA-------PSGLLKMM 68

Query: 251 --TIYKEEGFRALYKGFVPKVL 270
              I  E G R+ +KG VP  +
Sbjct: 69  KGMILNEGGLRSFWKGNVPGTM 90

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 74/285 (25%), Positives = 121/285 (42%), Gaps = 28/285 (9%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASR-LYKGIS 73
           +G  AG    +  +PLD++K R+QL         Y G+   I+ I  ++   R LY+G+ 
Sbjct: 14  SGLTAGTITTIASHPLDLLKLRLQLSAGNRANTTYTGL---IRDIFERQQWGRELYRGLG 70

Query: 74  SPVLMEAPKRATKFACNDEFQKIYKREFGVE--------KLTQSLSILSGASAGCCEAFV 125
             +L  +   A  F C    + I  R  G E        +L     +L+  S+G   A +
Sbjct: 71  VNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYMLAAGSSGIATAVL 130

Query: 126 VVPFELVKIRLQDVSSS--YKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGI 183
             P  ++K R+   S +  YK   D V K+   EGVLA + G+  +L   GV     +  
Sbjct: 131 TNPIWVIKTRIMATSRAGPYKSTFDGVYKLYQTEGVLAFWRGVVPSLL--GVSQGAIYFA 188

Query: 184 IFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMST-----PFDVVKSRIQNTAVVAGG 238
           ++          S  +  R   ++  IG T  S M +     PF ++KS++Q+    +G 
Sbjct: 189 LYDTLKFHYLHSSTDKAERRLSVSEIIGITCISKMISVTSVYPFQLLKSKLQDFGAPSGI 248

Query: 239 ARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
            +        + T+Y  EG R  Y+G    +LR  P   I   V+
Sbjct: 249 TQL-------VQTVYSREGIRGFYRGLSANLLRAVPATCITFFVY 286

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 83/176 (47%), Gaps = 11/176 (6%)

Query: 1   MTDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIV 60
           + D R     Y  AAG+ +GI+  ++  P+ V+KTR  +  +   GP YK   D + ++ 
Sbjct: 106 IMDRRLPAHAYMLAAGS-SGIATAVLTNPIWVIKTR--IMATSRAGP-YKSTFDGVYKLY 161

Query: 61  AKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGC 120
             EG    ++G+  P L+   + A  FA  D   K +      +K  + LS+       C
Sbjct: 162 QTEGVLAFWRGV-VPSLLGVSQGAIYFALYDTL-KFHYLHSSTDKAERRLSVSEIIGITC 219

Query: 121 CEAFV----VVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWR 172
               +    V PF+L+K +LQD  +   G   +V+ + ++EG+   Y GL + L R
Sbjct: 220 ISKMISVTSVYPFQLLKSKLQDFGAP-SGITQLVQTVYSREGIRGFYRGLSANLLR 274

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 85/190 (44%), Gaps = 22/190 (11%)

Query: 101 FGVEKLTQSLSILSGASAGCCEAFVVVPFELVKIRL-----QDVSSSYKGPI-DVVRKII 154
            G E  +    ++SG +AG        P +L+K+RL        +++Y G I D+  +  
Sbjct: 1   MGHELTSLQREVISGLTAGTITTIASHPLDLLKLRLQLSAGNRANTTYTGLIRDIFER-- 58

Query: 155 AQEGVLAMYNGLESTLWRHGVWNAGYFGII-----FQVRALLPEAKSKSQQTR----NDL 205
            Q+    +Y GL   L  + V  A YFG         +R L  E+ +     R      +
Sbjct: 59  -QQWGRELYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYM 117

Query: 206 IAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGF 265
           +A    G   ++++ P  V+K+RI  T+     A  Y  ++  ++ +Y+ EG  A ++G 
Sbjct: 118 LAAGSSGIATAVLTNPIWVIKTRIMATS----RAGPYKSTFDGVYKLYQTEGVLAFWRGV 173

Query: 266 VPKVLRLGPG 275
           VP +L +  G
Sbjct: 174 VPSLLGVSQG 183

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 62/258 (24%), Positives = 123/258 (47%), Gaps = 31/258 (12%)

Query: 29  PLDVVKTRMQLQVSGGLGPQ-YKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRATKF 87
           PLD+VK R+Q+       P+ Y   +   ++I+A EG  ++Y G  +  +  + + A K+
Sbjct: 38  PLDLVKCRLQVN------PKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKY 91

Query: 88  ACNDEFQKIYKREF--GVEKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSSY-K 144
              + F+ +Y      GV     ++ +++ A+A      ++ PFE +K++ Q     +  
Sbjct: 92  GGYEYFKHLYSSWLSPGV-----TVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCN 146

Query: 145 GPIDVVRKIIAQEGVL-AMYNGLESTLWRHGVWNAGYFG----IIFQVRALLPEAKSKS- 198
             +D  +K+ A+ G + A Y G+     R   +    F     I+ ++ ++LP+ K +  
Sbjct: 147 NVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMN 206

Query: 199 --QQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWP-SIFTIYKE 255
             QQ     + G + G + + +S P DV+ S+I +        RK N S   +   IY++
Sbjct: 207 ALQQISVSFVGGYLAGILCAAVSHPADVMVSKINS-------ERKANESMSVASKRIYQK 259

Query: 256 EGFRALYKGFVPKVLRLG 273
            GF  L+ G + +++ +G
Sbjct: 260 IGFTGLWNGLMVRIVMIG 277

 Score = 50.1 bits (118), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 63/155 (40%), Gaps = 18/155 (11%)

Query: 126 VVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIF 185
           + P +LVK RLQ     Y   +   RKIIA EG   +Y G  +T   + +  AG +G   
Sbjct: 36  ITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYE 95

Query: 186 QVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTA------VVAGGA 239
             + L     S        L+A +    +  +M  PF+ +K + Q T       VV G  
Sbjct: 96  YFKHLYSSWLSPGVTVY--LMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWK 153

Query: 240 RKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGP 274
           + Y           +  G +A YKG VP   R  P
Sbjct: 154 KMYA----------ESGGMKAFYKGIVPLWCRQIP 178

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 62.8 bits (151), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 120/274 (43%), Gaps = 22/274 (8%)

Query: 23  EILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPK 82
           E  V YP +  KTR+QL   G    + +  +  + +    +GA  LY G  + V+    K
Sbjct: 24  EGCVTYPFEFAKTRLQLAQQG--SGESRNPLVLLYRTARTQGAGALYVGCPAFVVGNTCK 81

Query: 83  RATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEA-FVVVPFELVKIRLQD--- 138
              +F   D  ++  + E G   L+    +L+G  AG  E+   V PFE VK  L D   
Sbjct: 82  AGVRFLGFDALRRALQDERGA--LSGPRGMLAGLGAGLLESVLAVTPFEAVKTALIDDRQ 139

Query: 139 -----VSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVR-ALLP 192
                   + +G       ++ + G+  +Y GL     R     A  FG   Q++ A+  
Sbjct: 140 AARPRYQHNGRGAARNYALLLRELGLRGLYGGLVPVALRQASNQAVRFGCYTQLKQAVQR 199

Query: 193 EAKSKSQQ---TRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSI 249
            A + + Q   +    + G++ G +    + P D VK+R+Q     A  A +Y  +    
Sbjct: 200 YAGTPADQPLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQ-----ALDAARYGSTVGCF 254

Query: 250 FTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
             + +EEG RAL++G  P++ RL   GGI+   +
Sbjct: 255 RAVVREEGVRALWRGATPRLGRLVLSGGIVFTAY 288

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 4/69 (5%)

Query: 5   RPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEG 64
           +PL     F  GA++GI  +    P+D VKTRMQ   +     +Y   V C + +V +EG
Sbjct: 207 QPLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQALDAA----RYGSTVGCFRAVVREEG 262

Query: 65  ASRLYKGIS 73
              L++G +
Sbjct: 263 VRALWRGAT 271

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 63.2 bits (152), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 121/284 (42%), Gaps = 33/284 (11%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVS---------GGLGP--QYKGVVDCIKQIVAKE 63
            GAVA     + +YPLD+ KT +Q QVS         G + P  +YK VVDC+  I  ++
Sbjct: 9   TGAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINIFKEK 68

Query: 64  GASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKRE--FGVEKLTQS---------LSI 112
           G   LY+G++   +    +    F      +K Y +    G++ L              +
Sbjct: 69  GILGLYQGMTVTTVATFVQNFVYFFWYTFIRKSYMKHKLLGLQSLKNRDGPITPSTIEEL 128

Query: 113 LSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEG---VLAMYNGLEST 169
           + G +A         P  +V  R Q V S+       V K I +E    + A + GL + 
Sbjct: 129 VLGVAAASISQLFTSPMAVVATRQQTVHSAESAKFTNVIKDIYRENNGDITAFWKGLRTG 188

Query: 170 LWRHGVWNAGY--FGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKS 227
           L      +  Y  F  + +V        + S     + I G +   I +L++ P  V K+
Sbjct: 189 LALTINPSITYASFQRLKEVFFHDHSNDAGSLSAVQNFILGVLSKMISTLVTQPLIVAKA 248

Query: 228 RIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLR 271
            +Q+    AG   K+     ++  +YK EG ++L+KG +P++ +
Sbjct: 249 MLQS----AGS--KFTTFQEALLYLYKNEGLKSLWKGVLPQLTK 286

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/299 (22%), Positives = 120/299 (40%), Gaps = 19/299 (6%)

Query: 1   MTDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIV 60
           M+D R  P   +  +G  AG    L+++PLD+ K R+QL ++       KG  +   +IV
Sbjct: 1   MSD-RYTPLQKEVISGLTAGSVTTLIVHPLDLFKVRLQLLIT---STTKKGYRNLWSEIV 56

Query: 61  AKEGA--SRLYKGISSPVLMEAPKRATKFA----CNDEFQKIYKREFGVEKLTQSLSILS 114
             + +    LY+G++  ++         FA      D       R    + L+  + + +
Sbjct: 57  GSDLSLTRELYRGLTVNLVGNTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSA 116

Query: 115 GASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHG 174
            AS+G     +  P  ++K R+   ++S    + V+R +I  +GV  ++ GL   L   G
Sbjct: 117 SASSGMLTTVLTNPLWVIKTRMMSKANSDLTSMKVLRDLIKNDGVQGLWKGLVPAL--VG 174

Query: 175 VWNAGYFGIIFQV--RALLPEAKSKSQQTRNDLIA-GSIGGTIGSLMSTPFDVVKSRIQN 231
           V         +      L+ + +   + T  + IA  S+   + +    PF ++KS +Q+
Sbjct: 175 VSQGALHFTCYDTLKHKLVLKNRDSDEITNLETIAVTSVSKMLSTSAVYPFQLLKSNLQS 234

Query: 232 TAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFF 290
                   +      P    IY   G    YKG    +LR  P   I   ++     F 
Sbjct: 235 FQASENDFKLL----PLSKMIYSRSGLLGFYKGLSANLLRSVPSTCITFCIYENFKSFL 289

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 68/311 (21%), Positives = 122/311 (39%), Gaps = 61/311 (19%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYK-------GVVDCIKQIVAKEGASR 67
           AG V+G     ++ PLD +K   Q        P Y        G+ +  K I   +G   
Sbjct: 24  AGGVSGSCAKTLIAPLDRIKILFQTS-----NPHYSKYAGSLVGLYEAAKHIWINDGIRG 78

Query: 68  LYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVV 127
            ++G S  +L   P  A KF   ++ + I       E   + L+  SG+ AG C  F+  
Sbjct: 79  FFQGHSVTLLRIFPYAAVKFVAYEQIRSILIPSREYESHWRRLA--SGSLAGLCSVFITY 136

Query: 128 PFELVKIRLQDVSSSYKGPI-DVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQ 186
           P +L ++RL  V+   +  + D+V+ I  +     + + L    W    W   Y G +  
Sbjct: 137 PLDLTRVRLAYVTEHKRVKLRDIVKTIYHEPASEGLTSHLLVPKW-FAHWCNFYRGYVPT 195

Query: 187 VRALLPEA------------------------KSKSQQ---------------TRNDLIA 207
           V  ++P A                        K  S Q               T  +L+A
Sbjct: 196 VLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELERKKLRQKTPLRTWAELVA 255

Query: 208 GSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFT----IYKEEGFRALYK 263
           G + G +    + P ++++ R+Q + +     + Y+  + SI +    IY+E+G+R  + 
Sbjct: 256 GGLSGILSQTAAYPLEIIRRRLQVSTL--SPRKMYDHKFQSISSIARIIYQEKGWRGFFV 313

Query: 264 GFVPKVLRLGP 274
           G     +++ P
Sbjct: 314 GLSIGYIKVTP 324

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/204 (23%), Positives = 81/204 (39%), Gaps = 31/204 (15%)

Query: 113 LSGASAGCCEAFVVVPFELVKIRLQDVSSSYK-------GPIDVVRKIIAQEGVLAMYNG 165
           L+G  +G C   ++ P + +KI  Q  +  Y        G  +  + I   +G+   + G
Sbjct: 23  LAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFFQG 82

Query: 166 LESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVV 225
              TL R   + A  F    Q+R++L  ++      R  L +GS+ G     ++ P D+ 
Sbjct: 83  HSVTLLRIFPYAAVKFVAYEQIRSILIPSREYESHWRR-LASGSLAGLCSVFITYPLDLT 141

Query: 226 KSRIQNTAVVAGGAR-KYNWSWPSIFTIYKE---EGFRA-------------LYKGFVPK 268
           + R+   A V    R K       + TIY E   EG  +              Y+G+VP 
Sbjct: 142 RVRL---AYVTEHKRVKLR---DIVKTIYHEPASEGLTSHLLVPKWFAHWCNFYRGYVPT 195

Query: 269 VLRLGPGGGILLVVFTGCMDFFRT 292
           VL + P  G+         D  ++
Sbjct: 196 VLGMIPYAGVSFFAHDLIHDIMKS 219

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 60/160 (37%), Gaps = 35/160 (21%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGAS----- 66
           + A+G++AG+  + + YPLD+ + R+   V+     + + +V  I    A EG +     
Sbjct: 120 RLASGSLAGLCSVFITYPLDLTRVRLAY-VTEHKRVKLRDIVKTIYHEPASEGLTSHLLV 178

Query: 67  --------RLYKGISSPVLMEAPKRATKFACNDEFQKIYK---------------REFGV 103
                     Y+G    VL   P     F  +D    I K                E   
Sbjct: 179 PKWFAHWCNFYRGYVPTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELER 238

Query: 104 EKLTQSL------SILSGASAGCCEAFVVVPFELVKIRLQ 137
           +KL Q         +++G  +G        P E+++ RLQ
Sbjct: 239 KKLRQKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQ 278

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 40/88 (45%), Gaps = 9/88 (10%)

Query: 6   PLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGP------QYKGVVDCIKQI 59
           PL  + +  AG ++GI      YPL++++ R+Q+     L P      +++ +    + I
Sbjct: 246 PLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQVST---LSPRKMYDHKFQSISSIARII 302

Query: 60  VAKEGASRLYKGISSPVLMEAPKRATKF 87
             ++G    + G+S   +   P  A  F
Sbjct: 303 YQEKGWRGFFVGLSIGYIKVTPMVACSF 330

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 66/292 (22%), Positives = 123/292 (42%), Gaps = 38/292 (13%)

Query: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGI 72
             AG+++G+     + PLD VK ++Q+       P  K   + +  I+ +EG    +KG 
Sbjct: 19  LVAGSLSGLFARTCIAPLDTVKIKLQVT------PHNKNA-NVLINILKREGIRGFWKGN 71

Query: 73  SSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELV 132
               +M       +F          +    +    Q  S L G+ AG   +    PF+++
Sbjct: 72  VPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLVGSLAGMTSSLASYPFDVL 131

Query: 133 KIRLQDVSSSYKGPI----DVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVR 188
           + R    +++ +G +    D +  I + EG++  ++G  S++   G+  A  FG+   ++
Sbjct: 132 RTRF---AANSQGQLIKLRDEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFGVYESIK 188

Query: 189 ALLPEAKSKSQQTRN-----DLIAGSIGGTIGSLMSTPFDVVKSRIQ--NTAVVAGGARK 241
            +  E +SK    R+     + +AG I G    L + P D V+ RIQ  N+       R+
Sbjct: 189 -IFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRRRIQIRNSPNEERHDRE 247

Query: 242 YNWSWPSIFTIYK-------------EEGFRALYKGFVPKVLRLGPGGGILL 280
           +      I+  YK             +EG  +LY+G    +++  P   I L
Sbjct: 248 FT---KDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPSTAISL 296

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 76/187 (40%), Gaps = 31/187 (16%)

Query: 8   PFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASR 67
           P  Y    G++AG++  L  YP DV++TR      G    Q   + D I  I + EG   
Sbjct: 106 PQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQG----QLIKLRDEIMAIWSHEGLMG 161

Query: 68  LYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQS------LSILSGASAGCC 121
            + G  S ++      A  F   +   KI+  E    KL+        L+ L+G  +G  
Sbjct: 162 FFSGCGSSMINIGLNTAIMFGVYESI-KIFTEE--RSKLSDRRDPFTLLNELAGPISGFT 218

Query: 122 EAFVVVPFELVKIRLQ----------------DVSSSYKGP--IDVVRKIIAQEGVLAMY 163
                 P + V+ R+Q                D+  SYK    + V   ++ QEG L++Y
Sbjct: 219 SKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLY 278

Query: 164 NGLESTL 170
            G+  +L
Sbjct: 279 RGVTMSL 285

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 82/182 (45%), Gaps = 10/182 (5%)

Query: 104 EKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMY 163
           E+++ + S+++G+ +G      + P + VKI+LQ   + +    +V+  I+ +EG+   +
Sbjct: 11  EEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQ--VTPHNKNANVLINILKREGIRGFW 68

Query: 164 NGLESTLWRHGVWNAGYFGIIFQVRALLPEAK--SKSQQTRNDLIAGSIGGTIGSLMSTP 221
            G       + ++    FG    + + L      + S Q  + L+ GS+ G   SL S P
Sbjct: 69  KGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQLYSCLV-GSLAGMTSSLASYP 127

Query: 222 FDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLV 281
           FDV+++R    A   G   K       I  I+  EG    + G    ++ +G    I+  
Sbjct: 128 FDVLRTRF--AANSQGQLIKLR---DEIMAIWSHEGLMGFFSGCGSSMINIGLNTAIMFG 182

Query: 282 VF 283
           V+
Sbjct: 183 VY 184

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 40/92 (43%), Gaps = 16/92 (17%)

Query: 195 KSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYK 254
           K +   T N L+AGS+ G        P D VK ++Q T         +N +   +  I K
Sbjct: 9   KDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTP--------HNKNANVLINILK 60

Query: 255 EEGFRALYKGFVPKVLRLGPGGGILLVVFTGC 286
            EG R  +KG VP        G I+ +++ G 
Sbjct: 61  REGIRGFWKGNVP--------GSIMYIIYGGA 84

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 88/187 (47%), Gaps = 21/187 (11%)

Query: 3   DARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKG---VVDCIKQI 59
           D + L     F AG +AG+     +YP+D +K RMQ      L  + KG   ++   K++
Sbjct: 314 DTKDLSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQ---CAPLNAELKGRKLMIQTAKEM 370

Query: 60  VAKEGASRLYKGISSPVLMEAPKRA---------TKFACNDEFQKIYKREFGVEKLTQSL 110
             + G    Y+G++  VL   P  A          K+  + + +K+ K+E  VE L+  +
Sbjct: 371 YTEGGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVE-LSNLV 429

Query: 111 SILSGASAGCCEAFVVVPFELVKIRLQDVSS-----SYKGPIDVVRKIIAQEGVLAMYNG 165
            +  GA +G   A VV P  L++ RLQ   +      Y G  DV+ K I +EG   ++ G
Sbjct: 430 VLPMGAFSGTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGYPGLFKG 489

Query: 166 LESTLWR 172
           L  TL +
Sbjct: 490 LVPTLAK 496

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 64/282 (22%), Positives = 119/282 (42%), Gaps = 28/282 (9%)

Query: 17  AVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSPV 76
           A   +S  L+    DV+      + +    P  K ++   +Q     G    Y G     
Sbjct: 230 ARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLVKAIISLYRQ----GGIKSFYVGNGLNA 285

Query: 77  LMEAPKRATKFACNDEFQKIYKREFGVE--KLTQSLSILS----GASAGCCEAFVVVPFE 130
           L   P+ + KF   +  +K+  +   VE  K T+ LS LS    G  AG C  F V P +
Sbjct: 286 LKVFPESSIKFGSFEITKKLMTK---VENCKDTKDLSKLSTFIAGGLAGVCAQFSVYPID 342

Query: 131 LVKIRLQ--DVSSSYKGP---IDVVRKIIAQEGVLAMYNGLEST---LWRHGVWNAGYFG 182
            +K R+Q   +++  KG    I   +++  + G+   Y G+      ++ +   + G F 
Sbjct: 343 TLKFRMQCAPLNAELKGRKLMIQTAKEMYTEGGLKLFYRGVTVGVLGIFPYAALDLGTFS 402

Query: 183 II----FQVRALLPEAKSKSQQTRNDLI--AGSIGGTIGSLMSTPFDVVKSRIQNTAVVA 236
           ++       +A     K +  +  N ++   G+  GT G+ +  P +++++R+Q     A
Sbjct: 403 MLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAFSGTFGATVVYPINLLRTRLQAQGTFA 462

Query: 237 GGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGI 278
              R Y+     +    + EG+  L+KG VP + ++ P   I
Sbjct: 463 HPYR-YDGFRDVLLKTIQREGYPGLFKGLVPTLAKVCPAVSI 503

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 44/83 (53%)

Query: 16  GAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSP 75
           GA +G     V+YP+++++TR+Q Q +     +Y G  D + + + +EG   L+KG+   
Sbjct: 434 GAFSGTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGYPGLFKGLVPT 493

Query: 76  VLMEAPKRATKFACNDEFQKIYK 98
           +    P  +  + C +  +K+ K
Sbjct: 494 LAKVCPAVSISYLCYENLKKLMK 516

 Score = 28.9 bits (63), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 44/203 (21%), Positives = 77/203 (37%), Gaps = 36/203 (17%)

Query: 113 LSGASAGCCEAFVVVPFELVKIRL---QDVSSSYKGPIDVVRKIIAQEGVLAMYNGLES- 168
           ++G  +G        PF+ +K+ L    D+SS+    ++    ++A+    A  N L S 
Sbjct: 205 IAGGISGVISRTCTAPFDRLKVFLIARTDLSSTL---LNSTEDVLAK-NPHAKPNKLRSP 260

Query: 169 ------TLWRHGVWNAGYFGIIFQVRALLPEA---------------KSKSQQTRNDL-- 205
                 +L+R G   + Y G       + PE+               K ++ +   DL  
Sbjct: 261 LVKAIISLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTKVENCKDTKDLSK 320

Query: 206 ----IAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRAL 261
               IAG + G        P D +K R+Q  A +    +       +   +Y E G +  
Sbjct: 321 LSTFIAGGLAGVCAQFSVYPIDTLKFRMQ-CAPLNAELKGRKLMIQTAKEMYTEGGLKLF 379

Query: 262 YKGFVPKVLRLGPGGGILLVVFT 284
           Y+G    VL + P   + L  F+
Sbjct: 380 YRGVTVGVLGIFPYAALDLGTFS 402

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 71/286 (24%), Positives = 112/286 (39%), Gaps = 42/286 (14%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLG------PQYKGVVDCIKQIVAKEGASRL 68
            GAVA       +YPLD+ KT +Q Q             +YK V+DCI +I  K G   L
Sbjct: 9   TGAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGFLGL 68

Query: 69  YKGISSPVLMEAPKRATKFACNDEFQKIY----------KREFGVEKLTQSLSILSGASA 118
           Y+G+++ V     +    F      +  Y          K +    +L+    +  G SA
Sbjct: 69  YQGLATNVAANFVQNFIYFFWYSLIRSNYFVFKAGRLQLKDDSKFIELSTIEELALGMSA 128

Query: 119 GCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWR------ 172
           G     V  P  ++  R Q         +  V K I +E      NG  +  W+      
Sbjct: 129 GAMTQVVTNPISVISTRQQLTKDGEDASLKAVIKQIYEES-----NGDLTAFWKGFKVAL 183

Query: 173 -HGVWNAGYFGIIFQVRALLPEAK--SKSQQTRNDLIAGS------IGGTIGSLMSTPFD 223
                 A  +G   ++++++  AK  S SQ+    L AG           I + ++ P  
Sbjct: 184 VLSTNPAITYGSYQKLKSMILTAKGLSGSQKISTQLSAGENFLLGMFSKMISTFVTQPLI 243

Query: 224 VVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKV 269
           V K  +Q      G   K+      +  IY+ EGF +L+KG +P+V
Sbjct: 244 VAKITLQ------GKGSKFKTFQEVLQHIYQNEGFLSLWKGVIPQV 283

 Score = 28.1 bits (61), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 36/88 (40%), Gaps = 5/88 (5%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKG 71
            F  G  + +    V  PL V K  +Q     G G ++K   + ++ I   EG   L+KG
Sbjct: 224 NFLLGMFSKMISTFVTQPLIVAKITLQ-----GKGSKFKTFQEVLQHIYQNEGFLSLWKG 278

Query: 72  ISSPVLMEAPKRATKFACNDEFQKIYKR 99
           +   V      +   F   DE  ++ ++
Sbjct: 279 VIPQVSKGVIVQGLLFTYKDEIVRVIRK 306

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 71/285 (24%), Positives = 117/285 (41%), Gaps = 38/285 (13%)

Query: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIV--AKEGASR--- 67
            AAG V G+  +L  +P D+VK R Q         Q +  +D +  I+  A++ A     
Sbjct: 32  LAAGGVGGVCAVLTGHPFDLVKVRCQSN-------QARSAMDAVSHILQAARQAAGPTSL 84

Query: 68  -----LYKGISSPVLMEAPKRATKFACNDEFQKIYKR-----EFGVEKLTQSLSILSGAS 117
                 YKG+  P+L   P  A  F   D  +K+          G   +   L++   A+
Sbjct: 85  NAVRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVEPELTLSQMAA 144

Query: 118 AGCCEA----FVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRH 173
           AG   A     V  P E VK+ LQ  +      +D  ++I+  +G  +++ G  +TL R 
Sbjct: 145 AGFISAIPTTLVTAPTERVKVVLQ-TTQGKASFLDAAKQIVRTQGFQSLFKGSLATLSRD 203

Query: 174 GVWNAGYFGIIFQVRALLPEAKSKSQ---QTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQ 230
           G  +A YF      +  L +A   +       N  I+G + G    ++  P D VK+++Q
Sbjct: 204 GPGSALYFASYEICKEYLNKASGHTSGELSITNVCISGGMAGVSMWVVVFPIDTVKTQLQ 263

Query: 231 NTAVVAGGARKYNWSWPSIFTIYKEE-GFRALYKGFVPKVLRLGP 274
           +++       K          IY    G +  + G  P +LR  P
Sbjct: 264 SSS-------KRQSMLEVTRMIYNTRGGIKGFFPGVGPAILRSFP 301

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 40/90 (44%), Gaps = 14/90 (15%)

Query: 194 AKSKSQQTRN--DLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFT 251
           +++KSQ T N   L AG +GG    L   PFD+VK R Q+       AR    +   I  
Sbjct: 19  SQTKSQLTENLKSLAAGGVGGVCAVLTGHPFDLVKVRCQSNQ-----ARSAMDAVSHILQ 73

Query: 252 IYKE-------EGFRALYKGFVPKVLRLGP 274
             ++          R  YKG VP +L + P
Sbjct: 74  AARQAAGPTSLNAVRGFYKGVVPPLLGVTP 103

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 41/201 (20%), Positives = 83/201 (41%), Gaps = 16/201 (7%)

Query: 105 KLTQSL-SILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKII--------- 154
           +LT++L S+ +G   G C      PF+LVK+R Q  S+  +  +D V  I+         
Sbjct: 24  QLTENLKSLAAGGVGGVCAVLTGHPFDLVKVRCQ--SNQARSAMDAVSHILQAARQAAGP 81

Query: 155 -AQEGVLAMYNG-LESTLWRHGVWNAGYFG--IIFQVRALLPEAKSKSQQTRNDLIAGSI 210
            +   V   Y G +   L    ++   ++G  +  ++   +P + +         +  S 
Sbjct: 82  TSLNAVRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVEPELTLSQ 141

Query: 211 GGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVL 270
               G + + P  +V +  +   VV    +       +   I + +GF++L+KG +  + 
Sbjct: 142 MAAAGFISAIPTTLVTAPTERVKVVLQTTQGKASFLDAAKQIVRTQGFQSLFKGSLATLS 201

Query: 271 RLGPGGGILLVVFTGCMDFFR 291
           R GPG  +    +  C ++  
Sbjct: 202 RDGPGSALYFASYEICKEYLN 222

 Score = 32.0 bits (71), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 43/86 (50%), Gaps = 7/86 (8%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASR-LYKGIS 73
           +G +AG+S  +V++P+D VKT  QLQ S     + + +++  + I    G  +  + G+ 
Sbjct: 240 SGGMAGVSMWVVVFPIDTVKT--QLQSSS----KRQSMLEVTRMIYNTRGGIKGFFPGVG 293

Query: 74  SPVLMEAPKRATKFACNDEFQKIYKR 99
             +L   P  A  F   +    ++K+
Sbjct: 294 PAILRSFPANAATFLGVELTHSLFKK 319

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 68/314 (21%), Positives = 123/314 (39%), Gaps = 67/314 (21%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYK-------GVVDCIKQIVAKEGASR 67
           AG ++G     ++ PLD +K   Q        P Y        G+V+  K I   +G   
Sbjct: 39  AGGISGSCAKTLIAPLDRIKILFQTS-----NPHYTKYTGSLIGLVEAAKHIWINDGVRG 93

Query: 68  LYKGISSPVLMEAPKRATKFACNDEFQK--IYKREFGVEKLTQSLSILSGASAGCCEAFV 125
            ++G S+ +L   P  A KF   ++ +   I  +EF     +    ++SG+ AG C  F+
Sbjct: 94  FFQGHSATLLRIFPYAAVKFVAYEQIRNTLIPSKEFE----SHWRRLVSGSLAGLCSVFI 149

Query: 126 VVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLA--MYNGLESTLWRHGVWNAGYFGI 183
             P +LV++RL   +   +  +  + K I +E   A  + N      + H  W   Y G 
Sbjct: 150 TYPLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNWFCH--WCNFYRGY 207

Query: 184 IFQVRALLPEA---------------------------------------KSKSQQTRND 204
           +  V  ++P A                                       + +  +T  +
Sbjct: 208 VPTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQKKQRRPLRTWAE 267

Query: 205 LIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSI----FTIYKEEGFRA 260
           LI+G + G      + PF++++ R+Q +A+       Y+  + SI      I+KE G R 
Sbjct: 268 LISGGLAGMASQTAAYPFEIIRRRLQVSAL--SPKTMYDHKFQSISEIAHIIFKERGVRG 325

Query: 261 LYKGFVPKVLRLGP 274
            + G     +++ P
Sbjct: 326 FFVGLSIGYIKVTP 339

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 87/199 (43%), Gaps = 21/199 (10%)

Query: 113 LSGASAGCCEAFVVVPFELVKIRLQDVSSSYK-------GPIDVVRKIIAQEGVLAMYNG 165
           L+G  +G C   ++ P + +KI  Q  +  Y        G ++  + I   +GV   + G
Sbjct: 38  LAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQG 97

Query: 166 LESTLWRHGVWNAGYFGIIFQVR-ALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDV 224
             +TL R   + A  F    Q+R  L+P  + +S   R  L++GS+ G     ++ P D+
Sbjct: 98  HSATLLRIFPYAAVKFVAYEQIRNTLIPSKEFESHWRR--LVSGSLAGLCSVFITYPLDL 155

Query: 225 VKSRI----QNTAVVAGGARKYNWSWPSIFTIYKEE-------GFRALYKGFVPKVLRLG 273
           V+ R+    ++  V  G   K  +  P+  T+ K +        +   Y+G+VP VL + 
Sbjct: 156 VRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGYVPTVLGMI 215

Query: 274 PGGGILLVVFTGCMDFFRT 292
           P  G+         D  ++
Sbjct: 216 PYAGVSFFAHDLLHDVLKS 234

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/198 (20%), Positives = 75/198 (37%), Gaps = 45/198 (22%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQ------------------------VSGGLGP 47
           +  +G++AG+  + + YPLD+V+ R+  +                        +     P
Sbjct: 135 RLVSGSLAGLCSVFITYPLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIP 194

Query: 48  Q--------YKGVVDCIKQIVAKEGASRLYKGISSPVLME---APKRATKFACNDEFQKI 96
                    Y+G V  +  ++   G S     +   VL     AP    + + +DE +++
Sbjct: 195 NWFCHWCNFYRGYVPTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERV 254

Query: 97  YKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPID-------- 148
            K++     L     ++SG  AG        PFE+++ RLQ  + S K   D        
Sbjct: 255 QKKQ--RRPLRTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISE 312

Query: 149 VVRKIIAQEGVLAMYNGL 166
           +   I  + GV   + GL
Sbjct: 313 IAHIIFKERGVRGFFVGL 330

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/89 (21%), Positives = 40/89 (44%), Gaps = 9/89 (10%)

Query: 5   RPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGP------QYKGVVDCIKQ 58
           RPL  + +  +G +AG++     YP ++++ R+Q+     L P      +++ + +    
Sbjct: 260 RPLRTWAELISGGLAGMASQTAAYPFEIIRRRLQV---SALSPKTMYDHKFQSISEIAHI 316

Query: 59  IVAKEGASRLYKGISSPVLMEAPKRATKF 87
           I  + G    + G+S   +   P  A  F
Sbjct: 317 IFKERGVRGFFVGLSIGYIKVTPMVACSF 345

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 67/313 (21%), Positives = 120/313 (38%), Gaps = 61/313 (19%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQY-------KGVVDCIKQIVAKEGASR 67
           AG VAG     ++ PLD +K   Q        P Y       +G+++    I +++    
Sbjct: 59  AGGVAGSCAKTLIAPLDRIKILFQTS-----NPHYVKYAGSFQGLLNAGVHIWSRDRLRG 113

Query: 68  LYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVV 127
           +++G S+ +L   P  A KF   ++ + +       E  T    + SG+ AG C  F   
Sbjct: 114 VFQGHSATLLRIFPYAAVKFIAYEQIRNVIIPSKEYE--THFRRLCSGSLAGLCSVFCTY 171

Query: 128 PFELVKIRLQDVSSSYKGPI-DVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQ 186
           P +L+++RL  V+  +K  +  +V++I ++    A+ +      W    W   Y G I  
Sbjct: 172 PLDLIRVRLAYVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPKW-FAQWCNFYRGYIPT 230

Query: 187 VRALLPEA-----------------------------------KSKSQQTRN-------- 203
           V  ++P A                                   K   Q TR         
Sbjct: 231 VIGMIPYAGVSFFAHDLFHDILRHPVIAPYSVLRVDDLDADDLKVDVQTTRTGKRIPLNT 290

Query: 204 --DLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRAL 261
             +L+AG + G      + PF++++ R+Q  AV      K+         I+ E G+R  
Sbjct: 291 WAELLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHKFTSMSEMAKIIFHERGWRGF 350

Query: 262 YKGFVPKVLRLGP 274
           + G     +++ P
Sbjct: 351 FVGLSIGYIKVTP 363

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 83/202 (41%), Gaps = 29/202 (14%)

Query: 113 LSGASAGCCEAFVVVPFELVKIRLQ-------DVSSSYKGPIDVVRKIIAQEGVLAMYNG 165
           L+G  AG C   ++ P + +KI  Q         + S++G ++    I +++ +  ++ G
Sbjct: 58  LAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVFQG 117

Query: 166 LESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVV 225
             +TL R   + A  F    Q+R ++  +K      R  L +GS+ G      + P D++
Sbjct: 118 HSATLLRIFPYAAVKFIAYEQIRNVIIPSKEYETHFRR-LCSGSLAGLCSVFCTYPLDLI 176

Query: 226 KSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRAL----------------YKGFVPKV 269
           + R+   A V    +     WP +  IY E    AL                Y+G++P V
Sbjct: 177 RVRL---AYVTEHHKVR--VWPLVKQIYSEPASEALSSKAYVPKWFAQWCNFYRGYIPTV 231

Query: 270 LRLGPGGGILLVVFTGCMDFFR 291
           + + P  G+         D  R
Sbjct: 232 IGMIPYAGVSFFAHDLFHDILR 253

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 35/172 (20%), Positives = 62/172 (36%), Gaps = 49/172 (28%)

Query: 10  FYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYK-GVVDCIKQIVAKEGASRL 68
           F +  +G++AG+  +   YPLD+++ R+       +   +K  V   +KQI ++  +  L
Sbjct: 153 FRRLCSGSLAGLCSVFCTYPLDLIRVRLAY-----VTEHHKVRVWPLVKQIYSEPASEAL 207

Query: 69  ----------------YKGISSPVLMEAPKRATKFACNDEFQKIYKR------------- 99
                           Y+G    V+   P     F  +D F  I +              
Sbjct: 208 SSKAYVPKWFAQWCNFYRGYIPTVIGMIPYAGVSFFAHDLFHDILRHPVIAPYSVLRVDD 267

Query: 100 ----EFGVE----------KLTQSLSILSGASAGCCEAFVVVPFELVKIRLQ 137
               +  V+           L     +L+G  AG        PFE+++ RLQ
Sbjct: 268 LDADDLKVDVQTTRTGKRIPLNTWAELLAGGLAGMASQTAAYPFEIIRRRLQ 319

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 40/83 (48%), Gaps = 1/83 (1%)

Query: 6   PLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQL-QVSGGLGPQYKGVVDCIKQIVAKEG 64
           PL  + +  AG +AG++     YP ++++ R+Q+  V+  L  ++  + +  K I  + G
Sbjct: 287 PLNTWAELLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHKFTSMSEMAKIIFHERG 346

Query: 65  ASRLYKGISSPVLMEAPKRATKF 87
               + G+S   +   P  A  F
Sbjct: 347 WRGFFVGLSIGYIKVTPMVACSF 369

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 70/300 (23%), Positives = 123/300 (41%), Gaps = 34/300 (11%)

Query: 8   PFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQ--YKGVVDCIK-----QIV 60
           P   +  +G  AG    +V +PLD++K R+QL  +  L P   Y  V   IK     Q +
Sbjct: 11  PLQKEIISGLTAGTITTIVTHPLDLIKLRLQL-AAIDLKPSSYYNQVQRIIKDGSGTQQL 69

Query: 61  AKEGASRLYKGISSPVLMEAPKRATKFA---CNDEFQKIYKREFGVE-------KLTQSL 110
            KE     Y+G+   ++  A      F    C+ +       E  ++       K+T S+
Sbjct: 70  LKEA----YRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSM 125

Query: 111 SILSGASAGCCEAFVVVPFELVKIRLQDVSSS--YKGPIDVVRKIIAQEGVLAMYNGLES 168
            ++S  ++G   A +  P  ++K R+    SS  Y   ++ + +I  +EG+   + GL  
Sbjct: 126 YLVSAGASGLATALLTNPMWVIKTRIMSTKSSQGYTSILNAITRIYTEEGLKTFWRGLVP 185

Query: 169 TLWRHGVWN-AGYFGIIFQVRALLPEAKSKSQQTRNDLIAG----SIGGTIGSLMSTPFD 223
           +L+  GV   A YF I   ++      ++  Q+ R + +      S+   I      P  
Sbjct: 186 SLF--GVTQGALYFAIYDTLKLKYLHDRNDIQERRLNAVETIGIISLSKMISVSSVYPLQ 243

Query: 224 VVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
           ++K+ +Q          K N     I +I+   G    YKG    ++R  P   I   V+
Sbjct: 244 LLKTNLQTFRTEHNENSKMN---SLIRSIWHTNGIAGFYKGLFANLVRAIPSTCITFGVY 300

>Kwal_27.11419
          Length = 298

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/293 (22%), Positives = 118/293 (40%), Gaps = 43/293 (14%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKG 71
            F  G V G++  +++ P D++KTR+Q   S  L       +D ++ I   E   +L+KG
Sbjct: 10  HFIGGFVGGLTSAVILQPFDLLKTRLQQNKSSNL-------LDVVRSI---ETPGQLWKG 59

Query: 72  ISSPVLMEAPKRA--------TKFACNDEFQKIYKREFGVEKLTQSLS----ILSGASAG 119
                L  +   A         + A  D+  K    + G       LS    ++SGA   
Sbjct: 60  TLPSALRTSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITR 119

Query: 120 CCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAG 179
                  +P  ++K+R +    +YK   +    I   EG+  +++G  +T+ R   +   
Sbjct: 120 AAVGVATMPITVLKVRFESTMYNYKSLGEAATHIYRSEGIRGLFSGCGATVMRDAPYAGL 179

Query: 180 YFGIIFQVRALLP---------EAKSKSQQTRNDLIAGSIG----GTIGSLMSTPFDVVK 226
           Y     Q +  LP           +S    T+   I  SI      ++ + +++PFD +K
Sbjct: 180 YVLFYEQSKLQLPRILPVWMVEHNESGVFSTKTSTIINSIAAFSSASLATTITSPFDTIK 239

Query: 227 SRIQ-NTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGI 278
           +R+Q N +   G  + +        +I + E  R L+ G   ++ R     GI
Sbjct: 240 TRMQLNPSQYYGFIQTFK-------SIIRYERPRNLFDGLSLRLSRKALSAGI 285

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 82/186 (44%), Gaps = 28/186 (15%)

Query: 113 LSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWR 172
           + G   G   A ++ PF+L+K RLQ   SS    +DVVR I   E    ++ G   +  R
Sbjct: 12  IGGFVGGLTSAVILQPFDLLKTRLQQNKSS--NLLDVVRSI---ETPGQLWKGTLPSALR 66

Query: 173 HGVWNAGYFGIIFQVRALLPEAKSKSQQTRN-------------DLIAGSIGGTIGSLMS 219
             V +A +   +  VR+ + + + K    +N             +LI+G+I      + +
Sbjct: 67  TSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAVGVAT 126

Query: 220 TPFDVVKSRIQNTAVVAGGARKYNWSW--PSIFTIYKEEGFRALYKGFVPKVLRLGPGGG 277
            P  V+K R ++T         YN+     +   IY+ EG R L+ G    V+R  P  G
Sbjct: 127 MPITVLKVRFESTM--------YNYKSLGEAATHIYRSEGIRGLFSGCGATVMRDAPYAG 178

Query: 278 ILLVVF 283
           + ++ +
Sbjct: 179 LYVLFY 184

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 72/181 (39%), Gaps = 17/181 (9%)

Query: 7   LPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGAS 66
           L  +    +GA+   +  +   P+ V+K R +  +       YK + +    I   EG  
Sbjct: 106 LSMYENLISGAITRAAVGVATMPITVLKVRFESTMY-----NYKSLGEAATHIYRSEGIR 160

Query: 67  RLYKGISSPVLMEAPKRA--TKFACNDEFQ--------KIYKREFGV--EKLTQSLSILS 114
            L+ G  + V+ +AP       F    + Q         +   E GV   K +  ++ ++
Sbjct: 161 GLFSGCGATVMRDAPYAGLYVLFYEQSKLQLPRILPVWMVEHNESGVFSTKTSTIINSIA 220

Query: 115 GASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHG 174
             S+      +  PF+ +K R+Q   S Y G I   + II  E    +++GL   L R  
Sbjct: 221 AFSSASLATTITSPFDTIKTRMQLNPSQYYGFIQTFKSIIRYERPRNLFDGLSLRLSRKA 280

Query: 175 V 175
           +
Sbjct: 281 L 281

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 39/85 (45%), Gaps = 11/85 (12%)

Query: 196 SKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKE 255
           S+  + R+  I G +GG   +++  PFD++K+R+Q            N S   +  +   
Sbjct: 2   SERPRGRSHFIGGFVGGLTSAVILQPFDLLKTRLQQ-----------NKSSNLLDVVRSI 50

Query: 256 EGFRALYKGFVPKVLRLGPGGGILL 280
           E    L+KG +P  LR   G  + L
Sbjct: 51  ETPGQLWKGTLPSALRTSVGSALFL 75

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 106/243 (43%), Gaps = 13/243 (5%)

Query: 29  PLDVVKTRMQL-QVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRATKF 87
           PL  + TRMQ+ +     G + K  ++ +++I  KEG    Y G+ S +   A      +
Sbjct: 36  PLVTLATRMQVSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYGMAANSLNYY 95

Query: 88  ACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPI 147
              +   +   R  G  +L  S +ILS A AG   A    P  +V  R+  V+ S +  +
Sbjct: 96  YFYELAARATMRVRGSRRLNTSEAILSSAVAGSMTAIASNPIWVVNTRM-TVAKSEQSTL 154

Query: 148 DVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQV--RALLPEAKSKSQQTRNDL 205
            V+  I+ ++GV A++NGL   L    V N      +F+     +L  + S         
Sbjct: 155 AVLLDIVRKDGVTALFNGLRPALML--VSNPIIQYTVFEQLKNVVLKWSGSDVLLPSWAF 212

Query: 206 IAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGG---ARKYNWSWPSIFTIYKEEGFRALY 262
           + G++G    +  + P+  +K+R+     +A G   A      W  +  I K+EG + LY
Sbjct: 213 LLGAVGKLAATGSTYPYITLKTRMH----LAKGKEDADTQQSMWSLMVDIVKKEGIQGLY 268

Query: 263 KGF 265
            G 
Sbjct: 269 HGI 271

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 71/154 (46%), Gaps = 16/154 (10%)

Query: 125 VVVPFELVKIRLQDVSSSYKGP-------IDVVRKIIAQEGVLAMYNGLESTLWRHGVWN 177
           + +P   +  R+Q VS   K P       ++ VR+I  +EGV+  Y GLES ++     +
Sbjct: 33  LTMPLVTLATRMQ-VSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYGMAANS 91

Query: 178 AGYFGII-FQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVA 236
             Y+       RA +    S+   T   +++ ++ G++ ++ S P  VV +R+       
Sbjct: 92  LNYYYFYELAARATMRVRGSRRLNTSEAILSSAVAGSMTAIASNPIWVVNTRMT------ 145

Query: 237 GGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVL 270
             A+    +   +  I +++G  AL+ G  P ++
Sbjct: 146 -VAKSEQSTLAVLLDIVRKDGVTALFNGLRPALM 178

 Score = 31.2 bits (69), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 27/62 (43%)

Query: 11  YQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYK 70
           + F  GAV  ++     YP   +KTRM L          + +   +  IV KEG   LY 
Sbjct: 210 WAFLLGAVGKLAATGSTYPYITLKTRMHLAKGKEDADTQQSMWSLMVDIVKKEGIQGLYH 269

Query: 71  GI 72
           GI
Sbjct: 270 GI 271

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 75/346 (21%), Positives = 139/346 (40%), Gaps = 85/346 (24%)

Query: 1   MTDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIV 60
           M+D  P   +    AG+ A + +  + +P + +KT  QL  S      +  +   +K   
Sbjct: 1   MSDTNP-SLYSNLLAGSAAAVFQTTLSHPFEFLKTGQQLHRSLPNAEAF-NMFHHVKSYF 58

Query: 61  AKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILS-GASAG 119
           A  G S L  GI    L+   K AT+FA  D+  ++ K     E     L +++ G+  G
Sbjct: 59  A--GCSALNIGI----LL---KTATRFATFDKACQLLKDPENPEAPVSGLRLIAAGSITG 109

Query: 120 CCEAFVVVPFELVKIRLQD----VSSSYKGPIDV-------------------------- 149
             E+ +++PFE +K R+ +    +S+ Y+  ++                           
Sbjct: 110 FMESMLIIPFENIKTRMIENALILSNRYQEEVETGGKDKPRSKSVNNMETKEQIRPKLYK 169

Query: 150 ---------------------------VRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFG 182
                                      VR+++   G    + G   T++R    +A  F 
Sbjct: 170 QVKKEINPRYEKFLYYEKHPSTNIFTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFT 229

Query: 183 IIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKY 242
               ++ ++   K  S+     +   S    +   ++ P DVVK+R+Q+         KY
Sbjct: 230 TYTTLKQMISPNKPLSEYYAFGIGVFSSCAVVA--LTQPIDVVKTRMQS---------KY 278

Query: 243 NWSW--PSIFTIYK---EEGFRALYKGFVPKVLRLGPGGGILLVVF 283
            WS    S+  +Y+   EEG  +L+KG+VP++ ++G  GG+   V+
Sbjct: 279 TWSLYRNSLNCVYRTFIEEGLTSLWKGWVPRLFKVGLSGGVSFGVY 324

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/232 (17%), Positives = 88/232 (37%), Gaps = 57/232 (24%)

Query: 14  AAGAVAGISEILVMYPLDVVKTRM-----------QLQVSGG------------------ 44
           AAG++ G  E +++ P + +KTRM           Q +V  G                  
Sbjct: 103 AAGSITGFMESMLIIPFENIKTRMIENALILSNRYQEEVETGGKDKPRSKSVNNMETKEQ 162

Query: 45  ------------LGPQYK-----------GVVDCIKQIVAKEGASRLYKGISSPVLMEAP 81
                       + P+Y+            +   ++++V   G +  ++G    +  +  
Sbjct: 163 IRPKLYKQVKKEINPRYEKFLYYEKHPSTNIFTTVREMVQTRGFTTFFQGSMPTIFRQVG 222

Query: 82  KRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQD--V 139
             A +F      +++       + L++  +   G  + C    +  P ++VK R+Q    
Sbjct: 223 NSAVRFTTYTTLKQMISPN---KPLSEYYAFGIGVFSSCAVVALTQPIDVVKTRMQSKYT 279

Query: 140 SSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALL 191
            S Y+  ++ V +   +EG+ +++ G    L++ G+     FG+   V  L+
Sbjct: 280 WSLYRNSLNCVYRTFIEEGLTSLWKGWVPRLFKVGLSGGVSFGVYQYVDNLM 331

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 55.8 bits (133), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 56/274 (20%), Positives = 112/274 (40%), Gaps = 25/274 (9%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKG 71
              +G   G++ +  + PLD++KTR+Q   +  L    + V    +++      S L   
Sbjct: 11  HLVSGFFGGLASVCALQPLDLLKTRLQQAQASSLRSVLREV-RTTRELWRGTLPSALRTS 69

Query: 72  ISSPVLMEAPKRA-TKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFE 130
           I S + +     + +  A   E +    R   + +L    ++L+GA +      V +P  
Sbjct: 70  IGSALYLSLLNYSRSALARGSEART---RSSLLPRLQSYQNLLTGALSRAAVGLVTMPIT 126

Query: 131 LVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRAL 190
           ++K+R +    +Y G  +  R I   EG    + G  +T  R   +   Y  +  Q + +
Sbjct: 127 VIKVRYESTLYAYNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLYVLLYEQAKEM 186

Query: 191 LPEA----------KSKSQQTRNDLIAGS---IGGTIGSLMSTPFDVVKSRIQNTAVVAG 237
           LP A            K     + ++ G    +  ++ + ++ PFD +K+R+Q  +   G
Sbjct: 187 LPRALPATLLGADESGKLTAPASAMVNGVSAFLSASLATTLTAPFDTIKTRMQLQSHPVG 246

Query: 238 GARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLR 271
             +       ++  I  EE  R L+ G   ++ R
Sbjct: 247 FVQ-------TLRHIVCEERARTLFDGLSLRLCR 273

 Score = 50.4 bits (119), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 81/181 (44%), Gaps = 21/181 (11%)

Query: 112 ILSGASAGCCEAFVVVPFELVKIRLQDV-SSSYKGPIDVVRKIIAQEGVLAMYNGLESTL 170
           ++SG   G      + P +L+K RLQ   +SS +  +  VR          ++ G   + 
Sbjct: 12  LVSGFFGGLASVCALQPLDLLKTRLQQAQASSLRSVLREVRT------TRELWRGTLPSA 65

Query: 171 WRHGVWNAGYFGIIFQVRALL---PEAKSKSQ-----QTRNDLIAGSIGGTIGSLMSTPF 222
            R  + +A Y  ++   R+ L    EA+++S      Q+  +L+ G++      L++ P 
Sbjct: 66  LRTSIGSALYLSLLNYSRSALARGSEARTRSSLLPRLQSYQNLLTGALSRAAVGLVTMPI 125

Query: 223 DVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVV 282
            V+K R ++T         YN    +   I++ EG R  +KG     LR  P  G+ +++
Sbjct: 126 TVIKVRYESTLYA------YNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLYVLL 179

Query: 283 F 283
           +
Sbjct: 180 Y 180

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 85/197 (43%), Gaps = 18/197 (9%)

Query: 7   LPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGAS 66
           L  +     GA++  +  LV  P+ V+K R +  +       Y G+ +  + I   EGA 
Sbjct: 102 LQSYQNLLTGALSRAAVGLVTMPITVIKVRYESTLYA-----YNGLAEATRHIWRSEGAR 156

Query: 67  RLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVE--------KLTQSLS-ILSGAS 117
             +KG ++  L +AP         ++ +++  R             KLT   S +++G S
Sbjct: 157 GFFKGAAATTLRDAPYAGLYVLLYEQAKEMLPRALPATLLGADESGKLTAPASAMVNGVS 216

Query: 118 A---GCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHG 174
           A         +  PF+ +K R+Q + S   G +  +R I+ +E    +++GL   L R  
Sbjct: 217 AFLSASLATTLTAPFDTIKTRMQ-LQSHPVGFVQTLRHIVCEERARTLFDGLSLRLCRKA 275

Query: 175 VWNAGYFGIIFQVRALL 191
           +     +GI  ++  LL
Sbjct: 276 MSACIAWGIYEELLKLL 292

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 55.8 bits (133), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 71/314 (22%), Positives = 127/314 (40%), Gaps = 69/314 (21%)

Query: 14  AAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGIS 73
            AG+V+G+    + YP + +KT +QL         ++ VV      V        + G S
Sbjct: 14  TAGSVSGLFSATITYPFEFLKTGLQL---------HRNVVAAKPFEVLGYQVRTYFAGCS 64

Query: 74  SPVLMEAPKRATKFACNDEFQKIYKREFGVEK---LTQSLSILSGASAGCCEAFVVVPFE 130
           +  +    K + +F   D+  + + R   + K   L+    +++GA  G  E+  ++PFE
Sbjct: 65  AVNIGVVMKTSLRFLAFDKASE-WLRPPALAKDAPLSGVQLLMAGALTGTMESLCIIPFE 123

Query: 131 LVKI-----------RLQDVSSSYKG----------------------------PIDVVR 151
            VK+           RL   +S+ +G                            P +V+ 
Sbjct: 124 NVKVAMIQNSLLSHERLNTTTSNVQGQVANEVKKTFHKKPTLRSSYEALFPEKLPTNVLT 183

Query: 152 ---KIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAG 208
              ++  Q G+ A + G   TL R      G   + F    +L +   K  Q  N+    
Sbjct: 184 TAAELYRQHGLRAYFKGTMPTLMRQ----VGNSVVRFTTFTMLKQFAPKEYQ--NNEYFA 237

Query: 209 SIGGTIGSLM----STPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKG 264
           ++ G I S      + P DV+K+R+Q           Y  S    + I+ EEGF  L+KG
Sbjct: 238 TLLGLISSCAVVGATQPLDVIKTRMQ----AKDSVLLYRNSINCAYRIFVEEGFAMLWKG 293

Query: 265 FVPKVLRLGPGGGI 278
           ++P+++++G  G +
Sbjct: 294 WLPRLMKVGLSGSV 307

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/135 (18%), Positives = 55/135 (40%), Gaps = 5/135 (3%)

Query: 51  GVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSL 110
            V+    ++  + G    +KG    ++ +      +F      ++   +E+   +  +  
Sbjct: 180 NVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQFAPKEY---QNNEYF 236

Query: 111 SILSGASAGCCEAFVVVPFELVKIRLQ--DVSSSYKGPIDVVRKIIAQEGVLAMYNGLES 168
           + L G  + C       P +++K R+Q  D    Y+  I+   +I  +EG   ++ G   
Sbjct: 237 ATLLGLISSCAVVGATQPLDVIKTRMQAKDSVLLYRNSINCAYRIFVEEGFAMLWKGWLP 296

Query: 169 TLWRHGVWNAGYFGI 183
            L + G+  +  FGI
Sbjct: 297 RLMKVGLSGSVSFGI 311

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 53.1 bits (126), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 86/182 (47%), Gaps = 22/182 (12%)

Query: 105 KLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSS---YKGPIDVVRKIIAQEGVLA 161
           K   S++ ++G  AG     VV PFE VKI LQ  SS+     G I+ V ++  +EGV  
Sbjct: 8   KQESSIAFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAG 67

Query: 162 MYNGLESTLWRHGVWNAGYFGI-------IFQVRALLPEAKSKSQQTRNDLIAGSIGGTI 214
           ++ G      R   ++A  F +       IF V   + + +  + Q    L AG++ G +
Sbjct: 68  LFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQ---RLSAGALCGGM 124

Query: 215 GSLMSTPFDVVKSRIQ-NTAVVAGGAR-------KYNWSWPSIFTIYKEE-GFRALYKGF 265
             L + P D+V++R+   TA +A  ++       K    W  +   +KEE G R LY+G 
Sbjct: 125 SVLATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIRGLYRGI 184

Query: 266 VP 267
            P
Sbjct: 185 YP 186

 Score = 43.9 bits (102), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 59/127 (46%), Gaps = 5/127 (3%)

Query: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGI 72
           F AG VAG     V+ P + VK  +Q+Q S        G+++ + Q+  +EG + L++G 
Sbjct: 15  FIAGGVAGAVSRTVVSPFERVKILLQVQSS--TSAYNHGIINAVGQVYKEEGVAGLFRGN 72

Query: 73  SSPVLMEAPKRATKFACNDEFQK-IYKRE--FGVEKLTQSLSILSGASAGCCEAFVVVPF 129
               +   P  A +F   +  +K I+  +   G E+L     + +GA  G        P 
Sbjct: 73  GLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLATYPL 132

Query: 130 ELVKIRL 136
           +LV+ RL
Sbjct: 133 DLVRTRL 139

 Score = 38.1 bits (87), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 42/89 (47%), Gaps = 5/89 (5%)

Query: 199 QQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSW-PSIFTIYKEEG 257
           Q++    IAG + G +   + +PF+ VK  +Q    V      YN     ++  +YKEEG
Sbjct: 9   QESSIAFIAGGVAGAVSRTVVSPFERVKILLQ----VQSSTSAYNHGIINAVGQVYKEEG 64

Query: 258 FRALYKGFVPKVLRLGPGGGILLVVFTGC 286
              L++G     +R+ P   +  VV+  C
Sbjct: 65  VAGLFRGNGLNCVRIFPYSAVQFVVYEWC 93

 Score = 34.7 bits (78), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 12/72 (16%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYK----------GVVDCIKQIVA 61
           + +AGA+ G   +L  YPLD+V+TR+ +Q +  L    K          GV + + +   
Sbjct: 114 RLSAGALCGGMSVLATYPLDLVRTRLSIQ-TANLAKLSKSKAKDIAKPPGVWELLVKTFK 172

Query: 62  KEGASR-LYKGI 72
           +EG  R LY+GI
Sbjct: 173 EEGGIRGLYRGI 184

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 57/285 (20%), Positives = 115/285 (40%), Gaps = 29/285 (10%)

Query: 16  GAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSP 75
           G   G++  + + PLD++KTR+Q      L    K + D   Q+      S L   I S 
Sbjct: 17  GFFGGLTSAVALQPLDLLKTRIQQDKKATLWKNLKEI-DSPLQLWRGTLPSALRTSIGSA 75

Query: 76  VLME---------APKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVV 126
           + +          A +R    +  ++   +Y +   + +LT   ++L+GA A     ++ 
Sbjct: 76  LYLSCLNLMRSSLAKRRNAVPSLTNDSNIVYNKSSSLPRLTMYENLLTGAFARGLVGYIT 135

Query: 127 VPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQ 186
           +P  ++K+R +    +Y    + +  I  +EG+   + G  +T  R   +   Y  +  +
Sbjct: 136 MPITVIKVRYESTLYNYSSLKEAITHIYTKEGLFGFFRGFGATCLRDAPYAGLYVLLYEK 195

Query: 187 VRALLPEAKSKSQQTRN-------------DLIAGSIGGTIGSLMSTPFDVVKSRIQNTA 233
            + LLP          N             +  +  +  ++ + ++ PFD +K+R+Q   
Sbjct: 196 SKQLLPMVLPSRFIHYNPEGGFTTYTSTTVNTTSAVLSASLATTVTAPFDTIKTRMQ--- 252

Query: 234 VVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGI 278
                  K+  S+ +  +I K E    L+ G   ++ R     GI
Sbjct: 253 ---LEPSKFTNSFNTFTSIVKNENVLKLFSGLSMRLARKAFSAGI 294

 Score = 31.2 bits (69), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 40/93 (43%), Gaps = 15/93 (16%)

Query: 200 QTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFR 259
           +  + LI G  GG   ++   P D++K+RIQ          K    W ++  I   +   
Sbjct: 9   RNSSHLIGGFFGGLTSAVALQPLDLLKTRIQQD--------KKATLWKNLKEI---DSPL 57

Query: 260 ALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRT 292
            L++G +P  LR   G  + L     C++  R+
Sbjct: 58  QLWRGTLPSALRTSIGSALYL----SCLNLMRS 86

 Score = 28.1 bits (61), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 39/197 (19%), Positives = 79/197 (40%), Gaps = 34/197 (17%)

Query: 108 QSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLE 167
            S  ++ G   G   A  + P +L+K R+Q    +      + + +   +  L ++ G  
Sbjct: 10  NSSHLIGGFFGGLTSAVALQPLDLLKTRIQQDKKA-----TLWKNLKEIDSPLQLWRGTL 64

Query: 168 STLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRND-------------------LIAG 208
            +  R  + +A Y   +  +R+ L + ++      ND                   L+ G
Sbjct: 65  PSALRTSIGSALYLSCLNLMRSSLAKRRNAVPSLTNDSNIVYNKSSSLPRLTMYENLLTG 124

Query: 209 SIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSW--PSIFTIYKEEGFRALYKGFV 266
           +    +   ++ P  V+K R ++T         YN+S    +I  IY +EG    ++GF 
Sbjct: 125 AFARGLVGYITMPITVIKVRYESTL--------YNYSSLKEAITHIYTKEGLFGFFRGFG 176

Query: 267 PKVLRLGPGGGILLVVF 283
              LR  P  G+ ++++
Sbjct: 177 ATCLRDAPYAGLYVLLY 193

>Scas_717.20
          Length = 356

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 63/314 (20%), Positives = 121/314 (38%), Gaps = 67/314 (21%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYK-------GVVDCIKQIVAKEGASR 67
           AG ++G     ++ PLD +K   Q        P Y        G+ +  K I   +G   
Sbjct: 38  AGGISGSCAKTLIAPLDRIKILFQTS-----NPHYTKYAGSLVGLKEAAKHIWLNDGIRG 92

Query: 68  LYKGISSPVLMEAPKRATKFACNDEFQK--IYKREFGVEKLTQSLSILSGASAGCCEAFV 125
            ++G S  ++   P  A KF   ++ +   I  +E+     +    ++SG+ AG C  F 
Sbjct: 93  FFQGHSVTLMRIFPYAAVKFVAYEQIRNTLIPSKEYE----SHWRRLMSGSLAGLCSVFT 148

Query: 126 VVPFELVKIRLQDVSSS-------------------------------------YKGPID 148
             P +L+++RL  V+                                       Y+G   
Sbjct: 149 TYPLDLIRVRLAYVTEHKRISLLGLVKTIYKEPASTTLEAKGYIPNWFAHWCNFYRGYTP 208

Query: 149 VVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQ----QTRND 204
            V  +I   GV    + L   + +H +     + ++    +   E   K Q    +T  +
Sbjct: 209 TVLGMIPYAGVSFFAHDLLHDVLKHPI--LAPYSVLALSESEQEERHFKHQRLPLRTWAE 266

Query: 205 LIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFT----IYKEEGFRA 260
           L++G + G      + PF++++ R+Q + +    ++ Y+  + SI      IYKE G+R 
Sbjct: 267 LLSGGLAGMASQTAAYPFEIIRRRLQVSTLSV--SQMYDHRFQSISEIAKIIYKERGWRG 324

Query: 261 LYKGFVPKVLRLGP 274
            + G     +++ P
Sbjct: 325 FFVGLSIGYIKVTP 338

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 78/194 (40%), Gaps = 39/194 (20%)

Query: 113 LSGASAGCCEAFVVVPFELVKIRLQDVSSSYK-------GPIDVVRKIIAQEGVLAMYNG 165
           L+G  +G C   ++ P + +KI  Q  +  Y        G  +  + I   +G+   + G
Sbjct: 37  LAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFFQG 96

Query: 166 LESTLWRHGVWNAGYFGIIFQVR-ALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDV 224
              TL R   + A  F    Q+R  L+P  + +S   R  L++GS+ G      + P D+
Sbjct: 97  HSVTLMRIFPYAAVKFVAYEQIRNTLIPSKEYESHWRR--LMSGSLAGLCSVFTTYPLDL 154

Query: 225 VKSRI----QNTAVVAGGARKYNWSWPSIFTIYKEEGFRAL----------------YKG 264
           ++ R+    ++  +   G  K         TIYKE     L                Y+G
Sbjct: 155 IRVRLAYVTEHKRISLLGLVK---------TIYKEPASTTLEAKGYIPNWFAHWCNFYRG 205

Query: 265 FVPKVLRLGPGGGI 278
           + P VL + P  G+
Sbjct: 206 YTPTVLGMIPYAGV 219

 Score = 32.7 bits (73), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 40/85 (47%), Gaps = 3/85 (3%)

Query: 6   PLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQ---LQVSGGLGPQYKGVVDCIKQIVAK 62
           PL  + +  +G +AG++     YP ++++ R+Q   L VS     +++ + +  K I  +
Sbjct: 260 PLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKE 319

Query: 63  EGASRLYKGISSPVLMEAPKRATKF 87
            G    + G+S   +   P  A  F
Sbjct: 320 RGWRGFFVGLSIGYIKVTPMVACSF 344

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 81/174 (46%), Gaps = 19/174 (10%)

Query: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIK--QIVAKEGASRL-Y 69
           + AG + GI     +YP+D +K R+Q      L  + +G+   IK  + + +EG  RL Y
Sbjct: 299 YVAGGLGGIMAQFSVYPIDTLKFRIQ---CAPLDTRCRGLPLLIKTAKDMYREGGLRLFY 355

Query: 70  KGISSPVLMEAPKRATKFACNDEFQKIY-KREFGVEKLTQSLSILS-------GASAGCC 121
           +G+   +L   P  A         ++ Y  R      ++++  ++S       GA +G  
Sbjct: 356 RGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTV 415

Query: 122 EAFVVVPFELVKIRLQDVSS-----SYKGPIDVVRKIIAQEGVLAMYNGLESTL 170
            A VV P  L++ RLQ   +      Y G  DV RK + +EG+  +Y GL  TL
Sbjct: 416 GATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPTL 469

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 44/85 (51%)

Query: 16  GAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSP 75
           GA +G     V+YP+++++TR+Q Q +     +Y G  D  ++ V +EG   LYKG+   
Sbjct: 409 GAFSGTVGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVPT 468

Query: 76  VLMEAPKRATKFACNDEFQKIYKRE 100
           +    P  A  + C +  ++  + E
Sbjct: 469 LAKVCPAVAISYLCYENLKRAMRLE 493

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/252 (20%), Positives = 106/252 (42%), Gaps = 24/252 (9%)

Query: 52  VVDCIKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVE------K 105
           +V     +  + G    Y G    V+   P+ A KF   +  +++     G+E      +
Sbjct: 236 LVKAATSLYRQGGLRAFYLGNGLNVIKVFPESAMKFGSFELAKRVLA---GLEGCGETGE 292

Query: 106 LTQSLSILSGASAGCCEAFVVVPFELVKIRLQ--DVSSSYKGP---IDVVRKIIAQEGVL 160
           L++  + ++G   G    F V P + +K R+Q   + +  +G    I   + +  + G+ 
Sbjct: 293 LSRLSTYVAGGLGGIMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYREGGLR 352

Query: 161 AMYNGLESTL---WRHGVWNAGYFGII---FQVRALLPEAKSKSQQTRNDLIA---GSIG 211
             Y GL   +   + +   + G F  +   +  R       S+++   ++L+    G+  
Sbjct: 353 LFYRGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFS 412

Query: 212 GTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLR 271
           GT+G+ +  P +++++R+Q     A   R Y+          + EG   LYKG VP + +
Sbjct: 413 GTVGATVVYPINLLRTRLQAQGTYAHPHR-YDGFQDVFRKTVQREGLPGLYKGLVPTLAK 471

Query: 272 LGPGGGILLVVF 283
           + P   I  + +
Sbjct: 472 VCPAVAISYLCY 483

 Score = 32.3 bits (72), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 57/146 (39%), Gaps = 22/146 (15%)

Query: 168 STLWRHGVWNAGYFGIIFQVRALLPEAKSK--------------------SQQTR-NDLI 206
           ++L+R G   A Y G    V  + PE+  K                     + +R +  +
Sbjct: 241 TSLYRQGGLRAFYLGNGLNVIKVFPESAMKFGSFELAKRVLAGLEGCGETGELSRLSTYV 300

Query: 207 AGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFV 266
           AG +GG +      P D +K RIQ  A +    R       +   +Y+E G R  Y+G  
Sbjct: 301 AGGLGGIMAQFSVYPIDTLKFRIQ-CAPLDTRCRGLPLLIKTAKDMYREGGLRLFYRGLG 359

Query: 267 PKVLRLGPGGGILLVVFTGCMDFFRT 292
             +L + P   + L  F+    ++ T
Sbjct: 360 VGILGVFPYAALDLGTFSALKRWYIT 385

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/278 (21%), Positives = 113/278 (40%), Gaps = 34/278 (12%)

Query: 10  FYQFAAGAVAGISEILVM-YPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRL 68
           F   A GA   + E+  +  PL+V KT M          +  G    ++ + ++ G    
Sbjct: 17  FSNIALGAALNMCEVTTLGQPLEVTKTTMAAN-------RQFGFSQAVRHVWSRGGVFGF 69

Query: 69  YKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVP 128
           Y+G+     +EA  +           +   R  G+        IL G S G  +A++ + 
Sbjct: 70  YQGLIPWAWIEASTKGAVLLFVSAEAEYQFRRLGLSNF--GAGILGGVSGGVAQAYLTMG 127

Query: 129 F----ELVKIRLQDVSSSYKGPI----DVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGY 180
           F    + V+I     +S+   P+     V ++I A EG+  +  G+ +   R        
Sbjct: 128 FCTCMKTVEITRSKAASAPGVPVPSSLQVFKQIFAAEGLRGINKGVNAVAIRQMT----N 183

Query: 181 FGIIFQVRALLPEAKSKSQQTRND--------LIAGSIGGTIGSLMSTPFDVVKSRIQNT 232
           +G  F +  L+ +   +    R+D        ++A ++GG + S  + P +V++  +Q+ 
Sbjct: 184 WGSRFGLSRLVEDGIRRVTHKRSDEKLSAMEKIVASALGGGL-SAWNQPIEVIRVEMQSR 242

Query: 233 AVVAGGARKYNWSWPSIFT-IYKEEGFRALYKGFVPKV 269
                  R  N +    F  IY+  G R LY+G  P++
Sbjct: 243 TNDPN--RPKNLTVGKTFRYIYENNGLRGLYRGVTPRI 278

>Scas_613.24
          Length = 177

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 73/170 (42%), Gaps = 2/170 (1%)

Query: 1   MTDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIV 60
           M+D  P    +   +G + G+S  + + PLD++KTR+Q      L    K + D I Q  
Sbjct: 1   MSDKSPKTSVH-LVSGFIGGLSSAVTLQPLDLLKTRIQQHKGATLWSAIKDIKDPI-QFW 58

Query: 61  AKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGC 120
                S L   I S + +           + +      +   + +LT   ++L+GA A  
Sbjct: 59  RGTLPSALRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTGAMARG 118

Query: 121 CEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTL 170
              ++ +P  ++K+R +    SYK   + ++ I   EG+   + G   T+
Sbjct: 119 LVGYITMPITILKVRYESTYYSYKSMNEAIKDIYKMEGISGFFKGFGPTV 168

 Score = 36.2 bits (82), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 43/96 (44%), Gaps = 15/96 (15%)

Query: 197 KSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEE 256
           KS +T   L++G IGG   ++   P D++K+RIQ          K    W +I  I    
Sbjct: 4   KSPKTSVHLVSGFIGGLSSAVTLQPLDLLKTRIQQ--------HKGATLWSAIKDIKDPI 55

Query: 257 GFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFFRT 292
            F   ++G +P  LR   G  + L     C++  RT
Sbjct: 56  QF---WRGTLPSALRTSIGSALYL----SCLNIMRT 84

 Score = 32.7 bits (73), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 72/173 (41%), Gaps = 25/173 (14%)

Query: 109 SLSILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPI--DVVRKIIAQEGVLAMYNGL 166
           S+ ++SG   G   A  + P +L+K R+Q     +KG      ++ I   +  +  + G 
Sbjct: 9   SVHLVSGFIGGLSSAVTLQPLDLLKTRIQQ----HKGATLWSAIKDI---KDPIQFWRGT 61

Query: 167 ESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTR----------NDLIAGSIGGTIGS 216
             +  R  + +A Y   +  +R  L   K  S  ++           +L+ G++   +  
Sbjct: 62  LPSALRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYENLLTGAMARGLVG 121

Query: 217 LMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKV 269
            ++ P  ++K R ++T         Y     +I  IYK EG    +KGF P V
Sbjct: 122 YITMPITILKVRYESTYY------SYKSMNEAIKDIYKMEGISGFFKGFGPTV 168

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 81/186 (43%), Gaps = 19/186 (10%)

Query: 3   DARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKG---VVDCIKQI 59
           D + L  F  + AG +AG++    +YP+D +K R+Q      L  + KG   +    K +
Sbjct: 341 DTKDLSKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQ---CAPLDTKLKGNNLLFQTAKDM 397

Query: 60  VAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIY-KREFGVEKLTQSLSILS---- 114
             + G    Y+G++  ++   P  A         +K Y  ++     L Q    LS    
Sbjct: 398 FREGGLRLFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVV 457

Query: 115 ---GASAGCCEAFVVVPFELVKIRLQDVSSS-----YKGPIDVVRKIIAQEGVLAMYNGL 166
              GA +G   A VV P  L++ RLQ   +      Y G  DV+ K + +EG   ++ GL
Sbjct: 458 LPMGAFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGL 517

Query: 167 ESTLWR 172
             TL +
Sbjct: 518 VPTLAK 523

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 64/294 (21%), Positives = 123/294 (41%), Gaps = 30/294 (10%)

Query: 17  AVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSPV 76
           A   +S IL+    D++       ++    P  K V    K +  + G    Y G    V
Sbjct: 257 ARTDLSSILLNSKTDLLAKNPNADINKISSPLAKAV----KSLYRQGGIKAFYVGNGLNV 312

Query: 77  LMEAPKRATKFACNDEFQKIYKREFG---VEKLTQSLSILSGASAGCCEAFVVVPFELVK 133
           +   P+ + KF   +  +KI  +  G    + L++  + ++G  AG    F V P + +K
Sbjct: 313 IKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLSKFSTYIAGGLAGMAAQFSVYPIDTLK 372

Query: 134 IRLQ--DVSSSYKGP---IDVVRKIIAQEGVLAMYNGLESTL---WRHGVWNAGYFG--- 182
            R+Q   + +  KG        + +  + G+   Y G+   +   + +   + G F    
Sbjct: 373 FRVQCAPLDTKLKGNNLLFQTAKDMFREGGLRLFYRGVTVGIVGIFPYAALDLGTFSALK 432

Query: 183 ---IIFQVRAL-LPEAKSKSQQTRNDLIA---GSIGGTIGSLMSTPFDVVKSRIQNTAVV 235
              I  Q + L LP+     Q T ++L+    G+  GT+G+ +  P +++++R+Q     
Sbjct: 433 KWYIAKQAKTLNLPQ----DQVTLSNLVVLPMGAFSGTVGASVVYPINLLRTRLQAQGTY 488

Query: 236 AGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDF 289
           A     YN     +    + EG++ L+KG VP + ++ P   I  + +     F
Sbjct: 489 AH-PYVYNGFKDVLLKTLEREGYQGLFKGLVPTLAKVCPAVSISYLCYENLKKF 541

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 42/85 (49%)

Query: 16  GAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSP 75
           GA +G     V+YP+++++TR+Q Q +      Y G  D + + + +EG   L+KG+   
Sbjct: 461 GAFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVPT 520

Query: 76  VLMEAPKRATKFACNDEFQKIYKRE 100
           +    P  +  + C +  +K    E
Sbjct: 521 LAKVCPAVSISYLCYENLKKFMNLE 545

>Scas_328.1
          Length = 227

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 37/69 (53%), Gaps = 2/69 (2%)

Query: 9   FFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRL 68
           F   F  G    IS     YPLD V+ RM +  + G   +YKG +DC +QIV++EG   L
Sbjct: 136 FLPSFLLGWAVTISASTTSYPLDTVRRRMMM--TSGQAVKYKGAIDCFQQIVSQEGVYSL 193

Query: 69  YKGISSPVL 77
           +KG  + + 
Sbjct: 194 FKGCGANIF 202

 Score = 49.3 bits (116), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 94/215 (43%), Gaps = 16/215 (7%)

Query: 76  VLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPF--ELVK 133
           V+   P +A  FA  D+ + ++  + G  +L Q +    G    C  +F +V     L K
Sbjct: 2   VIRYFPTQALNFAFKDKIKAMFGFQQGKRRLYQMVYGECGIRWMCRCSFPIVCLFLRLCK 61

Query: 134 IRLQDVSSS--------YKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIF 185
             +   + S        + G +DV +K +  +GVL +Y G   ++    V+   YFG+  
Sbjct: 62  NEIGSDAKSIKSGAPRKFNGILDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYD 121

Query: 186 QVRALLPEAKSKSQQTRNDLIAGSIGGTI-GSLMSTPFDVVKSRIQNTAVVAGGARKYNW 244
            ++ +L     ++    + L+  ++  TI  S  S P D V+ R+  T+   G A KY  
Sbjct: 122 SLKPVLLTGSFENAFLPSFLLGWAV--TISASTTSYPLDTVRRRMMMTS---GQAVKYKG 176

Query: 245 SWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGIL 279
           +      I  +EG  +L+KG    + R     G++
Sbjct: 177 AIDCFQQIVSQEGVYSLFKGCGANIFRGVAAAGVI 211

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 73/166 (43%), Gaps = 18/166 (10%)

Query: 41  VSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKRE 100
           +  G   ++ G++D  K+ +  +G   LY+G    V+     R   F   D  + +    
Sbjct: 71  IKSGAPRKFNGILDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLYFGLYDSLKPVL--- 127

Query: 101 FGVEKLTQSL------SILSGASAGCCEAFVVVPFELVKIRLQDVSSS---YKGPIDVVR 151
                LT S       S L G +     +    P + V+ R+   S     YKG ID  +
Sbjct: 128 -----LTGSFENAFLPSFLLGWAVTISASTTSYPLDTVRRRMMMTSGQAVKYKGAIDCFQ 182

Query: 152 KIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSK 197
           +I++QEGV +++ G  + ++R GV  AG   +  Q++ LL   K K
Sbjct: 183 QIVSQEGVYSLFKGCGANIFR-GVAAAGVISLYDQLQLLLFGRKFK 227

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 65/299 (21%), Positives = 110/299 (36%), Gaps = 34/299 (11%)

Query: 10  FYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLY 69
            +   AG+V+G+    V  P+D VK R QLQ++     +Y G++   + +  +EG   L+
Sbjct: 25  LHAVVAGSVSGLVARSVTAPMDTVKIRRQLQLAS--EHKYHGILHTFRTVAREEGVRALW 82

Query: 70  KGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPF 129
           KG      M     + +F     +        G+     SL++  GA AG   + +  P 
Sbjct: 83  KGNVPASAMYVLYGSLQFGTY-AWLNTAAASAGLPPQAHSLAV--GALAGLVSSLLTYPL 139

Query: 130 ELVKIRL-QDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAG----YFGII 184
           +L++ RL  + S+ +       R I   EG    + G        G W         G+I
Sbjct: 140 DLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRG--------GAWAIAATTLTTGLI 191

Query: 185 FQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNW 244
           F +      A            A    G +      P D V+ R+Q   +V      +  
Sbjct: 192 FGIYETCTIAADTYGLPWLAAAASPTAGLVSKAAVFPLDTVRRRLQ---IVDAKHIPFFT 248

Query: 245 SWPSIFT-------------IYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGCMDFF 290
             P  ++             + + EG  +LYKG    + +  P   I L V+  C+   
Sbjct: 249 RDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 71/179 (39%), Gaps = 25/179 (13%)

Query: 8   PFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASR 67
           P  +  A GA+AG+   L+ YPLD+++TR+    S      +  +    + I   EG + 
Sbjct: 117 PQAHSLAVGALAGLVSSLLTYPLDLLRTRLVANRSA----HFFSLRRQARVIWDTEGPAG 172

Query: 68  LYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVV 127
            ++G +  +          F    E   I    +G+  L  + S     +AG      V 
Sbjct: 173 FFRGGAWAIAATTLTTGLIFGIY-ETCTIAADTYGLPWLAAAAS----PTAGLVSKAAVF 227

Query: 128 PFELVKIRLQDVSSSY-------KGPIDVVR---------KIIAQEGVLAMYNGLESTL 170
           P + V+ RLQ V + +        G    +R          ++  EG+ ++Y GL   L
Sbjct: 228 PLDTVRRRLQIVDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMAL 286

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 79/183 (43%), Gaps = 13/183 (7%)

Query: 3   DARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAK 62
           D   L     + AG + G++    +YP+D +K R+Q         +   ++   K++  +
Sbjct: 313 DTSELSRLSTYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQ 372

Query: 63  EGASRLYKGISSPVLMEAPKRATKFACNDEFQKIY-KREFGVEKLTQSLSILS------- 114
            G    Y+G+   V+   P  A         +K Y K+E     L +   I+S       
Sbjct: 373 GGIRLFYRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPM 432

Query: 115 GASAGCCEAFVVVPFELVKIRLQDVSS-----SYKGPIDVVRKIIAQEGVLAMYNGLEST 169
           GA +G   A +V P  L++ RLQ   +     +Y G  DV++K I +EG   ++ GL   
Sbjct: 433 GAFSGTVGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPN 492

Query: 170 LWR 172
           L +
Sbjct: 493 LAK 495

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 45/85 (52%)

Query: 16  GAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSP 75
           GA +G     ++YP+++++TR+Q Q +      Y G  D +K+ + +EG   L+KG+   
Sbjct: 433 GAFSGTVGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPN 492

Query: 76  VLMEAPKRATKFACNDEFQKIYKRE 100
           +    P  +  + C +  +++ K E
Sbjct: 493 LAKVCPAVSISYLCYENLKRLMKLE 517

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/234 (23%), Positives = 103/234 (44%), Gaps = 22/234 (9%)

Query: 64  GASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILS----GASAG 119
           G    Y G    V+   P+ A KF   +  ++I  R   V K T  LS LS    G   G
Sbjct: 272 GLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENV-KDTSELSRLSTYIAGGLGG 330

Query: 120 CCEAFVVVPFELVKIRLQ--DVSSSYKGP---IDVVRKIIAQEGVLAMYNGLE---STLW 171
               F V P + +K R+Q   ++++ K     +   +++  Q G+   Y G+      ++
Sbjct: 331 VAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQGGIRLFYRGVHIGVMGIF 390

Query: 172 RHGVWNAGYFGIIFQVRALLPEAKS----KSQQTRNDLIA---GSIGGTIGSLMSTPFDV 224
            +   + G F  + +   +  EAK     + +   ++LI    G+  GT+G+ +  P ++
Sbjct: 391 PYAALDLGTFSAL-KKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGTVGATLVYPINL 449

Query: 225 VKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGI 278
           +++R+Q     A     YN     +    + EG++ L+KG VP + ++ P   I
Sbjct: 450 LRTRLQAQGTYAH-PHTYNGFSDVLKKTIQREGYQGLFKGLVPNLAKVCPAVSI 502

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 81/205 (39%), Gaps = 28/205 (13%)

Query: 113 LSGASAGCCEAFVVVPFELVKIRL---QDVSSSYKGPIDVVRKIIAQEGVLAMYNGL--- 166
           ++G  +G        PF+ +K+ L    D+SS+     D +        +  + + L   
Sbjct: 204 IAGGCSGVVSRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSPLIKA 263

Query: 167 ESTLWRHGVWNAGYFGIIFQVRALLPEA--------------------KSKSQQTR-NDL 205
            +TL+R G   A Y G    V  + PE+                    K  S+ +R +  
Sbjct: 264 ATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENVKDTSELSRLSTY 323

Query: 206 IAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGF 265
           IAG +GG        P D +K RIQ  A +    +K +    +   +Y++ G R  Y+G 
Sbjct: 324 IAGGLGGVAAQFSVYPIDTLKYRIQ-CAPLNTNLKKSSILLQTAKEMYQQGGIRLFYRGV 382

Query: 266 VPKVLRLGPGGGILLVVFTGCMDFF 290
              V+ + P   + L  F+    ++
Sbjct: 383 HIGVMGIFPYAALDLGTFSALKKWY 407

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/189 (21%), Positives = 83/189 (43%), Gaps = 20/189 (10%)

Query: 104 EKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMY 163
           E+   +  ++ G S G   A ++ PF+L+K RLQ   +S      + + + + E    ++
Sbjct: 3   EQRRATTHLIGGFSGGLVSAIILQPFDLLKTRLQQDKTS-----TLWKTLKSIETPSQLW 57

Query: 164 NGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQ---------QTRNDLIAGSIGGTI 214
            G   +  R  V +A Y  ++  +R  + + K+                ++ +G++   +
Sbjct: 58  RGALPSCIRTSVGSAMYLTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRAL 117

Query: 215 GSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGP 274
             L++ P  V+K R ++T       R Y  S      I++ EG R  ++GF    LR  P
Sbjct: 118 TGLITMPITVIKVRYESTLYQYTSLR-YATS-----HIFRTEGLRGFFRGFGATALRDAP 171

Query: 275 GGGILLVVF 283
             G+ ++ +
Sbjct: 172 YAGLYMLFY 180

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/284 (20%), Positives = 108/284 (38%), Gaps = 37/284 (13%)

Query: 16  GAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSP 75
           G   G+   +++ P D++KTR+Q   +  L    K +          E  S+L++G    
Sbjct: 14  GFSGGLVSAIILQPFDLLKTRLQQDKTSTLWKTLKSI----------ETPSQLWRGALPS 63

Query: 76  VLMEAPKRATKFA-CNDEFQKIYK-REFG------VEKLTQSLSILSGASAGCCEAFVVV 127
            +  +   A      N   Q I K +  G      + +L    ++ SGA        + +
Sbjct: 64  CIRTSVGSAMYLTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRALTGLITM 123

Query: 128 PFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQV 187
           P  ++K+R +     Y         I   EG+   + G  +T  R   +   Y     ++
Sbjct: 124 PITVIKVRYESTLYQYTSLRYATSHIFRTEGLRGFFRGFGATALRDAPYAGLYMLFYDRM 183

Query: 188 RALLP----------EAKSKSQQTRNDLIAGS---IGGTIGSLMSTPFDVVKSRIQNTAV 234
           + L+P           + ++     + LI GS       I + ++ PFD VK+R+Q    
Sbjct: 184 KVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSAAVIATSITAPFDTVKTRMQLEPA 243

Query: 235 VAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGI 278
                 K++    + + I  +E  R L+ G   ++ R     GI
Sbjct: 244 ------KFHSFTSTFWHIATKESVRNLFAGISLRLTRKAFSAGI 281

 Score = 34.7 bits (78), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 43/88 (48%), Gaps = 11/88 (12%)

Query: 196 SKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKE 255
           S+ ++    LI G  GG + +++  PFD++K+R+Q          K +  W ++ +I   
Sbjct: 2   SEQRRATTHLIGGFSGGLVSAIILQPFDLLKTRLQQD--------KTSTLWKTLKSI--- 50

Query: 256 EGFRALYKGFVPKVLRLGPGGGILLVVF 283
           E    L++G +P  +R   G  + L + 
Sbjct: 51  ETPSQLWRGALPSCIRTSVGSAMYLTML 78

>Kwal_47.19228
          Length = 281

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 45/75 (60%), Gaps = 4/75 (5%)

Query: 5   RPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEG 64
           +PL  +Y FA G ++  + + V  P+DV+KTRMQ + +      YK  ++C  +I  +EG
Sbjct: 180 KPLNEYYAFALGFISSCAVVAVTQPIDVIKTRMQSKYTWS---NYKNSLNCAYRIFVEEG 236

Query: 65  ASRLYKGISSPVLME 79
            ++ +KG  +P LM+
Sbjct: 237 FTKFWKGW-APRLMK 250

 Score = 43.5 bits (101), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 63/142 (44%), Gaps = 16/142 (11%)

Query: 147 IDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLI 206
           +  V++I    G+     G   T+ R    +A  F     ++ ++   K  ++     L 
Sbjct: 132 LTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMISPNKPLNEYYAFAL- 190

Query: 207 AGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWS-----WPSIFTIYKEEGFRAL 261
            G I       ++ P DV+K+R+Q+         KY WS         + I+ EEGF   
Sbjct: 191 -GFISSCAVVAVTQPIDVIKTRMQS---------KYTWSNYKNSLNCAYRIFVEEGFTKF 240

Query: 262 YKGFVPKVLRLGPGGGILLVVF 283
           +KG+ P+++++G  GG+   V+
Sbjct: 241 WKGWAPRLMKVGLSGGVSFGVY 262

 Score = 35.0 bits (79), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 41/220 (18%), Positives = 75/220 (34%), Gaps = 44/220 (20%)

Query: 13  FAAGAVAGISEILVMYPLDVVKTRM-----QLQVSGGLGPQYKGVVD------------- 54
            AAG + G  E L++ P + +KT M      L       PQ K  V              
Sbjct: 53  LAAGVITGFMESLLVIPFENIKTTMIENALLLSERANAEPQEKKKVTVQPRATFHSQKKA 112

Query: 55  ---------------------CIKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEF 93
                                 +++I    G     +G    ++ +    A +F      
Sbjct: 113 LHPRQKWALYYDEHPSRQFLTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSL 172

Query: 94  QKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQD--VSSSYKGPIDVVR 151
           +++       + L +  +   G  + C    V  P +++K R+Q     S+YK  ++   
Sbjct: 173 KQMISPN---KPLNEYYAFALGFISSCAVVAVTQPIDVIKTRMQSKYTWSNYKNSLNCAY 229

Query: 152 KIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALL 191
           +I  +EG    + G    L + G+     FG+   V  L+
Sbjct: 230 RIFVEEGFTKFWKGWAPRLMKVGLSGGVSFGVYQYVDNLM 269

>Kwal_23.3042
          Length = 542

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 81/186 (43%), Gaps = 19/186 (10%)

Query: 3   DARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKG---VVDCIKQI 59
           D   L  F  + AG + G+   L +YP+D +K R+Q      L  + KG   ++   K +
Sbjct: 338 DTAGLSRFSTYLAGGLGGVMAQLSVYPIDTLKYRVQ---CAPLNTESKGRQLLISTAKDM 394

Query: 60  VAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIY----KREFGVEKLTQSLS---- 111
             + G    Y+GI+  ++   P  A         +K Y     R  G+ +   ++S    
Sbjct: 395 YKEGGLRIFYRGITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFV 454

Query: 112 ILSGASAGCCEAFVVVPFELVKIRLQDVSS-----SYKGPIDVVRKIIAQEGVLAMYNGL 166
           +L GA +G   A  V P  L++ RLQ   +      Y G  DV+ K + +EG   ++ GL
Sbjct: 455 LLMGAFSGTVGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGL 514

Query: 167 ESTLWR 172
              L +
Sbjct: 515 VPNLAK 520

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 98/219 (44%), Gaps = 26/219 (11%)

Query: 81  PKRATKFACNDEFQKIYKREFGVEK---LTQSLSILSGASAGCCEAFVVVPFELVKIRLQ 137
           P+ A KF   +  +++  +  GV+    L++  + L+G   G      V P + +K R+Q
Sbjct: 314 PESAIKFGSFELAKRLMAQLEGVQDTAGLSRFSTYLAGGLGGVMAQLSVYPIDTLKYRVQ 373

Query: 138 --DVSSSYKGP---IDVVRKIIAQEGVLAMYNGLE---STLWRHGVWNAGYFG------I 183
              +++  KG    I   + +  + G+   Y G+      ++ +   + G F       I
Sbjct: 374 CAPLNTESKGRQLLISTAKDMYKEGGLRIFYRGITVGIMGIFPYAAMDLGTFSALKKWYI 433

Query: 184 IFQVRAL-LPEAKSKSQQTRND---LIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGA 239
             Q R   LPE     Q T ++   L+ G+  GT+G+    P +++++R+Q     A   
Sbjct: 434 ARQARLTGLPE----DQVTMSNMFVLLMGAFSGTVGATAVYPVNLLRTRLQAQGTFAHPH 489

Query: 240 RKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGI 278
           R YN     +    + EG++ L+KG VP + ++ P   I
Sbjct: 490 R-YNGFRDVLLKTVQREGYQGLFKGLVPNLAKVCPAVSI 527

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 43/85 (50%)

Query: 16  GAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSP 75
           GA +G      +YP+++++TR+Q Q +     +Y G  D + + V +EG   L+KG+   
Sbjct: 458 GAFSGTVGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGLVPN 517

Query: 76  VLMEAPKRATKFACNDEFQKIYKRE 100
           +    P  +  + C +  ++  K E
Sbjct: 518 LAKVCPAVSISYLCYENLKRGMKLE 542

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/206 (21%), Positives = 82/206 (39%), Gaps = 28/206 (13%)

Query: 112 ILSGASAGCCEAFVVVPFELVKIRL---QDVSSSYKGPIDVVRKIIAQEGVLAMYNGL-- 166
            ++G  +G        PF+ +K+ L    D+SS++    D++ +      +  + + L  
Sbjct: 228 FIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSPLVK 287

Query: 167 -ESTLWRHGVWNAGYFGIIFQVRALLPEAKSK----------------SQQTR-----ND 204
             +TL+R G   A Y G       + PE+  K                 Q T      + 
Sbjct: 288 AATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQLEGVQDTAGLSRFST 347

Query: 205 LIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKG 264
            +AG +GG +  L   P D +K R+Q  A +   ++       +   +YKE G R  Y+G
Sbjct: 348 YLAGGLGGVMAQLSVYPIDTLKYRVQ-CAPLNTESKGRQLLISTAKDMYKEGGLRIFYRG 406

Query: 265 FVPKVLRLGPGGGILLVVFTGCMDFF 290
               ++ + P   + L  F+    ++
Sbjct: 407 ITVGIMGIFPYAAMDLGTFSALKKWY 432

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 70/153 (45%), Gaps = 13/153 (8%)

Query: 128 PFELVKIRLQ----DVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGI 183
           P   +  +LQ    D ++  K  ++ +++I  ++G+L  Y GLES ++   + N  Y+  
Sbjct: 33  PLVTITTKLQTQGNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALTNFVYYYF 92

Query: 184 I-FQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKY 242
                R +L   K K   T   ++ G + G++ ++ S P  V  +R+  T       +  
Sbjct: 93  YELTSRNVLKVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRMTVT-------KSE 145

Query: 243 NWSWPSIFTIYKEEGFRALYKGFVPK-VLRLGP 274
             +  +I  I K++  + L+ G  P  VL + P
Sbjct: 146 KTALATIIEIVKKDSAKTLFNGLKPALVLVMNP 178

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 66/148 (44%), Gaps = 8/148 (5%)

Query: 26  VMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRAT 85
           + YPL  + T++Q Q       Q K  ++ IK+I  K+G    Y G+ S +   A    T
Sbjct: 30  LTYPLVTITTKLQTQ-GNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMA---LT 85

Query: 86  KFACNDEFQKIYKREFGV---EKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSS 142
            F     ++   +    V   +KL    S+L+G  AG   A    P  +   R+  V+ S
Sbjct: 86  NFVYYYFYELTSRNVLKVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRMT-VTKS 144

Query: 143 YKGPIDVVRKIIAQEGVLAMYNGLESTL 170
            K  +  + +I+ ++    ++NGL+  L
Sbjct: 145 EKTALATIIEIVKKDSAKTLFNGLKPAL 172

 Score = 36.2 bits (82), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 34/74 (45%), Gaps = 12/74 (16%)

Query: 11  YQFAAGAVAGISEILVMYPLDVVKTRMQLQVSG------------GLGPQYKGVVDCIKQ 58
           + F  GA+  ++     YP   +KTRM L  SG            G     K ++  I +
Sbjct: 205 WAFLLGALGKLAATGSTYPYITLKTRMHLSESGKHTDDDSGKKAKGHKASSKSMLSLITE 264

Query: 59  IVAKEGASRLYKGI 72
           IV K+G S LY+G+
Sbjct: 265 IVKKDGVSGLYRGV 278

 Score = 29.3 bits (64), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 37/179 (20%), Positives = 67/179 (37%), Gaps = 24/179 (13%)

Query: 5   RPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEG 64
           + L        G VAG    +   P+ V  TRM +  S       K  +  I +IV K+ 
Sbjct: 107 KKLNTLESMLTGCVAGSVTAIASNPIWVANTRMTVTKSE------KTALATIIEIVKKDS 160

Query: 65  ASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAF 124
           A  L+ G+  P L+       ++   ++ + +         L+ S + L GA        
Sbjct: 161 AKTLFNGLK-PALVLVMNPIVQYTVFEQLKNLVLAWNKQGILSPSWAFLLGALGKLAATG 219

Query: 125 VVVPFELVKIRLQDVSS-----------------SYKGPIDVVRKIIAQEGVLAMYNGL 166
              P+  +K R+    S                 S K  + ++ +I+ ++GV  +Y G+
Sbjct: 220 STYPYITLKTRMHLSESGKHTDDDSGKKAKGHKASSKSMLSLITEIVKKDGVSGLYRGV 278

>Scas_687.15*
          Length = 328

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 73/331 (22%), Positives = 126/331 (38%), Gaps = 69/331 (20%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKG 71
           Q  AG+ A + E  + YP + +KT  QL         ++  V   K   A       + G
Sbjct: 11  QILAGSAAAVFETTLTYPFEFLKTGFQL---------HRRTVGA-KPFEALRPIKVYFAG 60

Query: 72  ISSPVLMEAPKRATKFACNDEFQKIYKREFGVEK---LTQSLSILSGASAGCCEAFVVVP 128
            ++  L    K + +FA  D+  +I  R+  + K   L     +L+G   G  E+  ++P
Sbjct: 61  CTALNLSAIVKTSVRFATFDKACQIL-RDPNLPKDSLLKGPRLLLAGILTGAVESLCIIP 119

Query: 129 FELVKIRL-----------------------------------------QDVSSSYKGP- 146
           FE VK+ +                                         + V S Y    
Sbjct: 120 FENVKVTMIENSLQLSESKPTEKEIAGTLKKKVTFHVAKPKQLSPQEQWRQVYSKYPSSN 179

Query: 147 -IDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDL 205
              VV++I    G+     G   T++R    +   F     ++ L+        Q  N++
Sbjct: 180 IFSVVKEIYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTLKQLI-----SPTQPLNEV 234

Query: 206 IAGSIG---GTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALY 262
            A  IG         ++ P DVVK+R+Q+          Y  S    + ++ EEG  +L+
Sbjct: 235 YAFGIGLFSSCAVVALTQPIDVVKTRMQSKT----AHYFYKNSLNCAYRVFVEEGMVSLW 290

Query: 263 KGFVPKVLRLGPGGGILLVVFTGCMDFFRTL 293
           KG++P++ ++G  GGI   V+    +   TL
Sbjct: 291 KGWLPRLFKVGLSGGISFGVYQYVENLSHTL 321

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 38/71 (53%), Gaps = 3/71 (4%)

Query: 1   MTDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIV 60
           ++  +PL   Y F  G  +  + + +  P+DVVKTRMQ + +      YK  ++C  ++ 
Sbjct: 225 ISPTQPLNEVYAFGIGLFSSCAVVALTQPIDVVKTRMQSKTAHYF---YKNSLNCAYRVF 281

Query: 61  AKEGASRLYKG 71
            +EG   L+KG
Sbjct: 282 VEEGMVSLWKG 292

>Scas_578.3*
          Length = 524

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 66/307 (21%), Positives = 122/307 (39%), Gaps = 44/307 (14%)

Query: 10  FYQFAAGAVAGISEILVMYPLDVVKT---------------RMQLQVSG-GLGPQYKGVV 53
           F  F AG ++G+       PLD +K                +M L++ G  L      ++
Sbjct: 209 FGYFIAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSPII 268

Query: 54  DCIKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSIL 113
             I+ +  + G    Y G    V    P+ + KF   +  +++     G +KL   LS L
Sbjct: 269 KAIRSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSG-DKLVNDLSKL 327

Query: 114 ----SGASAGCCEAFVVVPFELVKIRLQ--DVSSSYKGP---IDVVRKIIAQEGVLAMYN 164
               +G  AG      + P + +K R+Q   +  + KG    I   +++  + G+   Y 
Sbjct: 328 QTYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEGGIRVFYR 387

Query: 165 GL---ESTLWRHGVWNAGYFG------IIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIG 215
           G+      ++ +   + G F       I  Q + L    K         L  G+  GT+G
Sbjct: 388 GVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMGAFSGTVG 447

Query: 216 SLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIY----KEEGFRALYKGFVPKVLR 271
           +    P +++++R+Q     A G   + +++     ++    K EG    YKG VP +++
Sbjct: 448 ATAVYPINLLRTRLQ-----AQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPTLVK 502

Query: 272 LGPGGGI 278
           + P   I
Sbjct: 503 VCPAVSI 509

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 42/88 (47%)

Query: 7   LPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGAS 66
           L +      GA +G      +YP+++++TR+Q Q +      Y G  D   Q + +EG  
Sbjct: 431 LSYLLVLPMGAFSGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVP 490

Query: 67  RLYKGISSPVLMEAPKRATKFACNDEFQ 94
             YKG+   ++   P  +  + C ++F+
Sbjct: 491 GFYKGLVPTLVKVCPAVSIGYLCYEKFK 518

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 82/205 (40%), Gaps = 34/205 (16%)

Query: 113 LSGASAGCCEAFVVVPFELVKIRL---QDVSSSYKGP------------------IDVVR 151
           LSG  +  C A    P + +K+ L    D+SS+   P                  I  +R
Sbjct: 217 LSGVISRTCTA----PLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSPIIKAIR 272

Query: 152 KIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDL------ 205
            +  Q G+ A Y G   ++++    ++  FG     + L+  A     +  NDL      
Sbjct: 273 SLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLM--ANLSGDKLVNDLSKLQTY 330

Query: 206 IAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGF 265
           +AG I G +  +   P D +K RIQ  A + G  +       +   +YKE G R  Y+G 
Sbjct: 331 VAGGIAGVMAQISIYPIDTLKFRIQ-CAPLEGNLKGNALLISTAKEMYKEGGIRVFYRGV 389

Query: 266 VPKVLRLGPGGGILLVVFTGCMDFF 290
           +   L + P   + L  F+    ++
Sbjct: 390 LLGALGIFPYAALDLGTFSALKKWY 414

>Kwal_55.21338
          Length = 323

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 62/140 (44%), Gaps = 8/140 (5%)

Query: 132 VKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWN-AGYFGIIFQVRAL 190
            K++ QD         D ++ I  ++G +  + GLES L+   + N   Y+      R +
Sbjct: 48  TKLQTQDAKGEKLSLADTIKDIYRKDGAMGFFAGLESALFGTTLSNFVYYYCYEASSRCV 107

Query: 191 LPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIF 250
           L    ++   T   ++ GSI G++ +  + P  V  +R+       G       +  +IF
Sbjct: 108 LRARHTQRLTTAESMLVGSIAGSLNATAANPLWVANTRMTVQKSDRG-------TLSTIF 160

Query: 251 TIYKEEGFRALYKGFVPKVL 270
            I K+EG   L+KG  P ++
Sbjct: 161 DIVKDEGISGLFKGLNPALI 180

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 69/158 (43%), Gaps = 14/158 (8%)

Query: 16  GAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSP 75
           G++AG        PL V  TRM +Q S       +G +  I  IV  EG S L+KG+ +P
Sbjct: 125 GSIAGSLNATAANPLWVANTRMTVQKSD------RGTLSTIFDIVKDEGISGLFKGL-NP 177

Query: 76  VLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKIR 135
            L+       ++   ++ +           L+ S + + GA           P+  +K R
Sbjct: 178 ALILVINPIIQYTVYEQLKNWILSSRQTRTLSPSWAFILGAVGKLAATGSTYPYVTMKAR 237

Query: 136 LQ---DVSSSYKGP----IDVVRKIIAQEGVLAMYNGL 166
           +    +  SS   P    + ++ +II ++G+L +Y G+
Sbjct: 238 MHLLGEHKSSTAAPPRSLLSLMAEIIKKDGILGLYRGI 275

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 4/71 (5%)

Query: 5   RPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQL---QVSGGLGPQYKGVVDCIKQIVA 61
           R L   + F  GAV  ++     YP   +K RM L     S    P  + ++  + +I+ 
Sbjct: 206 RTLSPSWAFILGAVGKLAATGSTYPYVTMKARMHLLGEHKSSTAAPP-RSLLSLMAEIIK 264

Query: 62  KEGASRLYKGI 72
           K+G   LY+GI
Sbjct: 265 KDGILGLYRGI 275

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/259 (22%), Positives = 111/259 (42%), Gaps = 13/259 (5%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISS 74
           AG++ G + I V YPL  + T +Q + +     + +  ++ IK+I  K G    + G+ S
Sbjct: 17  AGSLGGAASIAVTYPLVTITTNLQTKEN-----EARPKLETIKEIYNKNGIIGYFLGLES 71

Query: 75  PVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKI 134
            V   A      +   +   K  +     + L+   SIL+   AG   A    P  +   
Sbjct: 72  AVYGMATTNFVYYYFYEWCAKTARTLTTKQYLSTWESILASTIAGSMTAVASNPIWVANT 131

Query: 135 RLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGY-FGIIFQVRALLPE 193
           R+  V+ S    +  V  I+  +G L + NGL+  L    V N    + +  Q++ L+  
Sbjct: 132 RM-TVAKSNHSTLRTVIDIVKTDGPLTLLNGLKPALVL--VSNPIIQYTVYEQLKNLVLR 188

Query: 194 AKSKSQQTRN-DLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTI 252
            + K   + +   + G+IG    +  + P+  +K+R+    ++    +     W  I  I
Sbjct: 189 LQRKKVLSPSWAFLLGAIGKLAATGTTYPYITLKTRMH---LMQNDPKHQKSMWSLIVEI 245

Query: 253 YKEEGFRALYKGFVPKVLR 271
            K++G   LY G   K+++
Sbjct: 246 VKKDGVSGLYNGVAVKLVQ 264

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/160 (19%), Positives = 69/160 (43%), Gaps = 10/160 (6%)

Query: 113 LSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWR 172
           ++G+  G     V  P   +   LQ   +  +  ++ +++I  + G++  + GLES ++ 
Sbjct: 16  IAGSLGGAASIAVTYPLVTITTNLQTKENEARPKLETIKEIYNKNGIIGYFLGLESAVYG 75

Query: 173 HGVWNAGYFGIIFQVRALLPEAKSKSQ--QTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQ 230
               N  Y+   ++  A      +  Q   T   ++A +I G++ ++ S P  V  +R+ 
Sbjct: 76  MATTNFVYY-YFYEWCAKTARTLTTKQYLSTWESILASTIAGSMTAVASNPIWVANTRMT 134

Query: 231 NTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVL 270
                   A+  + +  ++  I K +G   L  G  P ++
Sbjct: 135 -------VAKSNHSTLRTVIDIVKTDGPLTLLNGLKPALV 167

 Score = 35.4 bits (80), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 4/64 (6%)

Query: 11  YQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQY-KGVVDCIKQIVAKEGASRLY 69
           + F  GA+  ++     YP   +KTRM L  +    P++ K +   I +IV K+G S LY
Sbjct: 199 WAFLLGAIGKLAATGTTYPYITLKTRMHLMQND---PKHQKSMWSLIVEIVKKDGVSGLY 255

Query: 70  KGIS 73
            G++
Sbjct: 256 NGVA 259

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
          Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 46.2 bits (108), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 43/83 (51%), Gaps = 2/83 (2%)

Query: 7  LPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGG--LGPQYKGVVDCIKQIVAKEG 64
          L   Y+ A GA++G     ++YP D+++ R Q+   GG  LG +YK V D +  I   EG
Sbjct: 8  LANLYKLAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEG 67

Query: 65 ASRLYKGISSPVLMEAPKRATKF 87
              YKG+++ +    P  A  +
Sbjct: 68 PKGYYKGLTANLFKVIPSTAVSW 90

 Score = 36.2 bits (82), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 7/83 (8%)

Query: 205 LIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSI----FTIYKEEGFRA 260
           L  G+I G +   +  PFD+++ R Q   V+A G  +  + + S+     TI K EG + 
Sbjct: 14  LAMGAISGGVAQTLVYPFDLLRRRFQ---VLAMGGNELGFRYKSVSDALITIGKTEGPKG 70

Query: 261 LYKGFVPKVLRLGPGGGILLVVF 283
            YKG    + ++ P   +  +V+
Sbjct: 71  YYKGLTANLFKVIPSTAVSWLVY 93

 Score = 27.7 bits (60), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 7/65 (10%)

Query: 115 GASAGCCEAFVVVPFELVKIRLQ-------DVSSSYKGPIDVVRKIIAQEGVLAMYNGLE 167
           GA +G     +V PF+L++ R Q       ++   YK   D +  I   EG    Y GL 
Sbjct: 17  GAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEGPKGYYKGLT 76

Query: 168 STLWR 172
           + L++
Sbjct: 77  ANLFK 81

>Kwal_55.21106
          Length = 328

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 66/289 (22%), Positives = 117/289 (40%), Gaps = 40/289 (13%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQ-------VSGGLGPQ----------YKGVVDCIK 57
            GAVA     +V+YPLD+VKT +Q Q          G+ PQ          YK  +D + 
Sbjct: 9   TGAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDALI 68

Query: 58  QIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVE----KLTQSLSIL 113
           +I   +G   LY+G+ + ++    +  + F      +K + R   +     K +    +L
Sbjct: 69  KIFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLGKFSTPEELL 128

Query: 114 SGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPI-DVVRKIIA-QEGVLAMYNGLESTLW 171
            G  A         P  ++  R Q  +S  KG   +V+ +I + Q  +   + G + +L 
Sbjct: 129 LGIVAAAVSQIFTSPIGVISTRQQTSTSGSKGGFREVLHQIYSEQNNITGFWRGFKVSLI 188

Query: 172 ---RHGVWNAGYFGI----IFQVRALLPEAK----SKSQQTRNDLIAGSIGGTIGSLMST 220
                 +  A Y  +    I   RA+    +    S     R + + G     I +L++ 
Sbjct: 189 LTVNPSITFASYEKLQDIFITSKRAVDENGQLLETSGQLSPRQNFLLGVFSKVISTLITQ 248

Query: 221 PFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKV 269
           P  V K+ +Q T         +      +  +YK+EG  +L+KG  P++
Sbjct: 249 PLIVSKAYLQRT------GSNFQSFQQVLLYLYKQEGLISLWKGLAPQL 291

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 86/212 (40%), Gaps = 38/212 (17%)

Query: 111 SILSGASAGCCEAFVVVPFELVKIRLQDVSSS----------------------YKGPID 148
           S ++GA A      VV P +LVK  +Q  +                        YK  +D
Sbjct: 6   SAITGAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLD 65

Query: 149 VVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYF---GIIFQ--VRALLPEAKSKSQQTRN 203
            + KI   +GVL +Y GL +++    + +  YF    I+ +   R  L   +     T  
Sbjct: 66  ALIKIFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLGKFSTPE 125

Query: 204 DLIAGSIGGTIGSLMSTPFDVVKSRIQ-NTAVVAGGARKYNWSWPSIFTIYKEE-GFRAL 261
           +L+ G +   +  + ++P  V+ +R Q +T+   GG R+       +  IY E+      
Sbjct: 126 ELLLGIVAAAVSQIFTSPIGVISTRQQTSTSGSKGGFREV------LHQIYSEQNNITGF 179

Query: 262 YKGF-VPKVLRLGPGGGILLVVFTGCMDFFRT 292
           ++GF V  +L + P   I    +    D F T
Sbjct: 180 WRGFKVSLILTVNP--SITFASYEKLQDIFIT 209

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 45/79 (56%), Gaps = 4/79 (5%)

Query: 1   MTDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIV 60
           ++  +PL  +Y F  G ++  + + V  P+DV+KTRMQ + +      YK  ++C  +I 
Sbjct: 315 ISPNKPLNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQSKYAWA---NYKNSLNCAYRIF 371

Query: 61  AKEGASRLYKGISSPVLME 79
            +EG  + +KG  +P LM+
Sbjct: 372 VEEGIPKFWKGW-APRLMK 389

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 64/336 (19%), Positives = 119/336 (35%), Gaps = 101/336 (30%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVS------GGLGPQYK------------GVVDCI 56
           AG+ A + +  + YP + +KT +QL  S        +  Q+K             +   +
Sbjct: 100 AGSCASVFQTTISYPFEFLKTGLQLHRSLPNAHPFNMMHQFKYYFSGCAALNVGTLFKTV 159

Query: 57  KQIVAKEGASRLYKGISSP-VLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSG 115
            +    E A +L K  SSP   +  P+                             +++G
Sbjct: 160 TRFTTFEKACQLLKDPSSPSAFISGPRL----------------------------LMAG 191

Query: 116 ASAGCCEAFVVVPFELVKIRLQD----VSSSYKGPID----------------------- 148
           A  G  E+  VVPFE +K  + +    +S  ++  I+                       
Sbjct: 192 AITGFMESLWVVPFENIKTTMVENALVLSGRFQKEIEDKGKAETGSKREVRATFHKQTPG 251

Query: 149 ---------------------VVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQV 187
                                 V++I    G+     G   T++R    +A  F     +
Sbjct: 252 ISPRERLFLHYEEHPTSRFFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSL 311

Query: 188 RALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWP 247
           + L+  + +K        + G I       ++ P DV+K+R+Q+    A     Y  S  
Sbjct: 312 KQLI--SPNKPLNEYYAFVLGFISSCAVVAVTQPIDVIKTRMQSKYAWAN----YKNSLN 365

Query: 248 SIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
             + I+ EEG    +KG+ P+++++G  GG+   V+
Sbjct: 366 CAYRIFVEEGIPKFWKGWAPRLMKVGLSGGVSFGVY 401

 Score = 35.4 bits (80), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 26/138 (18%), Positives = 57/138 (41%), Gaps = 5/138 (3%)

Query: 56  IKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSG 115
           +K+I    G     +G +  +  +    A +F      +++       + L +  + + G
Sbjct: 274 VKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLKQLISPN---KPLNEYYAFVLG 330

Query: 116 ASAGCCEAFVVVPFELVKIRLQD--VSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRH 173
             + C    V  P +++K R+Q     ++YK  ++   +I  +EG+   + G    L + 
Sbjct: 331 FISSCAVVAVTQPIDVIKTRMQSKYAWANYKNSLNCAYRIFVEEGIPKFWKGWAPRLMKV 390

Query: 174 GVWNAGYFGIIFQVRALL 191
           G+     FG+   V  L+
Sbjct: 391 GLSGGVSFGVYQYVENLI 408

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 65/299 (21%), Positives = 110/299 (36%), Gaps = 72/299 (24%)

Query: 28  YPLDVVKTRMQLQVSGG----LGPQYKG-VVDCIKQIVAKEGASRLYKGISSPVLMEAPK 82
           YP + +KT +QLQ  G     + PQ K   V C    VA  G + L              
Sbjct: 3   YPFEYLKTGLQLQPKGTAFEIILPQIKSYFVGCSALNVAAFGKTIL-------------- 48

Query: 83  RATKFACNDEF----QKIYKREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKIRL-Q 137
              +F   D+               ++LT    +++G   G  E+  ++PFE +K  L Q
Sbjct: 49  ---RFVTFDKLCHSLNNNIDNNDNFQRLTGYNLLIAGTLTGIVESLFIIPFENIKTTLIQ 105

Query: 138 DVSSSYK----------------------GPIDVVRKII-------AQEGVLAMYNGLES 168
                +K                       P+  + K++          G  A   G  +
Sbjct: 106 SAMIDHKKLEKNQPVVNAKATFHKVATKSTPVARIEKLLPAVKHMYQTRGPAAFVQGTTA 165

Query: 169 TLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSL----MSTPFDV 224
           T++R     +  F      + LL        Q RND  +  I G   S     M+ P DV
Sbjct: 166 TIFRQIANTSIQFTAYTAFKRLL--------QARNDKASSVITGLATSFTLVAMTQPIDV 217

Query: 225 VKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
           VK+R+ +         +Y  +   ++ I+ +EG    +KG + + +++G  GG+   V+
Sbjct: 218 VKTRMMS----QNAKTEYKNTLNCMYRIFVQEGMATFWKGSIFRFMKVGISGGLTFTVY 272

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKG 71
            G     + + +  P+DVVKTRM   +S     +YK  ++C+ +I  +EG +  +KG
Sbjct: 200 TGLATSFTLVAMTQPIDVVKTRM---MSQNAKTEYKNTLNCMYRIFVQEGMATFWKG 253

 Score = 38.5 bits (88), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/204 (18%), Positives = 85/204 (41%), Gaps = 32/204 (15%)

Query: 15  AGAVAGISEILVMYPLDVVKTRM---------QLQ--------------VSGGLGP--QY 49
           AG + GI E L + P + +KT +         +L+              V+    P  + 
Sbjct: 81  AGTLTGIVESLFIIPFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHKVATKSTPVARI 140

Query: 50  KGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQS 109
           + ++  +K +    G +   +G ++ +  +    + +F     F+++ +      +  ++
Sbjct: 141 EKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQ-----ARNDKA 195

Query: 110 LSILSGASAGCCEAFVVVPFELVKIRL--QDVSSSYKGPIDVVRKIIAQEGVLAMYNGLE 167
            S+++G +       +  P ++VK R+  Q+  + YK  ++ + +I  QEG+   + G  
Sbjct: 196 SSVITGLATSFTLVAMTQPIDVVKTRMMSQNAKTEYKNTLNCMYRIFVQEGMATFWKGSI 255

Query: 168 STLWRHGVWNAGYFGIIFQVRALL 191
               + G+     F +  QV  LL
Sbjct: 256 FRFMKVGISGGLTFTVYEQVSLLL 279

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 45/85 (52%)

Query: 16  GAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSP 75
           GA +G     V+YP+++++TR+Q Q +      Y G  D + + V +EG   L+KG+   
Sbjct: 429 GAFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLVPN 488

Query: 76  VLMEAPKRATKFACNDEFQKIYKRE 100
           +    P  +  + C + F+++ K E
Sbjct: 489 LAKVCPAVSISYLCYENFKRLMKLE 513

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 79/177 (44%), Gaps = 19/177 (10%)

Query: 10  FYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKG---VVDCIKQIVAKEGAS 66
           F  + AG + G+     +YP+D +K R+Q      L    KG   ++   +Q+    G  
Sbjct: 316 FSTYIAGGMGGVVAQFSVYPIDTLKYRVQ---CAPLDTALKGNELLISTARQMYRDGGLK 372

Query: 67  RLYKGISSPVLMEAPKRATKFACNDEFQKIY-KRE-----FGVEKLTQSLSIL--SGASA 118
             Y+G++  V+   P  A         +K Y  R+       V+++T S  I+   GA +
Sbjct: 373 LFYRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPMGAFS 432

Query: 119 GCCEAFVVVPFELVKIRLQDVSS-----SYKGPIDVVRKIIAQEGVLAMYNGLESTL 170
           G   A VV P  L++ RLQ   +     +Y G  DV+ K + +EG   ++ GL   L
Sbjct: 433 GTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLVPNL 489

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/247 (21%), Positives = 105/247 (42%), Gaps = 22/247 (8%)

Query: 64  GASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVE---KLTQSLSILSGASAGC 120
           G    Y G    V+   P+ A KF   +  +++     GV    +L++  + ++G   G 
Sbjct: 268 GIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSKFSTYIAGGMGGV 327

Query: 121 CEAFVVVPFELVKIRLQ--DVSSSYKGP---IDVVRKIIAQEGVLAMYNGLE---STLWR 172
              F V P + +K R+Q   + ++ KG    I   R++    G+   Y G+      ++ 
Sbjct: 328 VAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTARQMYRDGGLKLFYRGVTVGVMGIFP 387

Query: 173 HGVWNAGYFGII---FQVRALLPEAKSKSQQTRNDLIA---GSIGGTIGSLMSTPFDVVK 226
           +   + G F  +   +  R          Q T ++ I    G+  GT+G+ +  P ++++
Sbjct: 388 YAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPMGAFSGTVGATVVYPINLLR 447

Query: 227 SRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVFTGC 286
           +R+Q     A     Y      ++   + EG++ L+KG VP + ++ P   I  +    C
Sbjct: 448 TRLQAQGTYAH-PHTYTGFRDVLWKTVQREGYQGLFKGLVPNLAKVCPAVSISYL----C 502

Query: 287 MDFFRTL 293
            + F+ L
Sbjct: 503 YENFKRL 509

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 45/205 (21%), Positives = 82/205 (40%), Gaps = 28/205 (13%)

Query: 113 LSGASAGCCEAFVVVPFELVKIRL---QDVSSS---------YKGPIDVVRKIIA----- 155
           ++G  +G        PF+ +K+ L    D+SS+          K P   + KI +     
Sbjct: 200 IAGGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSPLIKA 259

Query: 156 ------QEGVLAMY--NGLES-TLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTR-NDL 205
                 Q G+ A Y  NGL    ++       G F +  Q+ A L      S+ ++ +  
Sbjct: 260 ATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSKFSTY 319

Query: 206 IAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGF 265
           IAG +GG +      P D +K R+Q  A +    +       +   +Y++ G +  Y+G 
Sbjct: 320 IAGGMGGVVAQFSVYPIDTLKYRVQ-CAPLDTALKGNELLISTARQMYRDGGLKLFYRGV 378

Query: 266 VPKVLRLGPGGGILLVVFTGCMDFF 290
              V+ + P   + L  F+    ++
Sbjct: 379 TVGVMGIFPYAALDLGTFSALKKWY 403

>Scas_705.9
          Length = 323

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 66/295 (22%), Positives = 123/295 (41%), Gaps = 55/295 (18%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQY----------KGVVDCIKQIVAKEG 64
            GA+A     +++YPLDV KT +Q +       +           + V+ C+ +I  K G
Sbjct: 9   TGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLIRIFRKRG 68

Query: 65  ASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKL--TQSLSILS-------- 114
              LY+G+S+ V     K    F     +  + ++ F ++ L  TQ+  I S        
Sbjct: 69  LRGLYQGMSTSVF---SKFVQSFCYFFWYSFLRRKYFSLKLLRNTQARPINSISTVEELI 125

Query: 115 -GASAGCCEAFVVVPFELVKIRLQDVSSSYKGPID---VVRKIIAQEGVLAMYNGLESTL 170
            G  A      V  P E++  + Q  ++  K  +D   V+++I  +       NG  S+ 
Sbjct: 126 VGVGAAALTQVVNNPIEVILTKQQ--TTDDKDNVDFYSVLKQIYVES------NGKLSSY 177

Query: 171 WR-------HGVWNAGYFGIIFQVRALLPEAKSKSQQT-------RNDLIAGSIGGTIGS 216
           W+         V  +  F    + + +L +  S S+++         + I G++   I +
Sbjct: 178 WKGFKVSLILTVNPSITFAAYQRFKDILLKQVSNSEKSYSGQLTVNQNFILGALAKIIST 237

Query: 217 LMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLR 271
           +++ P  V K  +Q +        K+      +  +YKEEG  AL+KG  P++ +
Sbjct: 238 IITQPLIVAKVSLQRS------NSKFKHFEEVLRYLYKEEGVLALWKGVGPQLTK 286

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/179 (24%), Positives = 76/179 (42%), Gaps = 22/179 (12%)

Query: 2   TDARPL---PFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVD---C 55
           T ARP+       +   G  A     +V  P++V+ T+ Q           K  VD    
Sbjct: 110 TQARPINSISTVEELIVGVGAAALTQVVNNPIEVILTKQQ-------TTDDKDNVDFYSV 162

Query: 56  IKQIVAKEGA--SRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVE------KLT 107
           +KQI  +     S  +KG    +++      T FA    F+ I  ++          +LT
Sbjct: 163 LKQIYVESNGKLSSYWKGFKVSLILTVNPSIT-FAAYQRFKDILLKQVSNSEKSYSGQLT 221

Query: 108 QSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGL 166
            + + + GA A      +  P  + K+ LQ  +S +K   +V+R +  +EGVLA++ G+
Sbjct: 222 VNQNFILGALAKIISTIITQPLIVAKVSLQRSNSKFKHFEEVLRYLYKEEGVLALWKGV 280

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 39/88 (44%), Gaps = 5/88 (5%)

Query: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKG 71
            F  GA+A I   ++  PL V K  +Q   S     ++K   + ++ +  +EG   L+KG
Sbjct: 225 NFILGALAKIISTIITQPLIVAKVSLQRSNS-----KFKHFEEVLRYLYKEEGVLALWKG 279

Query: 72  ISSPVLMEAPKRATKFACNDEFQKIYKR 99
           +   +      +   FA   E  K +KR
Sbjct: 280 VGPQLTKGVLVQGLVFAFKGELTKSWKR 307

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 49/97 (50%), Gaps = 7/97 (7%)

Query: 187 VRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSW 246
           V++L P    K+        AG++       ++ P DV+K+R+Q+          Y  S 
Sbjct: 237 VQSLSPH---KALDEYQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWF----TYKSSL 289

Query: 247 PSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
              + I+ EEGFR ++KG+VP++ ++   GGI   V+
Sbjct: 290 NCAYRIFVEEGFRYMWKGWVPRLFKVSLSGGISFGVY 326

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 41/71 (57%), Gaps = 3/71 (4%)

Query: 1   MTDARPLPFFYQFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIV 60
           ++  + L  +  FAAGA++  + + +  P+DV+KTRMQ + +      YK  ++C  +I 
Sbjct: 240 LSPHKALDEYQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWF---TYKSSLNCAYRIF 296

Query: 61  AKEGASRLYKG 71
            +EG   ++KG
Sbjct: 297 VEEGFRYMWKG 307

 Score = 28.5 bits (62), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 14/62 (22%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query: 106 LTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSS--SYKGPIDVVRKIIAQEGVLAMY 163
           L +  +  +GA +      +  P +++K R+Q  ++  +YK  ++   +I  +EG   M+
Sbjct: 246 LDEYQAFAAGALSSAAVVALTQPIDVIKTRMQSKTAWFTYKSSLNCAYRIFVEEGFRYMW 305

Query: 164 NG 165
            G
Sbjct: 306 KG 307

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 64/149 (42%), Gaps = 10/149 (6%)

Query: 132 VKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRAL- 190
           + +R    +  YKG +D +++I   EGV  +Y GL S+     + +  YF     VR   
Sbjct: 61  IALRSPQAAEQYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHY 120

Query: 191 --LPEAKSKSQQ--TRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSW 246
             L +A+    +  T  +L+ G +      L   P +VV +R Q     AG A     + 
Sbjct: 121 FRLKQARGGDARFSTPEELVLGIVAAATSQLFVNPINVVATRQQTRGQAAGAADMRTVAR 180

Query: 247 PSIFTIYKEEGFRALYKGF-VPKVLRLGP 274
                ++ E G+R  + G  V  VL + P
Sbjct: 181 E----VHAENGWRGFWAGLKVSLVLTVNP 205

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 61/301 (20%), Positives = 111/301 (36%), Gaps = 52/301 (17%)

Query: 16  GAVAGISEILVMYPLDVVKTRMQLQV------------------------------SGGL 45
           GA A     + +YPLD+ KT +Q Q+                              S   
Sbjct: 9   GATASSLANIAVYPLDLAKTLVQTQLKDEFVEAGEEAGEERAGSRRQNRIKPIALRSPQA 68

Query: 46  GPQYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKR----EF 101
             QYKG +D +++I   EG + LY+G+ S  +    +  + F      +K Y R      
Sbjct: 69  AEQYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHYFRLKQARG 128

Query: 102 GVEKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPID---VVRKIIAQEG 158
           G  + +    ++ G  A       V P  +V  R Q       G  D   V R++ A+ G
Sbjct: 129 GDARFSTPEELVLGIVAAATSQLFVNPINVVATR-QQTRGQAAGAADMRTVAREVHAENG 187

Query: 159 VLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRN--------DLIAGSI 210
               + GL+ +L      +  Y        AL P   + S    +        + + G +
Sbjct: 188 WRGFWAGLKVSLVLTVNPSITYATYERLREALFPTPAAASHLVDSAALLSPGQNFVMGVL 247

Query: 211 GGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVL 270
              + ++++ P  + K+ +Q +        +       +  +Y  EG  +L+KG  P++ 
Sbjct: 248 SKIVSTVLTQPLIIAKASLQRSGSCFQDFHQV------LHHLYSTEGPLSLWKGLGPQIT 301

Query: 271 R 271
           +
Sbjct: 302 K 302

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 68/309 (22%), Positives = 116/309 (37%), Gaps = 57/309 (18%)

Query: 10  FYQFAAGAVAGISEILVM-YPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRL 68
           F     GA   + E+  +  PL+VVKT M          Q+      I  I ++ G    
Sbjct: 15  FSNILLGAGLNMCEVTTLGQPLEVVKTTMAAN------RQFT-FFQAINHIWSRGGVFGF 67

Query: 69  YKGISSPVLMEAPKRATKF-----ACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEA 123
           Y+G+     +EA  +              F+K+    FG         I+ G S G  +A
Sbjct: 68  YQGLIPWAWIEASTKGAVLLFVSAEAEYHFKKLGLNNFGA-------GIMGGVSGGVAQA 120

Query: 124 FVVVPF-------ELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVW 176
           ++ + F       E+ K +    + + +      ++I  +EG+  +  G+ +   R    
Sbjct: 121 YLTMGFCTCMKTVEITKHK-SAAAGAKQSSWAAFKEIYNKEGIRGINKGVNAVAIRQMTN 179

Query: 177 NAGYFGIIFQVRALLPEAKSKSQ-----QTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQN 231
               FG    V   L +   K+           + A +IGG + S  + P +V++  +Q+
Sbjct: 180 WGSRFGFSRLVEEGLRKFTGKTNPDDKLTALEKIFASAIGGGL-SAWNQPIEVIRVEMQS 238

Query: 232 TA--------VVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
                     +  G A +Y         IY+  G + LY+G  P++     G GI   VF
Sbjct: 239 KTNDPNRPKDLTVGKAFRY---------IYQSNGVKGLYRGVTPRI-----GLGIWQTVF 284

Query: 284 -TGCMDFFR 291
             GC D  R
Sbjct: 285 MVGCGDIAR 293

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 59/301 (19%), Positives = 118/301 (39%), Gaps = 44/301 (14%)

Query: 3   DARPLPFFYQFAAGAVAGISEILVM-YPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVA 61
           + +P+ F      GA   +SE+  +  PL+VVKT M          +    ++ +K + +
Sbjct: 14  EKKPVSF-SNILLGACLNLSEVTTLGQPLEVVKTTMAAN-------RNFTFLESVKHVWS 65

Query: 62  KEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCC 121
           + G    Y+G+     +EA  +           +   +  G+        IL G + G  
Sbjct: 66  RGGILGYYQGLIPWAWIEASTKGAVLLFVSAEAEYRFKSLGLNNFASG--ILGGVTGGVT 123

Query: 122 EAFVVVPF-------ELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHG 174
           +A++ + F       E+ + +        +    V + I  +EG+  +  G+ +   R  
Sbjct: 124 QAYLTMGFCTCMKTVEITRHKSASAGGVPQSSWSVFKNIYKKEGIRGINKGVNAVAIRQM 183

Query: 175 VWNAGYFGIIFQVRALLPEAKSKSQQTR-----NDLIAGSIGGTIGSLMSTPFDVVKSRI 229
                 FG+   V   + +   K+ +         + A ++GG + S  + P +V++  +
Sbjct: 184 TNWGSRFGLSRLVEDGIRKITGKTNKDDKLNPFEKIGASALGGGL-SAWNQPIEVIRVEM 242

Query: 230 QNTAVVAGGARKYNWSWPSIFT-------IYKEEGFRALYKGFVPKVLRLGPGGGILLVV 282
           Q        ++K + + P   T       IY+  G + LY+G  P++     G GI   V
Sbjct: 243 Q--------SKKEDPNRPKNLTVGKTFKYIYQSNGLKGLYRGVTPRI-----GLGIWQTV 289

Query: 283 F 283
           F
Sbjct: 290 F 290

 Score = 33.5 bits (75), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 76/178 (42%), Gaps = 18/178 (10%)

Query: 103 VEKLTQSLS-ILSGASAGCCEAFVV-VPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVL 160
           +EK   S S IL GA     E   +  P E+VK  +   ++     ++ V+ + ++ G+L
Sbjct: 13  IEKKPVSFSNILLGACLNLSEVTTLGQPLEVVKTTM--AANRNFTFLESVKHVWSRGGIL 70

Query: 161 AMYNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTRN---DLIAGSIGGTIGSL 217
             Y GL    W      A   G +    +   E + KS    N    ++ G  GG   + 
Sbjct: 71  GYYQGLIPWAWIE----ASTKGAVLLFVSAEAEYRFKSLGLNNFASGILGGVTGGVTQAY 126

Query: 218 MSTPFDVVKSRIQNT---AVVAGGARKYNWSWPSIF-TIYKEEGFRALYKGFVPKVLR 271
           ++  F      ++ T   +  AGG  + +WS   +F  IYK+EG R + KG     +R
Sbjct: 127 LTMGFCTCMKTVEITRHKSASAGGVPQSSWS---VFKNIYKKEGIRGINKGVNAVAIR 181

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 62/291 (21%), Positives = 115/291 (39%), Gaps = 37/291 (12%)

Query: 10  FYQFAAGAVAGISEILVM-YPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRL 68
           F     GA   + E+  +  PL+V+KT M    S           + IK + ++ G    
Sbjct: 18  FSNILLGAGLNMCEVTTLGQPLEVIKTTMAANRSFSF-------FNAIKHVWSRGGVFGF 70

Query: 69  YKGISSPVLMEAPKRATKF---ACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFV 125
           Y+G+     +EA  +       +   E+Q  +KR  G+        I+ G + G  +A++
Sbjct: 71  YQGLIPWAWIEASTKGAVLLFVSAESEYQ--FKR-MGLSNFGSG--IMGGVTGGVAQAYL 125

Query: 126 VVPF-------ELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNA 178
            + F       E+ K +     +  +      ++I  ++G+  +  G+ +   R      
Sbjct: 126 TMGFCTCMKTVEITKKKSAGAGAIPQSSWGAFKEIYKKDGIKGINKGVNAVAIRQMTNWG 185

Query: 179 GYFGIIFQVRALLPEAKSKSQ-----QTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTA 233
             FG    V   +  A  K+           + A +IGG + S  + P +V++  +Q+  
Sbjct: 186 SRFGFSRLVEEGIRNATGKTNPDDKLTALEKIAASAIGGGL-SAWNQPIEVIRVEMQSKK 244

Query: 234 VVAGGARKYNWSWPSIFT-IYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
                 R  N +  S F  IY+  G + LY+G  P++     G G+   VF
Sbjct: 245 EDPN--RPKNLTVSSAFKYIYQSSGIKGLYRGVAPRI-----GLGVWQTVF 288

>Kwal_34.15907
          Length = 312

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 56/266 (21%), Positives = 106/266 (39%), Gaps = 49/266 (18%)

Query: 29  PLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAP-KRATKF 87
           PL+V+KT M    +   G         +K + ++ G    Y+G+     +EA  K A   
Sbjct: 38  PLEVIKTTMAANRNLNFG-------QSVKHVWSRGGVFGFYQGLIPWAWIEASTKGAVLL 90

Query: 88  ACNDEFQKIYKR----EFGVEKLTQSLSILSGASAGCCEAFVVVPFE--LVKIRLQDVSS 141
             + E +  +KR     FG         I+ G S G  +A++ + F   +  + +    S
Sbjct: 91  FVSAEAEYQFKRLGLGNFGA-------GIMGGVSGGVAQAYLTMGFCTCMKTVEITKAKS 143

Query: 142 SYKGPI-----DVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLPEAKS 196
           +  G I        ++I ++EG+  +  G+ +   R        FG+   V   + +   
Sbjct: 144 AVAGAIPQSSWSAFKEIYSKEGIKGINKGVNAVAIRQMTNWGSRFGLSRLVEQGIRDFTG 203

Query: 197 KSQ-----QTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTA--------VVAGGARKYN 243
           K+           + A ++GG + S  + P +V++  +Q+          +  G A KY 
Sbjct: 204 KTNPDDKLTALEKIFASALGGGL-SAWNQPIEVIRVEMQSKKEDPNRPKKLTVGSAFKY- 261

Query: 244 WSWPSIFTIYKEEGFRALYKGFVPKV 269
                   IY+  G + LY+G  P++
Sbjct: 262 --------IYQSSGIKGLYRGVAPRI 279

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 64/308 (20%), Positives = 116/308 (37%), Gaps = 59/308 (19%)

Query: 15  AGAVAGISEILVMYPLDVVKTRMQLQVS---------------------GGLGP------ 47
           +GAVA      V+YPLD+VKT +Q Q+                        + P      
Sbjct: 9   SGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDIPPVPIKLN 68

Query: 48  -----QYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRATKFACNDEFQKIYKREFG 102
                QY    D I +I  +EG   LY+G+++ V+    +  + F      +K Y R   
Sbjct: 69  ENNYLQYNSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFRVKL 128

Query: 103 VE----KLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSSYKGPID---VVRKII- 154
           +     K T    +L G  A         P  L+  R Q       G  D   V ++I  
Sbjct: 129 INRKNTKFTTIEELLLGIVAAATSQIFTNPISLISAR-QQTRQGIDGDNDFLTVAKEIYK 187

Query: 155 AQEGVLAMYNGLESTLW-----------RHGVWNAGYFGIIFQVRALLPEAKSKSQQTRN 203
            Q  +   + GL+ +L               + +A +      ++  L ++ S+    +N
Sbjct: 188 EQRSIKGFWKGLKVSLMLTINPSITYTSYEKLKDALFTTDTMNLKKELVDSSSQLSPYQN 247

Query: 204 DLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKEEGFRALYK 263
               G +   I ++++ P  + K+ +Q         ++       ++ +YK EG R+ +K
Sbjct: 248 -FTLGVLSKMISAIITMPLIISKAWLQRNGSNFSSFQQV------LYYLYKNEGLRSWWK 300

Query: 264 GFVPKVLR 271
           G  P++ +
Sbjct: 301 GLSPQLAK 308

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 58/142 (40%), Gaps = 15/142 (10%)

Query: 143 YKGPIDVVRKIIAQEGVLAMYNGLESTL-------WRHGVWNAGYFGIIFQVRALLPEAK 195
           Y    D + KI  QEG+  +Y GL +++       + +  W +      F+V+  L   K
Sbjct: 75  YNSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFRVK--LINRK 132

Query: 196 SKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFTIYKE 255
           +    T  +L+ G +      + + P  ++ +R Q    + G     N        IYKE
Sbjct: 133 NTKFTTIEELLLGIVAAATSQIFTNPISLISARQQTRQGIDGD----NDFLTVAKEIYKE 188

Query: 256 E-GFRALYKGF-VPKVLRLGPG 275
           +   +  +KG  V  +L + P 
Sbjct: 189 QRSIKGFWKGLKVSLMLTINPS 210

>Scas_696.9
          Length = 312

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 61/288 (21%), Positives = 112/288 (38%), Gaps = 31/288 (10%)

Query: 10  FYQFAAGAVAGISEILVM-YPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRL 68
           F     GA   ++E+  +  PL+VVKT M          +    V+ +K + ++ G    
Sbjct: 18  FSNIILGATINMAEVTSLGQPLEVVKTTMAAN-------RNLNFVNSMKYVWSRGGIVGF 70

Query: 69  YKGISSPVLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSIL-------SGASAGCC 121
           Y+G+     +EA  +           +   +  G+   T  +          S  + G C
Sbjct: 71  YQGLIPWAWIEASTKGAVLLFVSAESEYRFKLLGMGNFTSGILGGVLGGVTQSYLTMGFC 130

Query: 122 EAFVVVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYF 181
                V  E+ +++     +  +   +V R I A+EG+  +Y G+ +   R        F
Sbjct: 131 TCMKTV--EITRLKSASAGAPVQSSWNVFRSIYAKEGLRGIYKGVNAVAIRQMTNWGSRF 188

Query: 182 GIIFQVRALLPEAKSKSQ-----QTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVA 236
           G    V   + +A  K++          + A ++GG + S  + P +V++  +Q+     
Sbjct: 189 GFSRLVEDWVRKATGKTKPEDRLNAWEKIGATAVGGGL-SAWNQPIEVIRVEMQSKK--E 245

Query: 237 GGARKYNWSWPSIFT-IYKEEGFRALYKGFVPKVLRLGPGGGILLVVF 283
              R  N +    F  I K  G + LY+G  P++     G GI   VF
Sbjct: 246 DPNRPKNLTVAKTFKYIMKTNGVKGLYRGVTPRI-----GLGIWQTVF 288

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 69/308 (22%), Positives = 126/308 (40%), Gaps = 57/308 (18%)

Query: 3   DARPLPFFYQFAAGAVAGISEILVM-YPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVA 61
           + +P+ F      GA   +SE+  +  PL+VVKT M          +    +   K + +
Sbjct: 6   EKKPVSF-SNILLGAGLNLSEVTTLGQPLEVVKTTMAAH-------REFNFLQATKHVWS 57

Query: 62  KEGASRLYKGISSPVLMEAP-KRATKFACNDEFQKIYK----REFGVEKLTQSLSILSGA 116
           + G    Y+G+     +EA  K A     + E +  +K      FG         I+ G 
Sbjct: 58  RGGIFGFYQGLIPWAWIEASTKGAVLLFVSAEAEYRFKVLGLNNFGA-------GIMGGI 110

Query: 117 SAGCCEAFVVVPF----ELVKIRLQDVSSSYKGPI-----DVVRKIIAQEGVLAMYNGLE 167
           + G  +A++ + F    + V+I  Q  +++  G I      V + I  +EG+  +  G+ 
Sbjct: 111 TGGVTQAYLTMGFCTCMKTVEITRQK-AANVPGVIPQSSWQVFKSIYKKEGIRGINKGVN 169

Query: 168 STLWRHGVWNAGYFGIIFQVRALLPEAKSKSQQTR-----NDLIAGSIGGTIGSLMSTPF 222
           +   R        FG+   V   + +   K+ +         ++A +IGG + S  + P 
Sbjct: 170 AVAIRQMTNWGSRFGLSRLVEDGIRKLTGKTGKDDKLTALEKIMASAIGGGL-SAWNQPI 228

Query: 223 DVVKSRIQNTAVVAGGARKYNWSWPSIFT-------IYKEEGFRALYKGFVPKVLRLGPG 275
           +V++  +Q        ++K + + P   T       IY+  G + LY+G  P+V     G
Sbjct: 229 EVIRVEMQ--------SKKEDPNRPKNLTVGKTFKYIYQSNGLKGLYRGVTPRV-----G 275

Query: 276 GGILLVVF 283
            GI   VF
Sbjct: 276 LGIWQTVF 283

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 64/319 (20%), Positives = 124/319 (38%), Gaps = 74/319 (23%)

Query: 16  GAVAGISEILVMYPLDVVKTRMQLQVSGG------------------------------- 44
           GAV+     L +YPLD+ KT +Q Q+  G                               
Sbjct: 10  GAVSSGFANLAVYPLDLAKTVIQTQLKQGDLYPSSDVQADVSTKESTGSSKPKKHGIQQI 69

Query: 45  -------------LGPQYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRATKFACND 91
                        L  +YK  +D I ++   EG   LY G+S+ +L    +  + F    
Sbjct: 70  KPKPEPPTATKESLEQRYKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFWYT 129

Query: 92  EFQKIYKREFGVEKLTQSLS-----ILSGASAGCCEAFVVVPFELVKIRLQ-----DVSS 141
             ++ Y R   V+      S     +LS  +A   + F   P  +V  + Q     +  +
Sbjct: 130 LIRRHYFRVKKVKGEAARFSTIEELLLSMLAAATSQLF-TNPINIVSTKQQTRRGLEGDN 188

Query: 142 SYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFG------IIFQVRALLPEAK 195
           S+K    + +++  ++G+   +  L+ +L      +  Y        I++ V     +  
Sbjct: 189 SFKA---IAKEVYDEDGITGFWKSLKVSLVLTINPSITYASAEKLKDILYHVEWNAKDLN 245

Query: 196 SKSQQTR--NDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSIFT-I 252
             S Q +   + + G +   I + ++ P  V K+ +Q +      + K+  S+  + T +
Sbjct: 246 DSSLQLKPGQNFLIGVLSKIISTCLTHPLIVAKASLQRS------SSKFT-SFQEVLTYL 298

Query: 253 YKEEGFRALYKGFVPKVLR 271
           Y+ EG  AL+KG +P++ +
Sbjct: 299 YRHEGAHALWKGLLPQLTK 317

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 65/148 (43%), Gaps = 16/148 (10%)

Query: 137 QDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYF-------GIIFQVRA 189
           + +   YK  +DV+ K+   EG   +Y+GL ++L    + +  YF          F+V+ 
Sbjct: 81  ESLEQRYKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFWYTLIRRHYFRVKK 140

Query: 190 LLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWPSI 249
           +  EA   S  T  +L+   +      L + P ++V ++ Q    + G     + S+ +I
Sbjct: 141 VKGEAARFS--TIEELLLSMLAAATSQLFTNPINIVSTKQQTRRGLEG-----DNSFKAI 193

Query: 250 F-TIYKEEGFRALYKGF-VPKVLRLGPG 275
              +Y E+G    +K   V  VL + P 
Sbjct: 194 AKEVYDEDGITGFWKSLKVSLVLTINPS 221

>Sklu_1809.2 YDR194C, Contig c1809 1564-3570 reverse complement
          Length = 668

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 5/70 (7%)

Query: 80  APKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGAS--AGCCEAFVVVPFELVKI--R 135
           AP R      + E QKI+K  +G++K  +S+ ++ G +  +   + F   P  +V    R
Sbjct: 200 APTRDLALQIDSEIQKIHKNNYGLQKF-KSVCLIGGTNFDSSIKKMFKERPNIIVATPGR 258

Query: 136 LQDVSSSYKG 145
           LQDV S + G
Sbjct: 259 LQDVMSKFSG 268

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.139    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,540,179
Number of extensions: 331161
Number of successful extensions: 2757
Number of sequences better than 10.0: 208
Number of HSP's gapped: 1435
Number of HSP's successfully gapped: 611
Length of query: 293
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 192
Effective length of database: 13,099,691
Effective search space: 2515140672
Effective search space used: 2515140672
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)