Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.865336436017670.0
ACR104C29728613510.0
Scas_700.4229729113240.0
KLLA0D06941g29729113170.0
CAGL0M02695g29729113010.0
Sklu_2406.429729012940.0
YPL131W (RPL5)29728212821e-179
Scas_594.4172278682.5
YLR454W262845672.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.8653
         (360 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.8653                                                          685   0.0  
ACR104C [1151] [Homologous to ScYPL131W (RPL5) - SH] (541333..54...   525   0.0  
Scas_700.42                                                           514   0.0  
KLLA0D06941g complement(598560..599453) highly similar to sp|P26...   511   0.0  
CAGL0M02695g 308170..309063 highly similar to sp|P26321 Saccharo...   505   0.0  
Sklu_2406.4 YPL131W, Contig c2406 3367-4260                           503   0.0  
YPL131W (RPL5) [5314] chr16 (303120..304013) Ribosomal protein L...   498   e-179
Scas_594.4                                                             31   2.5  
YLR454W (YLR454W) [3828] chr12 (1043995..1051881) Protein of unk...    30   2.9  

>Kwal_26.8653
          Length = 364

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/360 (93%), Positives = 335/360 (93%)

Query: 1   MFLKENLESLYTETQLLRKSEKFLDACRAECDGHRMATHHRSITEHXXXXXXXXXXXXXX 60
           MFLKENLESLYTETQLLRKSEKFLDACRAECDGHRMATHHRSITEH              
Sbjct: 1   MFLKENLESLYTETQLLRKSEKFLDACRAECDGHRMATHHRSITEHSSQSKSSLLSHLYS 60

Query: 61  XXXPPVPTAMVFLKEVKSSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRL 120
              PPVPTAMVFLKEVKSSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRL
Sbjct: 61  SISPPVPTAMVFLKEVKSSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRL 120

Query: 121 VVRFTNKDIICQIVSSTITGDVVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRALQ 180
           VVRFTNKDIICQIVSSTITGDVVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRALQ
Sbjct: 121 VVRFTNKDIICQIVSSTITGDVVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRALQ 180

Query: 181 KLGLDETYQGVEEVEGEYQLTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGL 240
           KLGLDETYQGVEEVEGEYQLTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGL
Sbjct: 181 KLGLDETYQGVEEVEGEYQLTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGL 240

Query: 241 YVPHSESRFPGWDFEAEELDADTLRTYIFGGHVSQYMEELADDDEERFKELFKGYLXXXX 300
           YVPHSESRFPGWDFEAEELDADTLRTYIFGGHVSQYMEELADDDEERFKELFKGYL    
Sbjct: 241 YVPHSESRFPGWDFEAEELDADTLRTYIFGGHVSQYMEELADDDEERFKELFKGYLADDI 300

Query: 301 XXXXVEDIYMEAHEKIRADPSFKPTEKKFTKEQYAAESKKYRQTKLSREERKARVAAKIA 360
               VEDIYMEAHEKIRADPSFKPTEKKFTKEQYAAESKKYRQTKLSREERKARVAAKIA
Sbjct: 301 DADAVEDIYMEAHEKIRADPSFKPTEKKFTKEQYAAESKKYRQTKLSREERKARVAAKIA 360

>ACR104C [1151] [Homologous to ScYPL131W (RPL5) - SH]
           (541333..542226) [894 bp, 297 aa]
          Length = 297

 Score =  525 bits (1351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/286 (86%), Positives = 265/286 (92%)

Query: 70  MVFLKEVKSSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 129
           M F+K +K+SAYHSRFQTPFRRRREGKTDYY RKRLV QHKAKYN+PKYRLVVRFTNKDI
Sbjct: 1   MAFIKSIKNSAYHSRFQTPFRRRREGKTDYYARKRLVTQHKAKYNTPKYRLVVRFTNKDI 60

Query: 130 ICQIVSSTITGDVVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRALQKLGLDETYQ 189
           ICQ+VSSTITGD+VLAAAYSHELPRYGITHGLTNWSAAYATGLLIARR LQKLGLDETY+
Sbjct: 61  ICQVVSSTITGDIVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRTLQKLGLDETYK 120

Query: 190 GVEEVEGEYQLTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSESRF 249
           GVEE EGEY+LTEAVEDGPRPFKV+LDIGLQRTTTGARVFGALKGASDGGLYVPHSE+RF
Sbjct: 121 GVEEPEGEYELTEAVEDGPRPFKVYLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180

Query: 250 PGWDFEAEELDADTLRTYIFGGHVSQYMEELADDDEERFKELFKGYLXXXXXXXXVEDIY 309
           PGWDFE+EELDAD LRTYIFGGHVS YMEELADDDEER+ ELFKGY+        +EDIY
Sbjct: 181 PGWDFESEELDADLLRTYIFGGHVSAYMEELADDDEERYSELFKGYIADGIEADAIEDIY 240

Query: 310 MEAHEKIRADPSFKPTEKKFTKEQYAAESKKYRQTKLSREERKARV 355
            EAH  IRADPSFKPTEKKFTKEQYAAESKK+RQ KL++EERKARV
Sbjct: 241 TEAHAAIRADPSFKPTEKKFTKEQYAAESKKFRQVKLTKEERKARV 286

>Scas_700.42
          Length = 297

 Score =  514 bits (1324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/291 (89%), Positives = 269/291 (92%)

Query: 70  MVFLKEVKSSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 129
           M F    K+SAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI
Sbjct: 1   MTFNINQKNSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 60

Query: 130 ICQIVSSTITGDVVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRALQKLGLDETYQ 189
           ICQIVSSTITGD+VLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRALQKLGLDETY+
Sbjct: 61  ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRALQKLGLDETYK 120

Query: 190 GVEEVEGEYQLTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSESRF 249
           GVEEVEGEY+LTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLY+PHSE+RF
Sbjct: 121 GVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYIPHSENRF 180

Query: 250 PGWDFEAEELDADTLRTYIFGGHVSQYMEELADDDEERFKELFKGYLXXXXXXXXVEDIY 309
           PGWDFEAEELD D LRTYIFGGHVSQYMEELADDDEERF ELFKGYL        +EDIY
Sbjct: 181 PGWDFEAEELDPDLLRTYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY 240

Query: 310 MEAHEKIRADPSFKPTEKKFTKEQYAAESKKYRQTKLSREERKARVAAKIA 360
            EAH  IRADP+FK TEKKFTKEQYAAESKK+RQ KL+REERKARV AKIA
Sbjct: 241 TEAHAAIRADPAFKATEKKFTKEQYAAESKKFRQIKLTREERKARVEAKIA 291

>KLLA0D06941g complement(598560..599453) highly similar to sp|P26321
           Saccharomyces cerevisiae YPL131w RPL1 60S large subunit
           ribosomal protein L5.e singleton, start by similarity
          Length = 297

 Score =  511 bits (1317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/291 (86%), Positives = 272/291 (93%)

Query: 70  MVFLKEVKSSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 129
           M F+K++K+SAYHSR+QTPFRRRREGKTDYY RKRLVAQHKAKYN+PKYRLVVRFTNKDI
Sbjct: 1   MAFIKDIKTSAYHSRYQTPFRRRREGKTDYYARKRLVAQHKAKYNTPKYRLVVRFTNKDI 60

Query: 130 ICQIVSSTITGDVVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRALQKLGLDETYQ 189
           I QIVSSTITGD+VLAAAYSHELPRYGITHGLTNWSAAYATGLL+ARR LQKLGLDETY 
Sbjct: 61  ITQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWSAAYATGLLLARRTLQKLGLDETYP 120

Query: 190 GVEEVEGEYQLTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSESRF 249
           GVEEVEGEY+LTEAVEDGPRPFKV+LD+GLQRTTTGAR+FGALKGASDGGLYVPHSE+RF
Sbjct: 121 GVEEVEGEYELTEAVEDGPRPFKVYLDVGLQRTTTGARIFGALKGASDGGLYVPHSENRF 180

Query: 250 PGWDFEAEELDADTLRTYIFGGHVSQYMEELADDDEERFKELFKGYLXXXXXXXXVEDIY 309
           PGWDFEAEELDAD LRTYIFGGHVSQYMEELADDDEER++ELFKGYL        VEDIY
Sbjct: 181 PGWDFEAEELDADLLRTYIFGGHVSQYMEELADDDEERYRELFKGYLADDIDADAVEDIY 240

Query: 310 MEAHEKIRADPSFKPTEKKFTKEQYAAESKKYRQTKLSREERKARVAAKIA 360
            +AH  IR DP+FKPTEKKFTKEQYAAESKKYRQ KL+REERKARVAAKI+
Sbjct: 241 ADAHAAIREDPAFKPTEKKFTKEQYAAESKKYRQVKLTREERKARVAAKIS 291

>CAGL0M02695g 308170..309063 highly similar to sp|P26321
           Saccharomyces cerevisiae YPL131w RPL1, start by
           similarity
          Length = 297

 Score =  505 bits (1301), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/291 (88%), Positives = 274/291 (94%)

Query: 70  MVFLKEVKSSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 129
           MVF++ +K+SAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI
Sbjct: 1   MVFIQNLKTSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 60

Query: 130 ICQIVSSTITGDVVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRALQKLGLDETYQ 189
           ICQIVSSTITGD+VLAAAYSHELPRYGITHGLTNW+AAYATGLLIARRALQKLGLDETY+
Sbjct: 61  ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRALQKLGLDETYK 120

Query: 190 GVEEVEGEYQLTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSESRF 249
           GVEEVEGEY+LTEAVEDGPRPFKV+LDIGLQRTTTGARVFGALKGASDGGLYVPHSE+RF
Sbjct: 121 GVEEVEGEYELTEAVEDGPRPFKVYLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180

Query: 250 PGWDFEAEELDADTLRTYIFGGHVSQYMEELADDDEERFKELFKGYLXXXXXXXXVEDIY 309
           PGWDFEAEELDA+ LR+YIFGGHVSQYMEELADDDEERF ELFKGYL        +EDIY
Sbjct: 181 PGWDFEAEELDAELLRSYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSIEDIY 240

Query: 310 MEAHEKIRADPSFKPTEKKFTKEQYAAESKKYRQTKLSREERKARVAAKIA 360
             AHE IRADPSFKPTEKKFTKEQYAAESKKY+  KL++EER ARVAAKIA
Sbjct: 241 ASAHEAIRADPSFKPTEKKFTKEQYAAESKKYKAKKLTKEERDARVAAKIA 291

>Sklu_2406.4 YPL131W, Contig c2406 3367-4260
          Length = 297

 Score =  503 bits (1294), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/290 (88%), Positives = 270/290 (93%)

Query: 70  MVFLKEVKSSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 129
           M F   VK+SAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI
Sbjct: 1   MGFQLNVKTSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 60

Query: 130 ICQIVSSTITGDVVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRALQKLGLDETYQ 189
           ICQIVSSTITGD+VLAAAYSHELPRYGITHGLTNW+AAYATGLLIARR LQKLGLDETY+
Sbjct: 61  ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRTLQKLGLDETYK 120

Query: 190 GVEEVEGEYQLTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSESRF 249
           GVEEVEGEY+LTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSE+RF
Sbjct: 121 GVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180

Query: 250 PGWDFEAEELDADTLRTYIFGGHVSQYMEELADDDEERFKELFKGYLXXXXXXXXVEDIY 309
           PGWDFEAEELD D LRTYIF GHVSQYMEELADDDEERF+ELFKGYL        +EDIY
Sbjct: 181 PGWDFEAEELDPDMLRTYIFAGHVSQYMEELADDDEERFRELFKGYLADDIDADAIEDIY 240

Query: 310 MEAHEKIRADPSFKPTEKKFTKEQYAAESKKYRQTKLSREERKARVAAKI 359
           +EAHE IR DP+FK TEKKFTKEQYAAESKKY+Q KL++EERKARVAAKI
Sbjct: 241 LEAHEAIREDPAFKATEKKFTKEQYAAESKKYKQYKLTKEERKARVAAKI 290

>YPL131W (RPL5) [5314] chr16 (303120..304013) Ribosomal protein L5
           (yeast L1; YL3; rat L5), the sole 5S rRNA-associated
           ribosomal protein, involved in the binding of
           peptidyl-tRNA to the ribosome [894 bp, 297 aa]
          Length = 297

 Score =  498 bits (1282), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 248/282 (87%), Positives = 261/282 (92%)

Query: 70  MVFLKEVKSSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 129
           M F K+ KSSAY SRFQTPFRRRREGKTDYYQRKRLV QHKAKYN+PKYRLVVRFTNKDI
Sbjct: 1   MAFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFTNKDI 60

Query: 130 ICQIVSSTITGDVVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRALQKLGLDETYQ 189
           ICQI+SSTITGDVVLAAAYSHELPRYGITHGLTNW+AAYATGLLIARR LQKLGLDETY+
Sbjct: 61  ICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRTLQKLGLDETYK 120

Query: 190 GVEEVEGEYQLTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSESRF 249
           GVEEVEGEY+LTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSE+RF
Sbjct: 121 GVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180

Query: 250 PGWDFEAEELDADTLRTYIFGGHVSQYMEELADDDEERFKELFKGYLXXXXXXXXVEDIY 309
           PGWDFE EE+D + LR+YIFGGHVSQYMEELADDDEERF ELFKGYL        +EDIY
Sbjct: 181 PGWDFETEEIDPELLRSYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY 240

Query: 310 MEAHEKIRADPSFKPTEKKFTKEQYAAESKKYRQTKLSREER 351
             AHE IRADP+FKPTEKKFTKEQYAAESKKYRQTKLS+EER
Sbjct: 241 TSAHEAIRADPAFKPTEKKFTKEQYAAESKKYRQTKLSKEER 282

>Scas_594.4
          Length = 1722

 Score = 30.8 bits (68), Expect = 2.5,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 7/78 (8%)

Query: 214 FLDIGLQRTTTGARVFGALKGASDGGLYVPHSESRFPGW---DFEAEELDADTLRTYIFG 270
           + DI  +  TT   + G +K  S+ GL+V  +  +F G     +  E  D D  +T+   
Sbjct: 784 YADIKSKSKTTP--LHGYIKSISNKGLFVAFN-GKFVGLVLPSYAVESRDVDISKTFYIN 840

Query: 271 GHVSQYMEELADDDEERF 288
             V+ Y+   +DDD ERF
Sbjct: 841 QSVTAYLLR-SDDDNERF 857

>YLR454W (YLR454W) [3828] chr12 (1043995..1051881) Protein of unknown
            function, has low similarity to uncharacterized C.
            albicans Orf6.6103p [7887 bp, 2628 aa]
          Length = 2628

 Score = 30.4 bits (67), Expect = 2.9,   Method: Composition-based stats.
 Identities = 13/45 (28%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 98   DYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDIICQIVS-STITGD 141
            D +QRK ++ +++A  N  +  + ++F   D++CQ V   T++G+
Sbjct: 1728 DLHQRKEVLTEYQAGLNVRRRVMKLKFLAGDVVCQDVDIRTVSGE 1772

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,662,150
Number of extensions: 431569
Number of successful extensions: 1346
Number of sequences better than 10.0: 13
Number of HSP's gapped: 1367
Number of HSP's successfully gapped: 13
Length of query: 360
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 257
Effective length of database: 13,030,455
Effective search space: 3348826935
Effective search space used: 3348826935
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)