Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.821939138620020.0
Sklu_2411.83824058421e-110
ABR058C3504047426e-96
Scas_576.54074076885e-87
YMR021C (MAC1)4174376531e-81
KLLA0E07733g4694036441e-79
CAGL0M07590g4564054889e-57
Scas_668.16291581534e-11
CAGL0L09339g877411324e-08
Scas_710.11743411307e-08
AEL295C544401298e-08
KLLA0A03047g567401281e-07
YPR008W (HAA1)694411281e-07
YGL166W (CUP2)225401231e-07
Kwal_14.1543599401252e-07
CAGL0I04180g265641206e-07
Sklu_2324.238384701.2
AFR136C69574672.9
KLLA0E18216g169654673.1
Scas_550.5*83255655.0
YMR291W586100646.7
KLLA0F00660g137449638.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.8219
         (386 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.8219                                                          775   0.0  
Sklu_2411.8 YMR021C, Contig c2411 15729-16877                         328   e-110
ABR058C [649] [Homologous to ScYMR021C (MAC1) - SH] (501771..502...   290   6e-96
Scas_576.5                                                            269   5e-87
YMR021C (MAC1) [3985] chr13 complement(317164..318417) Transcrip...   256   1e-81
KLLA0E07733g 694992..696401 weakly similar to sp|P35192 Saccharo...   252   1e-79
CAGL0M07590g 758940..760310 weakly similar to sp|P35192 Saccharo...   192   9e-57
Scas_668.16                                                            64   4e-11
CAGL0L09339g 1012259..1014892 some similarities with sp|Q12753 S...    55   4e-08
Scas_710.11                                                            55   7e-08
AEL295C [2210] [Homologous to ScYPR008W (HAA1) - SH; ScYGL166W (...    54   8e-08
KLLA0A03047g 269553..271256 some similarities with sp|Q12753 Sac...    54   1e-07
YPR008W (HAA1) [5444] chr16 (573013..575097) Nuclear protein tha...    54   1e-07
YGL166W (CUP2) [1824] chr7 (191133..191810) Copper-dependent tra...    52   1e-07
Kwal_14.1543                                                           53   2e-07
CAGL0I04180g 367258..368055 sp|P41772 Candida glabrata metal-act...    51   6e-07
Sklu_2324.2 YGL246C, Contig c2324 2470-3621                            32   1.2  
AFR136C [3328] [Homologous to ScYOR140W (SFL1) - SH] (682890..68...    30   2.9  
KLLA0E18216g complement(1615820..1620910) similar to sp|P34241 S...    30   3.1  
Scas_550.5*                                                            30   5.0  
YMR291W (YMR291W) [4245] chr13 (852629..854389) Serine/threonine...    29   6.7  
KLLA0F00660g 54232..58356 similar to sgd|S0006031 Saccharomyces ...    29   8.3  

>Kwal_26.8219
          Length = 391

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/386 (96%), Positives = 374/386 (96%)

Query: 1   MIIFDGEKYSCVSCIRGHRSSTCKHSNRMLVKVRTRGRPSAQTVRKVILVDASSQVNSSP 60
           MIIFDGEKYSCVSCIRGHRSSTCKHSNRMLVKVRTRGRPSAQTVRKVILVDASSQVNSSP
Sbjct: 1   MIIFDGEKYSCVSCIRGHRSSTCKHSNRMLVKVRTRGRPSAQTVRKVILVDASSQVNSSP 60

Query: 61  HTEEDDQGQXXXXXXXXXXXXTKMNKQPILFLRTMSTQKALLVDGALKIMIEDTDPAFHG 120
           HTEEDDQGQ            TKMNKQPILFLRTMSTQKALLVDGALKIMIEDTDPAFHG
Sbjct: 61  HTEEDDQGQSPCCSSSASRSCTKMNKQPILFLRTMSTQKALLVDGALKIMIEDTDPAFHG 120

Query: 121 KYKFVSERDYLLNHLQIPLDDYSQETNGLAKNSVKEPSSLGNLLQSDTLLSNESQKHEYP 180
           KYKFVSERDYLLNHLQIPLDDYSQETNGLAKNSVKEPSSLGNLLQSDTLLSNESQKHEYP
Sbjct: 121 KYKFVSERDYLLNHLQIPLDDYSQETNGLAKNSVKEPSSLGNLLQSDTLLSNESQKHEYP 180

Query: 181 DIKFEEQNRPSFLPTGKHTEQISTLDSEAHNTSMVELFTHKGVYLSTQCSCDEGNCSCVN 240
           DIKFEEQNRPSFLPTGKHTEQISTLDSEAHNTSMVELFTHKGVYLSTQCSCDEGNCSCVN
Sbjct: 181 DIKFEEQNRPSFLPTGKHTEQISTLDSEAHNTSMVELFTHKGVYLSTQCSCDEGNCSCVN 240

Query: 241 CLIHRKEEELESYIQQSGVPLSTIGNGRITFPIEQSSKDAFVCKYSAEECPIQDCLLHPA 300
           CLIHRKEEELESYIQQSGVPLSTIGNGRITFPIEQSSKDAFVCKYSAEECPIQDCLLHPA
Sbjct: 241 CLIHRKEEELESYIQQSGVPLSTIGNGRITFPIEQSSKDAFVCKYSAEECPIQDCLLHPA 300

Query: 301 EILSLNHIFIYGLINVPIKRKSVIKFKHKLIPSKFWWHLLKEELPNMPHEQSASFDIFQW 360
           EILSLNHIFIYGLINVPIKRKSVIKFKHKLIPSKFWWHLLKEELPNMPHEQSASFDIFQW
Sbjct: 301 EILSLNHIFIYGLINVPIKRKSVIKFKHKLIPSKFWWHLLKEELPNMPHEQSASFDIFQW 360

Query: 361 FEHIIETFNAEIPNESDGSVNLHDMS 386
           FEHIIETFNAEIPNESDGSVNLHDMS
Sbjct: 361 FEHIIETFNAEIPNESDGSVNLHDMS 386

>Sklu_2411.8 YMR021C, Contig c2411 15729-16877
          Length = 382

 Score =  328 bits (842), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 180/405 (44%), Positives = 237/405 (58%), Gaps = 49/405 (12%)

Query: 1   MIIFDGEKYSCVSCIRGHRSSTCKHSNRMLVKVRTRGRPSAQTVRKVILVDASSQVNSSP 60
           MIIFDG+KYSCV+CIRGHRSSTCKHS+RMLVKVRTRGRPS   VRKVI+VD  SQV    
Sbjct: 1   MIIFDGDKYSCVACIRGHRSSTCKHSDRMLVKVRTRGRPSPMDVRKVIMVDTDSQVEPPV 60

Query: 61  HTEEDDQGQXXXXXXXXXXXXTKMNKQPILFLRTMSTQKALLVDGALKIMIEDTDPAF-- 118
           HT ED                 KMNKQPILFLR M TQKALLVDG LKIM+ED +     
Sbjct: 61  HTPED-SNPCCQRSNANSKSCNKMNKQPILFLRAMRTQKALLVDGMLKIMVEDNESVSID 119

Query: 119 -HGKYKFVSERDYLLNHLQIPLDDYSQETNGLAKNSVKEPSSLGNLLQSDTLLSNESQKH 177
              K+K VSER+Y+L H    + D                             S +S++ 
Sbjct: 120 SKKKFKLVSEREYMLKHSNNRMPD---------------------------CCSCKSEEA 152

Query: 178 EYPDIKFEEQNRPSFLPTGKHTEQISTLDSEA-------HNTSMVELFTHKGVYLSTQCS 230
           E P+ + E Q   SF            L + A           MVEL THKGVYLSTQCS
Sbjct: 153 ELPENELE-QRTASFQSVKTFHNGNDVLSTTATPPPPITDENQMVELLTHKGVYLSTQCS 211

Query: 231 CDEGNCSCVNCLIHRKEEELESYIQQSGVPLSTIGNGRITFPIEQSSKDAF--------- 281
           C++ NC C NCLIHRKEEEL  YI+QSG+PL+ +GNGR+T         +          
Sbjct: 212 CEDDNCQCDNCLIHRKEEELNKYIRQSGIPLTNLGNGRVTDDENGHGNGSIKTISCSTES 271

Query: 282 VCKYSAEECPIQDCLLHPAEILSLNHIFIYGLINVPIKRKSVIKFKHKLIPSKFWWHLLK 341
           VC+   ++C    CL HP EI+S++++ ++G++N  +KRK++IK+++KLIPSK+WW  +K
Sbjct: 272 VCRCPPQDCICPHCLDHPGEIISMSNLLLHGVLNTQLKRKTIIKYRNKLIPSKYWWDFIK 331

Query: 342 EELPNMPHEQSASFDIFQWFEHIIETFNA-EIPNESDGSVNLHDM 385
            ++P M   Q  S D+ +WF+ I+E + +  + +  D  +NLH++
Sbjct: 332 LQIPLMSRRQLESLDLLRWFDSIVEAYGSFLLEDHGDDMINLHEI 376

>ABR058C [649] [Homologous to ScYMR021C (MAC1) - SH]
           (501771..502826) [1056 bp, 351 aa]
          Length = 350

 Score =  290 bits (742), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 163/404 (40%), Positives = 222/404 (54%), Gaps = 78/404 (19%)

Query: 1   MIIFDGEKYSCVSCIRGHRSSTCKHSNRMLVKVRTRGRPSAQTVRKVILVDASSQVNSSP 60
           MIIFDGEKYSC +CIRGHRS+TCKHS+RMLVKVRTRGRPS   +RKVILVDA SQV   P
Sbjct: 1   MIIFDGEKYSCAACIRGHRSTTCKHSDRMLVKVRTRGRPSPMDIRKVILVDAGSQV---P 57

Query: 61  HTEEDDQGQXXXXXXXXXXXXTKMNKQPILFLRTMSTQKALLVDGALKIMIED--TDPAF 118
             +ED +               KM++QPILFL+ + TQKALLVDGALKIMIED       
Sbjct: 58  MEDEDTE-----ECCDGGKTCGKMDRQPILFLKALKTQKALLVDGALKIMIEDRANSDGV 112

Query: 119 HGKYKFVSERDYLLNHLQIPLDDYSQETNGLAKNSVKEPSSLGNLLQSDTLLSNESQKHE 178
             ++KFV+E+++LL +                               +D L + +    +
Sbjct: 113 DKRFKFVTEKEFLLQN-------------------------------ADMLKARDGCGCQ 141

Query: 179 YPDIKFEEQNRPSFLPTGKHTEQISTLDSEAHNTSMVELFTHKGVYLSTQCSCDEGNCSC 238
                     RP     G  T         A +   VE +T+KGVYLSTQCSCD+  C C
Sbjct: 142 ----------RPKRARVGCSTG--------AGSPHAVEPYTYKGVYLSTQCSCDDSACQC 183

Query: 239 VNCLIHRKEEELESYIQQSGVPLSTI-----------------GNGRITFPIEQSSKDAF 281
            NCLIHRKEEEL+ +I+QSGVPL+++                  +G + +    + + + 
Sbjct: 184 ANCLIHRKEEELDQFIRQSGVPLTSVDLEDRKPAEAGACCGDRASGLLGYDYAANERTSC 243

Query: 282 VCKYSAEECPIQDCLLHPAEILSLNHIFIYGLINVPIKRKSVIKFKHKLIPSKFWWHLLK 341
            C  S   C  +DC +H  E++S+N + ++G++N P+KRK  I++K KLI SKFWW +L 
Sbjct: 244 AC--SPVSCMCKDCEIHAEEVVSMNRLLLHGILNTPLKRKMSIQYKGKLINSKFWWDILY 301

Query: 342 EELPNMPHEQSASFDIFQWFEHIIETFNAEIPNESDGSVNLHDM 385
            +       Q  + D+ QWF++IIET  A +P+    +  L  M
Sbjct: 302 LQCAVAREPQLEALDLLQWFDNIIETHGAALPDAEPAATGLDYM 345

>Scas_576.5
          Length = 407

 Score =  269 bits (688), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 149/407 (36%), Positives = 225/407 (55%), Gaps = 35/407 (8%)

Query: 1   MIIFDGEKYSCVSCIRGHRSSTCKHSNRMLVKVRTRGRPSAQTVRKVILVDASSQVNSSP 60
           MII+  EKY+C SCIRGHRSSTCKH+NRMLVKVRTRGRPS   +R VI+VD+SS++++  
Sbjct: 1   MIIYASEKYACASCIRGHRSSTCKHTNRMLVKVRTRGRPSPTEIRDVIMVDSSSRIDAKS 60

Query: 61  HTEEDDQGQXXXXXXXXXXXXTKMNKQPILFLRTMSTQKALLVDGALKIMIEDTDPAF-- 118
                +                 M +QP+LF+R   ++KA L++G L+I+++D+  +   
Sbjct: 61  SCHSSNHQSKLAEGDDSNSCSQNMERQPVLFVRVKDSKKARLLNGKLQILVDDSADSNEK 120

Query: 119 --------HGKYKFVSERDYLLNHLQIPLDDYSQETNGLAKNSV---------KEPSSLG 161
                   +G  KF+ E +YL           S        ++             ++  
Sbjct: 121 GSSVSSKDNGNSKFIPEVEYLKQLSGSSSGSGSNSLGSTPNSNTCCHHHTTCASMAAAAT 180

Query: 162 NLLQSDTLLSNESQKHEYPDIKFEEQNRPSFLPTGKHTEQIST-------LDSEAHNTSM 214
               + +LLS             E+ N    L  GK  E +++       LDS+   T +
Sbjct: 181 ANTSTQSLLSKNDNNMTTSTNMTEDNN----LDIGKIEESLNSMEYFEQVLDSK---TPL 233

Query: 215 VELFTHKGVYLSTQCSCDEGNCSCVNCLIHRKEEELESYIQQSGVPLSTIGNGRITFPIE 274
           V+LFTHKGVYLS+ CSC++GNC C+NCLIHR E+EL SYI+QSG+PL+ +G       + 
Sbjct: 234 VDLFTHKGVYLSSACSCEDGNCPCLNCLIHRNEDELNSYIRQSGIPLTNVGEAEYKNELM 293

Query: 275 QSSKDAFVCKYSAEECPIQDCLLHPAEILSLNHIFIYGLINVPIKRKSVIKFKHKLIPSK 334
           + +     C  +A +C  QDC++HP EI+S++ I + GL+++ ++RK+VIKFK+KLIPS+
Sbjct: 294 ECTTSNCAC--TAVDCLCQDCIVHPTEIISIDKILLNGLLHMTLRRKTVIKFKNKLIPSQ 351

Query: 335 FWWHLLKEELPNMPHEQSASFDIFQWFEHIIETFNAEIPNESDGSVN 381
           +WW  L  +   +      S DI  WF+ +I  +  E+ + SD   N
Sbjct: 352 YWWDFLIGKTVKLQEGDLESIDIIGWFDSLINKYPMELLDASDMESN 398

>YMR021C (MAC1) [3985] chr13 complement(317164..318417)
           Transcription factor involved in induction of genes
           required for the reduction and utilization of iron and
           copper [1254 bp, 417 aa]
          Length = 417

 Score =  256 bits (653), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 162/437 (37%), Positives = 228/437 (52%), Gaps = 76/437 (17%)

Query: 1   MIIFDGEKYSCVSCIRGHRSSTCKHSNRMLVKVRTRGRPSAQTVRKVILVDASSQVNSSP 60
           MIIF+G KY+C SCIRGHRSSTC+HS+RML+KVRTRGRPS   +R  ILVD++SQ     
Sbjct: 1   MIIFNGNKYACASCIRGHRSSTCRHSHRMLIKVRTRGRPSPMAIRDAILVDSTSQ----- 55

Query: 61  HTEEDDQGQXXXXXXXXXXXXTKMNKQPILFLRTMSTQKALLVDGALKIMIEDTDPAFHG 120
            TE ++  Q            + MN+QPILF+R  + +KA +++G L I++E+   A   
Sbjct: 56  STEYENGAQIEGDCC------SAMNQQPILFVRASAVRKARMINGKLHILMEEGFTAHEP 109

Query: 121 K---------YKFVSERDYLLNH-----------------------------LQIPLDDY 142
           K          K+++E ++L  H                              Q P+  +
Sbjct: 110 KDISTFTDDGNKYITETEFLRKHSPKAPATGTISPDSTKSSSSSEKKERSRLQQEPIRHF 169

Query: 143 SQETNGLAKNSVKEPSSLG--NLLQSDTLLS---NESQKHEYPDIKFEEQNRPSFLPTGK 197
           S   N   K+  + P+S G  N   SD + +   +      + DI  E  N  S +P G 
Sbjct: 170 S---NCCKKDKSQNPASNGKTNKAPSDDIFTPYGSLESTSAFNDILQENYN--SSVP-GA 223

Query: 198 H------TEQISTLDSEAHNT---SMVELFTHKGVYLSTQCSCDEGNCSCVNCLIHRKEE 248
           H      T Q +T  +  H++   S VE+ THKG++LSTQCSC++ +C CVNCLIHR EE
Sbjct: 224 HDSSETLTPQSTTTIAAPHSSDVASKVEVLTHKGIFLSTQCSCEDESCPCVNCLIHRSEE 283

Query: 249 ELESYIQQSGVPLSTIGNGRITFPIEQSSKDAFV----CKYSAEECPIQDCLLHPAEILS 304
           EL SYIQQSGVPL+ IG  +IT  +     D       C    + C    C  H   I+ 
Sbjct: 284 ELNSYIQQSGVPLTNIGEAQITDKMMDYLDDCKCTDKECICPPDNCTCDGCFSHSTNIIP 343

Query: 305 LNHIFIYGLINVPIKRKSVIKFKHKLIPSKFWWHLLKEELPNMPHEQSASFDIFQWFEHI 364
               F YG++N  + RK+ IKFK KL+PSK+WW  LK ++P M   Q    DI  WF+ +
Sbjct: 344 FEKFFFYGILNARLTRKTQIKFKGKLVPSKYWWDFLKLQVPLMTDAQLELLDIHAWFQKL 403

Query: 365 IETFNAEIPNESDGSVN 381
           +  +    P+ SD + +
Sbjct: 404 VSNY---APHLSDATTS 417

>KLLA0E07733g 694992..696401 weakly similar to sp|P35192
           Saccharomyces cerevisiae YMR021c MAC1 metal binding
           activator singleton, start by similarity
          Length = 469

 Score =  252 bits (644), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 158/403 (39%), Positives = 229/403 (56%), Gaps = 46/403 (11%)

Query: 1   MIIFDGEKYSCVSCIRGHRSSTCKHSNRMLVKVRTRGRPSAQTVRKVILVDASSQVNSSP 60
           MIIF+GEKYSCVSCIRGHRSS+CKHS RMLVKVRTRGRPS   +RKVILVD +S+V    
Sbjct: 1   MIIFNGEKYSCVSCIRGHRSSSCKHSERMLVKVRTRGRPSPLDIRKVILVDRASRV---- 56

Query: 61  HTEEDDQGQXXXXXXXXXXXXTKMNKQPILFLRTMSTQKALLVDGALKIMI--EDTDPAF 118
             EE D                 MNKQP+LFLR ++T+KALL++G LKIM+  E   P +
Sbjct: 57  --EEVDGSGQDNGAGDESQLCCGMNKQPVLFLRAIATKKALLINGDLKIMVTSESGTPDY 114

Query: 119 H------GKYKFVSERDYLLNHLQIPLDDYSQETNGLAKNSVKEPSSLGNLLQSDTLLSN 172
                     KFV+E ++LLNH+  P       T       VK  +      +S +L + 
Sbjct: 115 EVARKVSDDNKFVTEHEFLLNHVSPPPCKSCNST-------VKREN------ESHSLDAT 161

Query: 173 ESQKHEYPDIKFEEQNRPSF----LPTGKHTEQISTLDSEAHNTSMVELFTHKGVYLSTQ 228
            + ++    +KFE Q+  +     L +     Q++++ +     S+VELFT  G YLST 
Sbjct: 162 NTTENYAKRVKFERQDMTNLSNHELLSAGDNVQLNSVGNSTFQDSVVELFTQNGAYLSTT 221

Query: 229 CSCDEGNCSCVNCLIHRKEEELESYIQQSGVPLSTIGNGRITFPIE---QSSKDAF---- 281
                 NC C NCLIHR+E ELE Y+ +   P+  +G+ +I        + SKD F    
Sbjct: 222 -CSCNENCQCNNCLIHREEAELERYLTELNQPMINLGSAQILTADSSQVEPSKDFFHGET 280

Query: 282 -------VCKYSAEECPIQDCLLHPAEILSLNHIFIYGLINVPIKRKSVIKFKHKLIPSK 334
                  +C    + C   +C  HP E+++L+ + +YG++N   K+K VIK+++K+I SK
Sbjct: 281 DDQNMSTLCLCEPDFCTCFNCEAHPDEVVTLSELLLYGVLNYKWKKKMVIKYRNKVIHSK 340

Query: 335 FWWHLLKEELPNMPHEQSASFDIFQWFEHIIETFNAEIPNESD 377
           +WWH L  E+P+M  +Q  S D+ +WF+++I + +AE+P  +D
Sbjct: 341 YWWHYLTVEIPSMNEKQLRSLDLMEWFDNLISSHSAELPEAND 383

>CAGL0M07590g 758940..760310 weakly similar to sp|P35192
           Saccharomyces cerevisiae YMR021c metal binding
           activator, start by similarity
          Length = 456

 Score =  192 bits (488), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 135/405 (33%), Positives = 193/405 (47%), Gaps = 51/405 (12%)

Query: 1   MIIFDGEKYSCVSCIRGHRSSTCKHSNRMLVKVRTRGRPSAQTVRKVILVDASSQVNS-- 58
           MIIF  +KY+CV CIRGHRSS C H+ RMLVKVR RGR     VR  I+V    +  S  
Sbjct: 1   MIIFKNDKYACVKCIRGHRSSLCVHTGRMLVKVRNRGRKKGIDVRDAIVVGDIHRKRSCE 60

Query: 59  --SPHTEEDDQGQXXXXXXXXX-------XXXTKMNKQPILFLRTMSTQKALLVDGALKI 109
             S H  +D +                       MNKQPILF+R     KA L+ G LK 
Sbjct: 61  CASGHAGDDSKQYGAPNADVSRPHESGLNSTCVGMNKQPILFVRAKKVLKAQLIGGELKE 120

Query: 110 MIEDTDPAFHGKYKFVSERDYLLNHLQIPLDDYSQETNGLAKNSVKEPSSL----GNLLQ 165
           M               SE D     +    D+    T  + K  + + + L    GN+  
Sbjct: 121 M---------------SEVDMSRLEVDTSDDETVATTTTVPKVEILDNNVLNVTQGNI-D 164

Query: 166 SDTLLSNESQKHEYPDIK--FEEQ-NRPSFLPTGKHT--EQISTLD-----------SEA 209
            D +L ++++      I    +EQ +  +  PTG H    Q   +D           +E 
Sbjct: 165 DDMVLVDDTKNFAGASIGELIDEQLSSINVEPTGSHCCGSQPHGIDPMKTTTVTAAATET 224

Query: 210 HNTSMVELFTHKGVYLSTQCSCDEGNCSCVNCLIHRKEEELESYIQQSGVPLSTIGNGRI 269
                 +L T +GVYLSTQCSC   NC+C NCLIHR EEE+ +YI+ SGVPL+ + +   
Sbjct: 225 EKYPFFQLLTKRGVYLSTQCSCSAANCACSNCLIHRTEEEINNYIEASGVPLTNLDSSTS 284

Query: 270 --TFPIEQSSKDAFVCKYSAEECPIQDCLLHPAEILSLNHIFIYGLINVPIKRKSVIKFK 327
               P  +S + + +CK   EEC    C +H  E++    I I+GLIN  + +K++I+++
Sbjct: 285 LQATPEIESPRPSCMCK--PEECTCDGCDIHTIEVVPFQRIVIHGLINTRLTKKTLIQYR 342

Query: 328 HKLIPSKFWWHLLKEELPNMPHEQSASFDIFQWFEHIIETFNAEI 372
            KLI  K+WW      +P +        DI  +F++II+    E+
Sbjct: 343 KKLIGQKYWWDYCMVYIPCLRCNNFDGLDIVGFFDNIIKEHGHEL 387

>Scas_668.16
          Length = 291

 Score = 63.5 bits (153), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (68%), Gaps = 5/58 (8%)

Query: 1  MIIFDGEKYSCVSCIRGHRSSTCKHSNRMLVKVRTRGRPSA-----QTVRKVILVDAS 53
          MI+ +GEKY+C  CIRGHRSS+C H +R L K++ +GRPS      + +RKV  V+ S
Sbjct: 1  MIMLNGEKYACDLCIRGHRSSSCNHRDRQLTKLKPKGRPSTTCMHCKEMRKVKNVNPS 58

>CAGL0L09339g 1012259..1014892 some similarities with sp|Q12753
          Saccharomyces cerevisiae YPR008w, hypothetical start
          Length = 877

 Score = 55.5 bits (132), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 31/41 (75%)

Query: 1  MIIFDGEKYSCVSCIRGHRSSTCKHSNRMLVKVRTRGRPSA 41
          M++ +G KY+C  CIRGHR +TC HS++ L+ ++ +GRPS 
Sbjct: 1  MVLINGVKYACERCIRGHRVTTCNHSDQPLMMIKPKGRPST 41

>Scas_710.11
          Length = 743

 Score = 54.7 bits (130), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 31/41 (75%)

Query: 1  MIIFDGEKYSCVSCIRGHRSSTCKHSNRMLVKVRTRGRPSA 41
          M++ +G KY+C  CIRGHR +TC H+++ L+ ++ +GRPS 
Sbjct: 1  MVLINGVKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPST 41

>AEL295C [2210] [Homologous to ScYPR008W (HAA1) - SH; ScYGL166W
          (CUP2) - SH] (88054..89688) [1635 bp, 544 aa]
          Length = 544

 Score = 54.3 bits (129), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 31/40 (77%)

Query: 1  MIIFDGEKYSCVSCIRGHRSSTCKHSNRMLVKVRTRGRPS 40
          M++ +G KY+C  CIRGHR +TC H+++ L+ ++ +GRPS
Sbjct: 1  MVLLNGVKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPS 40

>KLLA0A03047g 269553..271256 some similarities with sp|Q12753
          Saccharomyces cerevisiae YPR008w, hypothetical start
          Length = 567

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 30/40 (75%)

Query: 1  MIIFDGEKYSCVSCIRGHRSSTCKHSNRMLVKVRTRGRPS 40
          M++ +G KY+C  CIRGHR +TC H+++ L  ++ +GRPS
Sbjct: 1  MVLINGVKYACERCIRGHRVTTCNHTDQPLTMIKPKGRPS 40

>YPR008W (HAA1) [5444] chr16 (573013..575097) Nuclear protein that
          activates transcription of several genes including TPO2
          and YRO2, has homology to the copper-activated
          transcription factor Ace1p [2085 bp, 694 aa]
          Length = 694

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 31/41 (75%)

Query: 1  MIIFDGEKYSCVSCIRGHRSSTCKHSNRMLVKVRTRGRPSA 41
          M++ +G KY+C  CIRGHR +TC H+++ L+ ++ +GRPS 
Sbjct: 1  MVLINGIKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPST 41

>YGL166W (CUP2) [1824] chr7 (191133..191810) Copper-dependent
          transcription factor responsible for induction of
          CUP1A, CUP1B, CRS5, and SOD1 [678 bp, 225 aa]
          Length = 225

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 30/40 (75%)

Query: 1  MIIFDGEKYSCVSCIRGHRSSTCKHSNRMLVKVRTRGRPS 40
          M++ +G KY+C +CIRGHR++ C H++  L  +R +GRPS
Sbjct: 1  MVVINGVKYACETCIRGHRAAQCTHTDGPLQMIRRKGRPS 40

>Kwal_14.1543
          Length = 599

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 31/40 (77%)

Query: 1  MIIFDGEKYSCVSCIRGHRSSTCKHSNRMLVKVRTRGRPS 40
          M++ +G KY+C  CIRGHR +TC H+++ L+ ++ +GRPS
Sbjct: 1  MVLVNGIKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPS 40

>CAGL0I04180g 367258..368055 sp|P41772 Candida glabrata
          metal-activated transcriptional activator, identified
          start
          Length = 265

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 39/64 (60%), Gaps = 5/64 (7%)

Query: 1  MIIFDGEKYSCVSCIRGHRSSTCKHSNRMLVKVRTRGRPSA-----QTVRKVILVDASSQ 55
          M++ +G KY+C SCI+ H+++ C+H++R L  ++ RGRP       + +RK   V+ S  
Sbjct: 1  MVVINGVKYACDSCIKSHKAAQCEHNDRPLKILKPRGRPPTTCDHCKDMRKTKNVNPSGS 60

Query: 56 VNSS 59
           N S
Sbjct: 61 CNCS 64

>Sklu_2324.2 YGL246C, Contig c2324 2470-3621
          Length = 383

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 9/84 (10%)

Query: 302 ILSLNHIFIYGLINVPIKRKSVIKFKHKLIPSKFWWHLLKEELPNMPHEQSASFDIFQWF 361
           ++ +N + IYG  +     KSV +F  + IP      +LK    N P   +A  D  +W+
Sbjct: 264 LVGVNRV-IYGFRDDNFILKSVEEFSTQEIPI-----ILKN---NNPQMTNACVDAIKWY 314

Query: 362 EHIIETFNAEIPNESDGSVNLHDM 385
               E     IP+E+DG +  + +
Sbjct: 315 GAFTEWLLKTIPHENDGGLRAYKL 338

>AFR136C [3328] [Homologous to ScYOR140W (SFL1) - SH]
           (682890..684977) [2088 bp, 695 aa]
          Length = 695

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 5/74 (6%)

Query: 170 LSNESQKHEYPDIKFEEQNRP--SFLPTGKHTEQISTLDSEAHNTSMVEL--FTHKGVYL 225
           L ++SQ   YPD++F ++ +P  S + T  H    +  D  A N  M++L     K +++
Sbjct: 197 LHSQSQIQAYPDMRFPQEQKPHTSSVITLPHLPNSAIEDLRATNLDMMKLLDLVQKAMHI 256

Query: 226 STQCSCDE-GNCSC 238
           S+  S +E G   C
Sbjct: 257 SSPPSANELGGSVC 270

>KLLA0E18216g complement(1615820..1620910) similar to sp|P34241
           Saccharomyces cerevisiae YKL014c singleton, start by
           similarity
          Length = 1696

 Score = 30.4 bits (67), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 324 IKFKHKLIPSKFWWHLLKEELPNMPHEQSASFDIFQWFEHIIETFNAEIPNESD 377
           +KFK +++   ++ HL   ELPN+    S SFD+F +  + ++   +++  E D
Sbjct: 835 MKFKKRVVKKSYFSHLFDGELPNI---DSDSFDLFLYVVNGLQQIYSQLDIEYD 885

>Scas_550.5*
          Length = 832

 Score = 29.6 bits (65), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 268 RITFPIEQSSKDAFVCKYSAEECPIQDCLLHPAEILSLNHI--FIYGLINVPIKR 320
           R+++ ++  S++  V KY A+  P  D LL     L L HI   +Y +I+  +KR
Sbjct: 636 RLSYKLDMVSRNNEVMKYMAQRLPNDDILLIDIVKLVLGHIKNHVYCIIHNTLKR 690

>YMR291W (YMR291W) [4245] chr13 (852629..854389) Serine/threonine
           protein kinase of unknown function [1761 bp, 586 aa]
          Length = 586

 Score = 29.3 bits (64), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 46/100 (46%), Gaps = 5/100 (5%)

Query: 273 IEQSSKDA--FVCKYSAEECPIQDCLLHPAEILSLNHIFIYGLINVPIKRKSVIKFKHKL 330
           +  S+ DA  F CKY      + D     + +    +I    L  + + +K  +K K +L
Sbjct: 24  LSGSNADAQTFKCKYVTNHNSLGDGNF--SVVKECMNIHTKDLYAMKLIKKQTVKNKIQL 81

Query: 331 IPSKF-WWHLLKEELPNMPHEQSASFDIFQWFEHIIETFN 369
           I  +F     + E++ +M  +   S DIF+   HI++ F+
Sbjct: 82  IQREFDLLRSISEKIRDMEKKNEHSLDIFEGHHHILQLFD 121

>KLLA0F00660g 54232..58356 similar to sgd|S0006031 Saccharomyces
            cerevisiae YPL110c, start by similarity
          Length = 1374

 Score = 28.9 bits (63), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 3/49 (6%)

Query: 111  IEDTDPAFHGKYKFVSERDYLLNHLQIPLDDYSQETNGLAKNSVKEPSS 159
            ++DTD A   + + + ER   LNH++    D    TNG A  S KE S+
Sbjct: 1091 LDDTDAAILRRSRLLKERGPSLNHIE---SDKKDPTNGAAGISNKEDST 1136

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,750,916
Number of extensions: 550486
Number of successful extensions: 1702
Number of sequences better than 10.0: 31
Number of HSP's gapped: 1706
Number of HSP's successfully gapped: 40
Length of query: 386
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 283
Effective length of database: 13,030,455
Effective search space: 3687618765
Effective search space used: 3687618765
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)