Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.821450249525610.0
Sklu_2411.949749415700.0
YMR020W (FMS1)50849713890.0
Scas_709.5055249813061e-176
KLLA0E07744g53350311641e-155
ABR057W52049611181e-148
CAGL0M07612g58158210721e-141
CAGL0H05665g47633800.10
Kwal_33.1501333389750.35
KLLA0A08492g37359750.36
Sklu_2260.639959740.50
Scas_664.248832701.5
YPL091W (GLR1)48332701.7
Sklu_2232.691743701.7
KLLA0A00198g324137691.8
CAGL0D01628g36058691.9
KLLA0E24112g48432692.1
ACL031C61449692.1
YEL047C47087692.2
Sklu_2405.435332673.7
Sklu_2382.2126168673.9
AAL137W33189664.1
ADR290W219540674.3
Scas_709.1950551664.4
Sklu_2020.347963656.4
Kwal_27.1008849847657.0
Kwal_47.17085211360657.1
CAGL0I05676g75869657.3
Kwal_51.1942848233648.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.8214
         (495 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.8214                                                          991   0.0  
Sklu_2411.9 YMR020W, Contig c2411 17037-18530 reverse complement      609   0.0  
YMR020W (FMS1) [3984] chr13 (315376..316902) Protein involved in...   539   0.0  
Scas_709.50                                                           507   e-176
KLLA0E07744g complement(696382..697983) similar to sp|P50264 Sac...   452   e-155
ABR057W [648] [Homologous to ScYMR020W (FMS1) - SH] complement(5...   435   e-148
CAGL0M07612g complement(760610..762355) similar to sp|P50264 Sac...   417   e-141
CAGL0H05665g complement(561332..562762) highly similar to sp|P41...    35   0.10 
Kwal_33.15013                                                          33   0.35 
KLLA0A08492g 751047..752168 weakly similar to sp|Q99042 Trigonop...    33   0.36 
Sklu_2260.6 YIL045W, Contig c2260 9086-10285 reverse complement        33   0.50 
Scas_664.2                                                             32   1.5  
YPL091W (GLR1) [5353] chr16 (375497..376948) Glutathione reducta...    32   1.7  
Sklu_2232.6 YOR058C, Contig c2232 5552-8305                            32   1.7  
KLLA0A00198g complement(14237..15211) highly similar to sp|P3231...    31   1.8  
CAGL0D01628g complement(170546..171628) weakly similar to tr|Q99...    31   1.9  
KLLA0E24112g complement(2143697..2145151) highly similar to sp|P...    31   2.1  
ACL031C [1018] [Homologous to ScYER080W - SH] (309369..311213) [...    31   2.1  
YEL047C (YEL047C) [1381] chr5 complement(65385..66797) Cytoplasm...    31   2.2  
Sklu_2405.4 YPL091W, Contig c2405 6783-7839 reverse complement         30   3.7  
Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement         30   3.9  
AAL137W [50] [Homologous to ScYGR144W (THI4) - NSH] complement(1...    30   4.1  
ADR290W [2031] [Homologous to ScYDL171C (GLT1) - SH] complement(...    30   4.3  
Scas_709.19                                                            30   4.4  
Sklu_2020.3 YCR045C, Contig c2020 5388-6827 reverse complement         30   6.4  
Kwal_27.10088                                                          30   7.0  
Kwal_47.17085                                                          30   7.1  
CAGL0I05676g 535983..538259 some similarities with sp|P20095 Sac...    30   7.3  
Kwal_51.19428                                                          29   8.5  

>Kwal_26.8214
          Length = 502

 Score =  991 bits (2561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/495 (97%), Positives = 481/495 (97%)

Query: 1   MIEKKVVIIGAGISGLKAASVLHEKGCDSCIVIEARDRIGGRLHTVSGYKGRKYDVGASW 60
           MIEKKVVIIGAGISGLKAASVLHEKGCDSCIVIEARDRIGGRLHTVSGYKGRKYDVGASW
Sbjct: 1   MIEKKVVIIGAGISGLKAASVLHEKGCDSCIVIEARDRIGGRLHTVSGYKGRKYDVGASW 60

Query: 61  HHDTLVNGLFLEEMGLPREERTPFVFDDDSMLVFDKARGRVDYDSQMELEILVEELSKYT 120
           HHDTLVNGLFLEEMGLPREERTPFVFDDDSMLVFDKARGRVDYDSQMELEILVEELSKYT
Sbjct: 61  HHDTLVNGLFLEEMGLPREERTPFVFDDDSMLVFDKARGRVDYDSQMELEILVEELSKYT 120

Query: 121 QLQYFEDLEVEDVNYFQTIMKYLYERRELLTDDQIQYLPQLARFMELWHGIDWKSQSSKG 180
           QLQYFEDLEVEDVNYFQTIMKYLYERRELLTDDQIQYLPQLARFMELWHGIDWKSQSSKG
Sbjct: 121 QLQYFEDLEVEDVNYFQTIMKYLYERRELLTDDQIQYLPQLARFMELWHGIDWKSQSSKG 180

Query: 181 LEIAHQGRNAFVLNFGNIAQRVASTIPQEWFELXXXXXXXXXXXXXXLVSTSKGETISCD 240
           LEIAHQGRNAFVLNFGNIAQRVASTIPQEWFEL              LVSTSKGETISCD
Sbjct: 181 LEIAHQGRNAFVLNFGNIAQRVASTIPQEWFELETEVREVKKEGEKVLVSTSKGETISCD 240

Query: 241 YVIVTIPQSILAHSLQPEPRKGRIEFIPPLSSEIKTSLEHAHFGGLGKVVFEFESCCWSK 300
           YVIVTIPQSILAHSLQPEPRKGRIEFIPPLSSEIKTSLEHAHFGGLGKVVFEFESCCWSK
Sbjct: 241 YVIVTIPQSILAHSLQPEPRKGRIEFIPPLSSEIKTSLEHAHFGGLGKVVFEFESCCWSK 300

Query: 301 ERSRALALGKPIVDLTSKIREAVDLSQLVEKLDLDSKYTYKNGESWDFPLLFVNLAKHTD 360
           ERSRALALGKPIVDLTSKIREAVDLSQLVEKLDLDSKYTYKNGESWDFPLLFVNLAKHTD
Sbjct: 301 ERSRALALGKPIVDLTSKIREAVDLSQLVEKLDLDSKYTYKNGESWDFPLLFVNLAKHTD 360

Query: 361 IPSFIMLMPNPLTEYIESIKDKEKLYEFFKPILDQLLVTFGCFEPIIKDFDDEIVSEDEK 420
           IPSFIMLMPNPLTEYIESIKDKEKLYEFFKPILDQLLVTFGCFEPIIKDFDDEIVSEDEK
Sbjct: 361 IPSFIMLMPNPLTEYIESIKDKEKLYEFFKPILDQLLVTFGCFEPIIKDFDDEIVSEDEK 420

Query: 421 KPVLKNILTTSWTGDDYALGAYSACYPGDDPMNVVLALSNNQTSRIRFAGEHTIMDGAGC 480
           KPVLKNILTTSWTGDDYALGAYSACYPGDDPMNVVLALSNNQTSRIRFAGEHTIMDGAGC
Sbjct: 421 KPVLKNILTTSWTGDDYALGAYSACYPGDDPMNVVLALSNNQTSRIRFAGEHTIMDGAGC 480

Query: 481 VYGAWESGKREALFI 495
           VYGAWESGKREALFI
Sbjct: 481 VYGAWESGKREALFI 495

>Sklu_2411.9 YMR020W, Contig c2411 17037-18530 reverse complement
          Length = 497

 Score =  609 bits (1570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/494 (58%), Positives = 367/494 (74%), Gaps = 3/494 (0%)

Query: 2   IEKKVVIIGAGISGLKAASVLHEKGCDSCIVIEARDRIGGRLHTVSGYKGRKYDVGASWH 61
           IEK VVIIGAGI+GLKAAS L+ K C SC+V+E+RDRIGGRLHTV GY GRKYD+GASWH
Sbjct: 3   IEKSVVIIGAGIAGLKAASDLYAKNCHSCVVLESRDRIGGRLHTVEGYDGRKYDLGASWH 62

Query: 62  HDTLVNGLFLEEMGLPREERTPFVFDDDSMLVFDKARGRVDYDSQMELEILVEELSKYTQ 121
           HDTL+NGLFLEE+ LP +ERTPFVFDDD +++F +   R+D+D ++ LE+L EEL ++ +
Sbjct: 63  HDTLMNGLFLEELQLPEQERTPFVFDDDDLILFTENGKRLDHDPKLILEVLKEELDRFIE 122

Query: 122 LQYFEDLEVEDVNYFQTIMKYLYERRELLTDDQIQYLPQLARFMELWHGIDWKSQSSKGL 181
           LQ+FE L+V+D++YFQ I+KYLY+RR+ L+D+Q+++LPQLAR++ELWHGIDWK+ S K  
Sbjct: 123 LQFFESLDVKDISYFQIILKYLYQRRDFLSDEQLKHLPQLARYLELWHGIDWKTLSGKYA 182

Query: 182 EIAHQGRNAFVLNFGNIAQRVASTIPQEWFELXXXXXXXXXXXXXXLVSTSKGETISCDY 241
            I HQGRNA VL++ +I +RVAS+ P+EW +L               V T + ET  CDY
Sbjct: 183 HIDHQGRNAMVLHYSSIVKRVASSFPKEWLKLSTEVCEVRREGKKVCVKTFE-ETYVCDY 241

Query: 242 VIVTIPQSILAHSLQPEPRKGRIEFIPPLSSEIKTSLEHAHFGGLGKVVFEFESCCWSKE 301
           V+VT+PQSIL  SL  E R GRIEF PPL+ +I  S    H+G LGKVVFEF+ CCWS E
Sbjct: 242 VVVTVPQSILELSLHKEARTGRIEFCPPLNKDIVESFGKVHYGTLGKVVFEFDKCCWSTE 301

Query: 302 RSRALALGKPIVDLTSKIREAVDLSQLVEKLDLDSKYTYKNGESWDFPLLFVNLAKHTDI 361
           R++ L++GK       K+R A D   LV++LD D+ Y   N + WDFPL FVNLAK T +
Sbjct: 302 RAKILSMGKTPEGFARKVRNATDFCALVKELDKDTSYELGN-DPWDFPLYFVNLAKTTGV 360

Query: 362 PSFIMLMPNPLTEYIESIKDKEKLYEFFKPILDQLLVTFGCFEPIIKDFDDEIVSEDEKK 421
           PSF+MLM  PLT Y+ES++DK  +YE+FKPIL+ L    G   PI  DF+  I    E  
Sbjct: 361 PSFVMLMQEPLTGYVESLEDKRHVYEYFKPILESLFKVLGSDAPIC-DFEKGIDDARENV 419

Query: 422 PVLKNILTTSWTGDDYALGAYSACYPGDDPMNVVLALSNNQTSRIRFAGEHTIMDGAGCV 481
           P+LKN+ TT+WT + Y+LGAYSAC+P DDPM+ +LAL   Q S IRFAGEHT+MDGAGCV
Sbjct: 420 PILKNVFTTNWTREPYSLGAYSACFPNDDPMDFILALEKGQDSHIRFAGEHTVMDGAGCV 479

Query: 482 YGAWESGKREALFI 495
           YGAWESGKREA +I
Sbjct: 480 YGAWESGKREASYI 493

>YMR020W (FMS1) [3984] chr13 (315376..316902) Protein involved in
           the biosynthesis of pantothenic acid, has similarity to
           Candida albicans corticosteroid-binding protein CBP1
           [1527 bp, 508 aa]
          Length = 508

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/497 (51%), Positives = 346/497 (69%), Gaps = 5/497 (1%)

Query: 3   EKKVVIIGAGISGLKAASVLHEKGCDSCIVIEARDRIGGRLHTVSGYKGRKYDVGASWHH 62
           +KKV+IIGAGI+GLKAAS LH+ G   C+V+EARDR+GGRL TV+GY+GRKYD+GASWHH
Sbjct: 8   KKKVIIIGAGIAGLKAASTLHQNGIQDCLVLEARDRVGGRLQTVTGYQGRKYDIGASWHH 67

Query: 63  DTLVNGLFLEEMGLP-REERTPFVFDDDSMLVFDKARGRVDYDSQMELEILVEELSKYTQ 121
           DTL N LFLEE  L   + RT FVFDDD+ +  D+ RGRVD+D ++ LEI+  E+SK+ +
Sbjct: 68  DTLTNPLFLEEAQLSLNDGRTRFVFDDDNFIYIDEERGRVDHDKELLLEIVDNEMSKFAE 127

Query: 122 LQYFEDLEVEDVNYFQTIMKYLYERRELLTDDQIQYLPQLARFMELWHGIDWKSQSSKGL 181
           L++ + L V D ++FQ +MKYL +RR+ LT+DQI+YLPQL R++ELWHG+DWK  S+K  
Sbjct: 128 LEFHQHLGVSDCSFFQLVMKYLLQRRQFLTNDQIRYLPQLCRYLELWHGLDWKLLSAKDT 187

Query: 182 EIAHQGRNAFVLNFGNIAQRVASTIPQEWFELXXXXXXXXXXXXXXL-VSTSKGETISCD 240
              HQGRNAF LN+ ++ QR+A + PQ W +L              + V+   G   + D
Sbjct: 188 YFGHQGRNAFALNYDSVVQRIAQSFPQNWLKLSCEVKSITREPSKNVTVNCEDGTVYNAD 247

Query: 241 YVIVTIPQSILAHSLQPEPR-KGRIEFIPPLSSEIKTSLEHAHFGGLGKVVFEFESCCWS 299
           YVI+T+PQS+L  S+QPE   +GRIEF PPL   I+ + +  HFG LGKV+FEFE CCWS
Sbjct: 248 YVIITVPQSVLNLSVQPEKNLRGRIEFQPPLKPVIQDAFDKIHFGALGKVIFEFEECCWS 307

Query: 300 KERSRALALGKPIVDLTSKIREAVDLSQLVEKLDLDSKYTYKNGESWDFPLLFVNLAKHT 359
            E S+ + L     +    +R A +L +L   L+ +    + +   W  PL FVNL+K T
Sbjct: 308 NESSKIVTLANSTNEFVEIVRNAENLDELDSMLEREDSQKHTSVTCWSQPLFFVNLSKST 367

Query: 360 DIPSFIMLMPNPLTEYIESIK-DKEKLYEFFKPILDQLLVTFGCFEPIIKDFDDEIVSED 418
            + SF+MLM  PLT +IESI+ DKE+L+ FF+P+L++++      E +I          +
Sbjct: 368 GVASFMMLMQAPLTNHIESIREDKERLFSFFQPVLNKIMKCLDS-EDVIDGMRPIENIAN 426

Query: 419 EKKPVLKNILTTSWTGDDYALGAYSACYPGDDPMNVVLALSNNQTSRIRFAGEHTIMDGA 478
             KPVL+NI+ ++WT D Y+ GAYSAC+PGDDP+++V+A+SN Q SRIRFAGEHTIMDGA
Sbjct: 427 ANKPVLRNIIVSNWTRDPYSRGAYSACFPGDDPVDMVVAMSNGQDSRIRFAGEHTIMDGA 486

Query: 479 GCVYGAWESGKREALFI 495
           GC YGAWESG+REA  I
Sbjct: 487 GCAYGAWESGRREATRI 503

>Scas_709.50
          Length = 552

 Score =  507 bits (1306), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 243/498 (48%), Positives = 330/498 (66%), Gaps = 8/498 (1%)

Query: 3   EKKVVIIGAGISGLKAASVLHEKGCDSCIVIEARDRIGGRLHTVSGYKGRKYDVGASWHH 62
           E++V+IIGAGI+GLKAAS L+  G  +C+VIEARDRIGGRL TV GYKG KYD+GA WHH
Sbjct: 51  EQQVIIIGAGIAGLKAASTLYANGIKNCLVIEARDRIGGRLLTVKGYKGDKYDLGAGWHH 110

Query: 63  DTLVNGLFLEEM-GLPREERTPFVFDDDSMLVFDKARGRVDYDSQMELEILVEELSKYTQ 121
           DTL+N LFLEE   + ++ +  FVF+D   +  D  RGR+D+D  M LE +  E+ K+T 
Sbjct: 111 DTLMNPLFLEEAEAMKKDSKKRFVFEDSQFIYIDDQRGRIDHDPDMSLEFVDAEIDKFTG 170

Query: 122 LQYFEDLEVEDVNYFQTIMKYLYERRELLTDDQIQYLPQLARFMELWHGIDWKSQSSKGL 181
           L++++ L+V+D +++  I+KYL +RR+ LTDDQI++  Q+AR++ELWHG  W   S+K  
Sbjct: 171 LEFYQSLDVKDCSFYHIILKYLLQRRDFLTDDQIKFSAQIARYLELWHGASWDKLSAKDT 230

Query: 182 EIAHQGRNAFVLNFGNIAQRVASTIPQEWFELXXXXXXXXXXXXXXLVSTSKGETISCDY 241
              HQGRNA V NF ++  R+  T P++W  L              L+  S GE   C Y
Sbjct: 231 YFDHQGRNALVTNFDSVVNRIGDTFPKDWIRLNTEVKAIERDGKNVLIKLSSGEEYICQY 290

Query: 242 VIVTIPQSILAHSLQ-PEPR--KGRIEFIPPLSSEIKTSLEHAHFGGLGKVVFEFESCCW 298
            IVTIPQS+L  SLQ P+    KGRI+F PPL+ +I+ + +  HFGGLGKVVFEF+ C W
Sbjct: 291 TIVTIPQSVLQLSLQLPDESNTKGRIDFKPPLNPQIQEAFKKIHFGGLGKVVFEFDKCTW 350

Query: 299 SKERSRALALGKPIVDLTSKIREAVDLSQLVEKLDLDSKYTYKNGESWDFPLLFVNLAKH 358
           S E SR   L     +    +R+A     L++ L   S   ++N   WDFPLLF+NLAK 
Sbjct: 351 SNESSRIFTLAHSQENFVEDVRKAETWEGLIDNLKTPSSQLFEN--CWDFPLLFINLAKS 408

Query: 359 TDIPSFIMLMPNPLTEYIESI-KDKEKLYEFFKPILDQLLVTFGCFEPIIKDFDDEIVSE 417
              P+ IMLM +PL+ YIESI  DK+K+YEFF+P+LD+++ T      +I          
Sbjct: 409 IGRPTLIMLMQSPLSNYIESIGNDKQKVYEFFQPVLDKVMTTLQS-NKVINGLSANPTEA 467

Query: 418 DEKKPVLKNILTTSWTGDDYALGAYSACYPGDDPMNVVLALSNNQTSRIRFAGEHTIMDG 477
           +   P+LKN+L T+W  D Y+ GAYSAC+ GDD + +++A+SN Q SRIRFAGEHTIMDG
Sbjct: 468 ETNSPILKNLLVTNWNNDPYSRGAYSACFAGDDALEMIIAMSNGQDSRIRFAGEHTIMDG 527

Query: 478 AGCVYGAWESGKREALFI 495
           AG V+G+WESG+RE  +I
Sbjct: 528 AGAVHGSWESGRREGEYI 545

>KLLA0E07744g complement(696382..697983) similar to sp|P50264
           Saccharomyces cerevisiae YMR020w FMS1 suppressor of
           fenpropimorph resistance mutation FEN2 singleton, start
           by similarity
          Length = 533

 Score =  452 bits (1164), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 243/503 (48%), Positives = 333/503 (66%), Gaps = 20/503 (3%)

Query: 1   MIEKKVVIIGAGISGLKAASVLHEKGCDSCIVIEARDRIGGRLHTVSGYKGRKYDVGASW 60
           M +  V++IGAGISGLKA S L + G +S I IE+RDR+GGRL+T  G  G KYD+G SW
Sbjct: 33  MTDYSVIVIGAGISGLKATSDLVKSGIESVICIESRDRVGGRLNTRQGRNG-KYDIGGSW 91

Query: 61  HHDTLVNGLFLEEMGLPREERTPFVFDD-DSMLVFDKARGRVDYDSQMELEILVEELSKY 119
           HHDTL NGLF+EEM LP  ER  FVFDD D   + DK  G ++ D   +LE L  E  K+
Sbjct: 92  HHDTLSNGLFMEEMSLPESERAGFVFDDEDRACLVDKKLGVLEVD---QLECLAYEFEKW 148

Query: 120 TQLQYFEDLEVEDVNYFQTIMKYLYERRELLTDDQIQYLPQLARFMELWHGIDWKSQSSK 179
            +++Y++ L+VEDV+YFQ  +++ + R+E LTD+Q+ +LPQL R+MELWHG+DW + S K
Sbjct: 149 VEMRYYDSLDVEDVSYFQLCIEFCFSRKEFLTDEQLYHLPQLLRYMELWHGVDWYALSGK 208

Query: 180 GLEIAHQGRNAFVLNFGNIAQRVASTIPQEWFELXXXXXXXXXXXXXXLVSTSKGETISC 239
              I H GRNA VL++  I  R+++ +  +                   V+T KG+ + C
Sbjct: 209 WSGIEHNGRNALVLHYDKILARISNPVKDKIHLSESVNLIKKLSNGKYQVNTDKGKYL-C 267

Query: 240 DYVIVTIPQSILAHSLQPEP------RKGRIEFIPPLSSEIKTSL-EHAHFGGLGKVVFE 292
           DY IVT+PQS+LA S + E       RK RI F PPL+ +I  ++   A FG LGKV+FE
Sbjct: 268 DYCIVTVPQSVLAISCEQEENEFSHMRKARIGFEPPLNGDIFEAITTKASFGSLGKVIFE 327

Query: 293 FESCCWSKERSRALALGKPIVDLTSKIREAVDLSQLVEKLDLDSKYTYKNGESWDFPLLF 352
           F+S  WSK   R L + +   D    IR A DL  L++  D++ K    + +SW  P  F
Sbjct: 328 FDSIKWSKTSGRILTVHEQPTDFVESIRSAKDLKTLLK--DIEQKLPRSHEDSWKNPTCF 385

Query: 353 VNLAKHTDIPSFIMLMPNPLTEYIESIKDKEKLYEFFKPILDQLLVTFGCFEPIIKDFDD 412
           +NLAKHTD  SF+ L+  P+TEYIE++   E++ EFF+P+L++LL + G  +  I D +D
Sbjct: 386 LNLAKHTDTASFVALIQQPVTEYIETLT-TEEVEEFFRPVLNKLLNSLGSSD-YISDLND 443

Query: 413 EIVSEDEKKPVLKNILTTSWTGDDYALGAYSACYPGDDPMNVVLALSNNQTSRIRFAGEH 472
           E+  ++ K P+LKNILT++W+ D ++LGAYSAC PGDDPM++V+AL+  Q   +RFAGEH
Sbjct: 444 EV--KESKTPILKNILTSNWSSDPFSLGAYSACQPGDDPMDLVIALNVGQ-GNLRFAGEH 500

Query: 473 TIMDGAGCVYGAWESGKREALFI 495
           TIMDGAGC YGAWESGKREA +I
Sbjct: 501 TIMDGAGCAYGAWESGKREANYI 523

>ABR057W [648] [Homologous to ScYMR020W (FMS1) - SH]
           complement(500154..501716) [1563 bp, 520 aa]
          Length = 520

 Score =  435 bits (1118), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 217/496 (43%), Positives = 302/496 (60%), Gaps = 5/496 (1%)

Query: 3   EKKVVIIGAGISGLKAASVLHEKGCDSCIVIEARDRIGGRLHTV--SGYKGRKYDVGASW 60
           E  VV++GAGI+GLKAA+ LH  G + C+V+EAR R GGRL  V  S + GR+YD+GASW
Sbjct: 9   EYTVVVVGAGIAGLKAAAELHSAGIEKCVVLEARARTGGRLLQVESSVFPGRRYDLGASW 68

Query: 61  HHDTLVNGLFLEEMGLPREERTPFVFDDDSMLVFDKARGRVDYDSQMELEILVEELSKYT 120
           HHDTL N LF EE+ LP  ER  +VFDD   +V   A  R+D D  + LE L  E+  Y 
Sbjct: 69  HHDTLSNELFAEELRLPEAERAGYVFDDVPTMVVSPAGRRLDGDFGLMLEALQREVEHYI 128

Query: 121 QLQYFEDLEVEDVNYFQTIMKYLYERRELLTDDQIQYLPQLARFMELWHGIDWKSQSSKG 180
           + QYFE LE  D+ +F+ +M YLYERR +LTDDQIQ LP   RF E WH IDWK  S+K 
Sbjct: 129 EEQYFESLEARDMPFFELVMAYLYERRGVLTDDQIQQLPGTVRFREFWHAIDWKLLSAKL 188

Query: 181 LEIAHQGRNAFVLNFGNIAQRVASTIPQEWFELXXXXXXXXXXXXXXLVSTSKGETISCD 240
            E+ + GRNAFVLN+  + +RV S +P+EW  L               ++T+ G      
Sbjct: 189 SEVENNGRNAFVLNYDKLLRRVESGVPREWIRLGTRVTKIERVRDTVHITTADGACYVSK 248

Query: 241 YVIVTIPQSILAHSLQPEPRKGRIEFIPPLSSEIKTSLEHAHFGGLGKVVFEFESCCWSK 300
             IVT+PQS+L  SL+PE   GRIEF PPL+  I ++ E AH+  LGK+ FEF+ C W  
Sbjct: 249 CAIVTVPQSVLELSLKPERVPGRIEFRPPLNDNITSAFERAHYASLGKIFFEFDKCTWDT 308

Query: 301 ERSRALALGKPIVDLTSKIREAVDLSQLVEKLDLDSKYTYKNGESWDFPLLFVNLAKHTD 360
           +R R     K   D ++++R+A DL +L+      ++      + +DFP  F N+     
Sbjct: 309 QRPRVAIAAKVPDDFSAQVRKAQDLQELLRSASAQTEVKLGQ-DCFDFPQEFQNMVALAG 367

Query: 361 IPSFIMLMPNPLTEYIESIKDKEKLYEFFKPILDQLLVTFGCFEPIIKDFDDEIVSEDEK 420
           IP+ I     PLTE++E +  K+++ ++FKP +   L   G  E  + D  +    +D  
Sbjct: 368 IPTLIAFTQTPLTEHVERLS-KQEIVDYFKPAIVVALRALGSKEECLFDLGNTQPQDDSH 426

Query: 421 K-PVLKNILTTSWTGDDYALGAYSACYPGDDPMNVVLALSNNQTSRIRFAGEHTIMDGAG 479
             P+LKN++   W+ D Y+ G+Y+  +  DD + + +AL+N Q SRIRFAGEHT+M+G G
Sbjct: 427 PGPILKNVIFNPWSQDTYSRGSYTGSHVDDDQLPLTVALNNGQDSRIRFAGEHTVMEGNG 486

Query: 480 CVYGAWESGKREALFI 495
           C YGAWESG+REA ++
Sbjct: 487 CTYGAWESGRREAEYV 502

>CAGL0M07612g complement(760610..762355) similar to sp|P50264
           Saccharomyces cerevisiae YMR020w FMS1 suppressor of
           fenpropimorph resistance mutation FEN2, hypothetical
           start
          Length = 581

 Score =  417 bits (1072), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 236/582 (40%), Positives = 317/582 (54%), Gaps = 104/582 (17%)

Query: 6   VVIIGAGISGLKAASVLHEKGCDSCIVIEARDRIGGRLHTVSGYKGRKYDVGASWHHDTL 65
           VV++GAGI+GLKAASVL + G  SC+VIE+RDRIGGRL TV+GY G +YD+GASWHHDTL
Sbjct: 7   VVVVGAGIAGLKAASVLTQSG-KSCLVIESRDRIGGRLCTVTGYNGARYDLGASWHHDTL 65

Query: 66  VNGLFLEEMGLPREE------------------------------------RTPFVFDDD 89
            N LF EE+ L   +                                      PFVFDDD
Sbjct: 66  TNRLFAEEVQLAAVDGADSTPQMFSGGATHCSASSASSASSASTGGNSAGVYAPFVFDDD 125

Query: 90  SMLVFDKARGRVDYDSQMELEILVEELSKYTQLQYFEDLEVE-----------------D 132
             L+ DK RG +     + + ++ +E+ K+ +L +  +   E                 D
Sbjct: 126 DPLIVDKIRGSL---GDVTIRLIADEIEKFIELYFHSEYTAELSDDNDSQHSHEGFPRAD 182

Query: 133 VNYFQTIMKYLYERRELLTDDQIQYLPQLARFMELWHGIDWKSQSSKGLEIAHQGRNAFV 192
           +  F  ++ YL +R   LTDDQ+ Y  Q AR+MELWHG+ W   SS+     HQGRNAFV
Sbjct: 183 MPLFDMLLMYLQQRAPFLTDDQMWYGIQYARYMELWHGVSWYQLSSRDSFFGHQGRNAFV 242

Query: 193 LNFGNIAQRVASTIPQEW--FELXXXXXXXXXXXXXXLVS-----------TSKGE---- 235
           +N+  I  R+   I  E    +L               VS           T  G+    
Sbjct: 243 MNYDTIYNRIHGQIRTELGTVQLNSTVTKIENAGAHTTVSYTTSSASGAEDTQHGQHGAA 302

Query: 236 ----TISCDYVIVTIPQSILAHSLQPEPRKGRIEFIPPLSSEIKTSLEHAHFGGLGKVVF 291
               T+ C YVIVTIPQS+L+        +G +EF PPL  +I  +L+  HFG LGKVVF
Sbjct: 303 GQQHTVQCSYVIVTIPQSLLS--------EGAVEFKPPLVPQISAALQKMHFGSLGKVVF 354

Query: 292 EFESCCWSKERSRALALGKPIVD--------LTSKIREAVDLSQLVEKLDLDSKYTYKNG 343
           EFE CCW    ++ +A+     D        L  + RE    +Q ++ L  D K    + 
Sbjct: 355 EFEECCWDLHTAKIVAVAHAAADTRAEFTALLRKESREKNYTAQRLQALVQDVKQLLGDD 414

Query: 344 ----ESWDFPLLFVNLAKHTDIPSFIMLMPNPLTEYIESIKDKEKLYEFFKPILDQLLVT 399
               + W+ PLLFVN+AK T +PS +MLM  PLT YIES+ D  ++YEFFKP+L Q++  
Sbjct: 415 AVRHDCWNQPLLFVNMAKTTGVPSLMMLMAPPLTHYIESLHDSHQVYEFFKPVLSQIMSV 474

Query: 400 FGCFEPIIKDFD--DEIVSED----EKKPVLKNILTTSWTGDDYALGAYSACYPGDDPMN 453
                 II   D    +  +D    +K P+L+N++ T WT D Y+ GAYSACY GDD ++
Sbjct: 475 CNAPGHIINGLDIAGGVAGDDANVSDKGPILRNVIVTDWTNDPYSKGAYSACYAGDDALD 534

Query: 454 VVLALSNNQTSRIRFAGEHTIMDGAGCVYGAWESGKREALFI 495
           + LA+SN Q+SR+RFAGEHTI+DGAGC YGAWESG+REA +I
Sbjct: 535 MFLAMSNGQSSRVRFAGEHTILDGAGCAYGAWESGEREANYI 576

>CAGL0H05665g complement(561332..562762) highly similar to sp|P41921
           Saccharomyces cerevisiae YPL091w GLR1, hypothetical
           start
          Length = 476

 Score = 35.4 bits (80), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%)

Query: 4   KKVVIIGAGISGLKAASVLHEKGCDSCIVIEAR 36
           KKVV++GAG  G++ A V H  G DS +VI  +
Sbjct: 191 KKVVVVGAGYIGIELAGVFHGLGSDSHLVIRGK 223

>Kwal_33.15013
          Length = 333

 Score = 33.5 bits (75), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 40/89 (44%), Gaps = 25/89 (28%)

Query: 6   VVIIGAGISGLKAASVLHEKGCDSCI-VIEARDRIGGRLHTVSGYKGRKYDVGASWHHDT 64
           VVIIGAG SGL AA V+ +   D  I ++EA    G                G +W    
Sbjct: 67  VVIIGAGSSGLAAAYVIAKNRPDLKIAIVEANVSPG----------------GGAWLGGQ 110

Query: 65  LVNG--------LFLEEMGLPREERTPFV 85
           L +         LFLE++GLP E+   +V
Sbjct: 111 LFSAMIMRKPAHLFLEDLGLPYEDEGDYV 139

>KLLA0A08492g 751047..752168 weakly similar to sp|Q99042
          Trigonopsis variabilis D-amino acid oxidase (EC
          1.4.3.3) (DAMOX) (DAO) (DAAO), start by similarity
          Length = 373

 Score = 33.5 bits (75), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 32/59 (54%), Gaps = 7/59 (11%)

Query: 5  KVVIIGAGISGLKAA-SVLHEKGCDSC--IVIEARDRIGGRLHTVSGYKGRKYDVGASW 60
          KVV++GAGISGL  A S+L   G D    +VI ARD  G    T + Y       GA+W
Sbjct: 3  KVVVVGAGISGLSVAHSLLELYGRDKIEELVIIARDIPG----TFTSYDYTSPWAGANW 57

>Sklu_2260.6 YIL045W, Contig c2260 9086-10285 reverse complement
          Length = 399

 Score = 33.1 bits (74), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 31/59 (52%)

Query: 110 EILVEELSKYTQLQYFEDLEVEDVNYFQTIMKYLYERRELLTDDQIQYLPQLARFMELW 168
           EI++ E  K ++  +F+  +V  V YFQ   + +   +  + +DQ+ + P+   FM  W
Sbjct: 128 EIIIMEPPKRSKSVHFDQRDVVSVKYFQKDERPVEVAQREVEEDQLSFTPKQLSFMNSW 186

>Scas_664.2
          Length = 488

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%)

Query: 4   KKVVIIGAGISGLKAASVLHEKGCDSCIVIEA 35
           KKVV++GAG  G++ A V H  G ++ +VI  
Sbjct: 203 KKVVVVGAGYIGIELAGVFHGLGSEAHLVIRG 234

>YPL091W (GLR1) [5353] chr16 (375497..376948) Glutathione reductase,
           converts oxidized glutathione + NADPH into 2 glutathione
           + NADP+ [1452 bp, 483 aa]
          Length = 483

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%)

Query: 4   KKVVIIGAGISGLKAASVLHEKGCDSCIVIEA 35
           KKVV++GAG  G++ A V H  G ++ +VI  
Sbjct: 198 KKVVVVGAGYIGIELAGVFHGLGSETHLVIRG 229

>Sklu_2232.6 YOR058C, Contig c2232 5552-8305
          Length = 917

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%)

Query: 370 NPLTEYIESIKDKEKLYEFFKPILDQLLVTFGCFEPIIKDFDD 412
           N L E   +++D EKL E  + ++ QL   F  +EPI+K  D+
Sbjct: 483 NNLREQSTTVEDDEKLLEICESMISQLERKFALYEPILKLVDE 525

>KLLA0A00198g complement(14237..15211) highly similar to sp|P32318
           Saccharomyces cerevisiae YGR144w THI4 involved in
           thiamine biosynthesis and DNA repair singleton, start by
           similarity
          Length = 324

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 54/137 (39%), Gaps = 40/137 (29%)

Query: 6   VVIIGAGISGLKAASVLHEKGCDSCI-VIEARDRIGGRLHTVSGYKGRKYDVGASWHHDT 64
           VVIIGAG SGL AA V+ +   D  I +IEA    G                G  W    
Sbjct: 65  VVIIGAGSSGLSAAYVIAKNRPDLKIAIIEANVAPG----------------GGCWLGGQ 108

Query: 65  LVNGL--------FLEEMGLPREERTPFVFDDDSMLVFDKARGRVDYDSQMELEILVEEL 116
           L + +        FL+E+ +P E+   +V    + L                +  ++ E+
Sbjct: 109 LFSAMIMRKPADKFLDELNIPYEDEGHYVVVKHAALF---------------MSTVLSEV 153

Query: 117 SKYTQLQYFEDLEVEDV 133
            K+  ++ F    VED+
Sbjct: 154 LKFPNVKMFNATAVEDL 170

>CAGL0D01628g complement(170546..171628) weakly similar to tr|Q99177
           Saccharomyces cerevisiae YPR057w BRR1 involved in snRNP
           biogenesis, hypothetical start
          Length = 360

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 34/58 (58%), Gaps = 7/58 (12%)

Query: 359 TDIPSFIMLMPNPLTEYIESIKDKEKLYEFFKPILDQLLVTFGCFEPIIKDFDDEIVS 416
           T IPS   +  + +TEY+ SI   E  Y++F+ I D  ++  GC+  + + +DDE +S
Sbjct: 82  TSIPSDTKVKSDQITEYLYSI---ENWYKWFENISD--IIWHGCY--VFEGYDDESIS 132

>KLLA0E24112g complement(2143697..2145151) highly similar to
           sp|P41921 Saccharomyces cerevisiae YPL091w GLR1
           glutathione reductase (NADPH), start by similarity
          Length = 484

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 21/32 (65%)

Query: 4   KKVVIIGAGISGLKAASVLHEKGCDSCIVIEA 35
           KKVV++GAG  G++ A V +  G DS +VI  
Sbjct: 197 KKVVVVGAGYIGVEIAGVFNGLGSDSHLVIRG 228

>ACL031C [1018] [Homologous to ScYER080W - SH] (309369..311213)
           [1845 bp, 614 aa]
          Length = 614

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 422 PVLKNILTTSWTGDDYALGAYSACYPGDDPMNVVLALSNNQTSRIRFAG 470
           PV+ N+ T S    D A+     C+P  DPMNV+L   N +   + F G
Sbjct: 384 PVMYNLKTKSIPNMD-AIVKPRLCHPDLDPMNVILHEENGKPYLLDFEG 431

>YEL047C (YEL047C) [1381] chr5 complement(65385..66797)
          Cytoplasmic soluble fumarate reductase, involved with
          Osm1p in the reoxidation of NADH and the production of
          succinate during anaerobic growth [1413 bp, 470 aa]
          Length = 470

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 38/87 (43%), Gaps = 18/87 (20%)

Query: 6  VVIIGAGISGLKAASVLHEKGCDSCIVIEARDRIGGR-LHTVSGYKGRKYDVGASWHHDT 64
          VV+IG G++GL AA+ L  K      ++E    IGG  +   SG  G   +    +H   
Sbjct: 6  VVVIGTGLAGLAAANELVNKYNIPVTILEKASSIGGNSIKASSGINGACTETQRHFHI-- 63

Query: 65 LVNGLFLEEMGLPREERTPFVFDDDSM 91
                         E +P +F+DD++
Sbjct: 64 ---------------EDSPRLFEDDTI 75

>Sklu_2405.4 YPL091W, Contig c2405 6783-7839 reverse complement
          Length = 353

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 21/32 (65%)

Query: 4   KKVVIIGAGISGLKAASVLHEKGCDSCIVIEA 35
           +KVV++GAG  G++ A V H  G ++ +VI  
Sbjct: 182 QKVVVVGAGYIGVELAGVFHGLGSETHMVIRG 213

>Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement
          Length = 1261

 Score = 30.4 bits (67), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 1/68 (1%)

Query: 100  RVDYDSQMELEILVEELSKYTQLQYFE-DLEVEDVNYFQTIMKYLYERRELLTDDQIQYL 158
            ++  D Q  ++ L  EL++ T L   E   +++D N    I+    E+++LLT   I  L
Sbjct: 1153 KIPEDQQPLIDFLTSELARVTPLIPHEYTKQLKDCNKRLKILFNHLEKQDLLTQPTIDKL 1212

Query: 159  PQLARFME 166
             QL  F++
Sbjct: 1213 HQLVEFLK 1220

>AAL137W [50] [Homologous to ScYGR144W (THI4) - NSH]
           complement(108988..109983) [996 bp, 331 aa]
          Length = 331

 Score = 30.0 bits (66), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 39/89 (43%), Gaps = 25/89 (28%)

Query: 6   VVIIGAGISGLKAASVLHEKGCDSCI-VIEARDRIGGRLHTVSGYKGRKYDVGASWHHDT 64
           VVI+GAG SGL AA VL +   D  I +IEA    G                G +W    
Sbjct: 74  VVIVGAGSSGLSAAYVLAKNRPDLRIAIIEANVAPG----------------GGAWLGGQ 117

Query: 65  LVNG--------LFLEEMGLPREERTPFV 85
           L +         LFL+E+ +P E+   +V
Sbjct: 118 LFSAMIMRKPTHLFLDELEIPYEDEGDYV 146

>ADR290W [2031] [Homologous to ScYDL171C (GLT1) - SH]
            complement(1196235..1202822) [6588 bp, 2195 aa]
          Length = 2195

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 4    KKVVIIGAGISGLKAASVLHEKGCDSCIVIEARDRIGGRL 43
            + V IIG+G +GL  A  L+  G  S  V E  DR GG L
Sbjct: 1836 RTVAIIGSGPAGLSCADQLNRAG-HSVTVYERADRCGGLL 1874

>Scas_709.19
          Length = 505

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 2  IEKKVVIIGAGISGLKAASVLHEKGCDSCIVIEARDRIGGR-LHTVSGYKG 51
          ++K VV+IG+G++GL A++ L  K     ++++    +GG  +   SG  G
Sbjct: 38 LKKPVVVIGSGLAGLTASNRLVSKYNIPVVLLDKASSMGGNSIKASSGING 88

>Sklu_2020.3 YCR045C, Contig c2020 5388-6827 reverse complement
          Length = 479

 Score = 29.6 bits (65), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 31/63 (49%), Gaps = 1/63 (1%)

Query: 369 PNPLTEYIESIKDKEKLYEFFKPILDQLLVTFGCFEPIIKDFDDEIVSEDEKKPVLKNIL 428
           P  LT+++ES      L  F    + +   +FG FE    DF  + V + +K P++ +++
Sbjct: 28  PKSLTKFMESKIGDMSLKSFVSTRISKTF-SFGKFEGFTADFPKDFVEKLKKNPLVADVV 86

Query: 429 TTS 431
             S
Sbjct: 87  PNS 89

>Kwal_27.10088
          Length = 498

 Score = 29.6 bits (65), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query: 6  VVIIGAGISGLKAASVLHEKGCDSCIVIEARDRIGGR-LHTVSGYKG 51
          VVIIG+G++GL AA+ L  K     +++E    +GG  +   SG  G
Sbjct: 40 VVIIGSGLAGLTAANQLVLKHKVPIVMLEKASSLGGNSIKASSGING 86

>Kwal_47.17085
          Length = 2113

 Score = 29.6 bits (65), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 33/60 (55%), Gaps = 3/60 (5%)

Query: 292  EFESCCWSKERSRALAL---GKPIVDLTSKIREAVDLSQLVEKLDLDSKYTYKNGESWDF 348
            E  S    KERS  + L   G+P+  ++S +R+  +  ++ ++L++D    Y++   WD+
Sbjct: 1044 ELFSLSKPKERSTPIVLDINGRPVQKVSSTLRKKQEEEKMRKRLNVDLNPFYRDVLQWDY 1103

>CAGL0I05676g 535983..538259 some similarities with sp|P20095
           Saccharomyces cerevisiae YNR011c PRP2, hypothetical
           start
          Length = 758

 Score = 29.6 bits (65), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 36/69 (52%), Gaps = 3/69 (4%)

Query: 53  KYDVGASWHHDTLVNGLF---LEEMGLPREERTPFVFDDDSMLVFDKARGRVDYDSQMEL 109
           +Y+ G +W    L + L    ++++ +  +E+  FVFD D+M+ F K      YD +   
Sbjct: 41  RYNKGDNWEDRQLKHALKNPKVDDIVVAGQEQYDFVFDSDAMIDFSKEDEIDGYDDEEYE 100

Query: 110 EILVEELSK 118
           + L+E L K
Sbjct: 101 KKLLEALDK 109

>Kwal_51.19428
          Length = 482

 Score = 29.3 bits (64), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 4   KKVVIIGAGISGLKAASVLHEKGCDSCIVIEAR 36
           KKVV+ GAG  G++ A V H  G ++ +VI  +
Sbjct: 197 KKVVVSGAGYIGVELAGVFHGLGTETHMVIRGQ 229

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.138    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,428,679
Number of extensions: 736587
Number of successful extensions: 2258
Number of sequences better than 10.0: 48
Number of HSP's gapped: 2274
Number of HSP's successfully gapped: 50
Length of query: 495
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 389
Effective length of database: 12,926,601
Effective search space: 5028447789
Effective search space used: 5028447789
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)