Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.820650649925040.0
Sklu_2411.1050449918720.0
YKL045W (PRI2)52850917610.0
Scas_625.952451417410.0
CAGL0L01749g50250116980.0
KLLA0F04818g49349616180.0
ABR056C48950013970.0
Kwal_27.10213936127770.24
YPL085W (SEC16)2195124683.6
ADL093W1120116673.8
YOR227W124666665.0
KLLA0E11099g460118655.8
CAGL0F03157g99066648.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.8206
         (499 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.8206                                                          969   0.0  
Sklu_2411.10 YKL045W, Contig c2411 18845-20359                        725   0.0  
YKL045W (PRI2) [3214] chr11 (353138..354724) DNA primase large s...   682   0.0  
Scas_625.9                                                            675   0.0  
CAGL0L01749g 184351..185859 highly similar to sp|P20457 Saccharo...   658   0.0  
KLLA0F04818g 469283..470764 similar to sp|P20457 Saccharomyces c...   627   0.0  
ABR056C [647] [Homologous to ScYKL045W (PRI2) - SH] (498192..499...   542   0.0  
Kwal_27.10213                                                          34   0.24 
YPL085W (SEC16) [5359] chr16 (387062..393649) Hydrophilic protei...    31   3.6  
ADL093W [1648] [Homologous to ScYIL026C (IRR1) - SH] complement(...    30   3.8  
YOR227W (YOR227W) [5018] chr15 (762825..766565) Protein of unkno...    30   5.0  
KLLA0E11099g 979660..981042 some similarities with sp|Q03508 Sac...    30   5.8  
CAGL0F03157g complement(307854..310826) similar to sp|P32898 Sac...    29   8.7  

>Kwal_26.8206
          Length = 506

 Score =  969 bits (2504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/499 (93%), Positives = 466/499 (93%)

Query: 1   MFRQAKRRITSRRNFAGQVGDSSGKFILDGXXXXXXXXXXXXXXXXXXXFYQMPPKGEIT 60
           MFRQAKRRITSRRNFAGQVGDSSGKFILDG                   FYQMPPKGEIT
Sbjct: 1   MFRQAKRRITSRRNFAGQVGDSSGKFILDGTTTEEESKLYESLYESKLSFYQMPPKGEIT 60

Query: 61  LEQFEVWAINRLKVLLEIESCIQRNKSPKEMEIIVKPLLNKLLPSTSDDLQDRKKDYYSH 120
           LEQFEVWAINRLKVLLEIESCIQRNKSPKEMEIIVKPLLNKLLPSTSDDLQDRKKDYYSH
Sbjct: 61  LEQFEVWAINRLKVLLEIESCIQRNKSPKEMEIIVKPLLNKLLPSTSDDLQDRKKDYYSH 120

Query: 121 FILRLCFCRSKELRDKVIRSETALLKLRFNMLTSRDQAKFVQTLNLPFLQFITDEEKEQL 180
           FILRLCFCRSKELRDKVIRSETALLKLRFNMLTSRDQAKFVQTLNLPFLQFITDEEKEQL
Sbjct: 121 FILRLCFCRSKELRDKVIRSETALLKLRFNMLTSRDQAKFVQTLNLPFLQFITDEEKEQL 180

Query: 181 STQLYQTISSALQFQLNLTDETQRRQYFNQEKFIKLPFESVIDLVGSRQVFIKKGYAYLP 240
           STQLYQTISSALQFQLNLTDETQRRQYFNQEKFIKLPFESVIDLVGSRQVFIKKGYAYLP
Sbjct: 181 STQLYQTISSALQFQLNLTDETQRRQYFNQEKFIKLPFESVIDLVGSRQVFIKKGYAYLP 240

Query: 241 QFQQLNHIANEFSNMLSLALSKTYQSIPRLNEDDRLLPILHHLSSGYTIXXXXXXXXXXX 300
           QFQQLNHIANEFSNMLSLALSKTYQSIPRLNEDDRLLPILHHLSSGYTI           
Sbjct: 241 QFQQLNHIANEFSNMLSLALSKTYQSIPRLNEDDRLLPILHHLSSGYTISNFQQQDQFNQ 300

Query: 301 XXXGEVTATSVYSDKIRENFPLCAKNLMNGLKENHHLRYQGRQQLSFFLKGIGMDVDEAL 360
              GEVTATSVYSDKIRENFPLCAKNLMNGLKENHHLRYQGRQQLSFFLKGIGMDVDEAL
Sbjct: 301 ASQGEVTATSVYSDKIRENFPLCAKNLMNGLKENHHLRYQGRQQLSFFLKGIGMDVDEAL 360

Query: 361 QFWSDAFTSGGHMTADKFTKEYRYNFRHNYGLEGNRINYKPWDCRTILSRPRPSRGEYHG 420
           QFWSDAFTSGGHMTADKFTKEYRYNFRHNYGLEGNRINYKPWDCRTILSRPRPSRGEYHG
Sbjct: 361 QFWSDAFTSGGHMTADKFTKEYRYNFRHNYGLEGNRINYKPWDCRTILSRPRPSRGEYHG 420

Query: 421 CPYRDWNADRLSMELSQGMSLTPAQVTSVLDSVQRTEYTIACTKVFEMTHGGAANVEVND 480
           CPYRDWNADRLSMELSQGMSLTPAQVTSVLDSVQRTEYTIACTKVFEMTHGGAANVEVND
Sbjct: 421 CPYRDWNADRLSMELSQGMSLTPAQVTSVLDSVQRTEYTIACTKVFEMTHGGAANVEVND 480

Query: 481 QTHIAHPNLYYERSRQFQK 499
           QTHIAHPNLYYERSRQFQK
Sbjct: 481 QTHIAHPNLYYERSRQFQK 499

>Sklu_2411.10 YKL045W, Contig c2411 18845-20359
          Length = 504

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/499 (70%), Positives = 403/499 (80%), Gaps = 2/499 (0%)

Query: 1   MFRQAKRRITSRRNFAGQVGDSSGKFILDGXXXXXXXXXXXXXXXXXXXFYQMPPKGEIT 60
           MFRQ KR+I+SRRNF     D+SG+FIL                     FY +PP+GEIT
Sbjct: 1   MFRQTKRKISSRRNFDNST-DASGQFILQATTSEGEQKLYEKLYSSKISFYDLPPQGEIT 59

Query: 61  LEQFEVWAINRLKVLLEIESCIQRNKSPKEMEIIVKPLLNKLLPSTSDDLQDRKKDYYSH 120
           L+QFE WAI+RLK+LLEIESC+QRNK+ KE+E IVKPLL K LP  +D  QDRKKDYYSH
Sbjct: 60  LDQFETWAIDRLKILLEIESCVQRNKTIKEIETIVKPLLQKSLPYNTDSFQDRKKDYYSH 119

Query: 121 FILRLCFCRSKELRDKVIRSETALLKLRFNMLTSRDQAKFVQTLNLPFLQFITDEEKEQL 180
           FILRLCFCRSKELR+K  RSET L K+RFNMLTS+DQ KFVQ+LNLP LQFI+DEEK  L
Sbjct: 120 FILRLCFCRSKELREKFTRSETLLFKIRFNMLTSQDQTKFVQSLNLPLLQFISDEEKANL 179

Query: 181 STQLYQTISSALQFQLNLTDETQRRQYFNQEKFIKLPFESVIDLVGSRQVFIKKGYAYLP 240
           S QLYQTI+ ALQFQL+L++E QRRQ+F QEKFIKLPFESVI+LVGSRQVF+ +G+AYLP
Sbjct: 180 SQQLYQTIAPALQFQLSLSEEQQRRQFFQQEKFIKLPFESVIELVGSRQVFVSRGFAYLP 239

Query: 241 QFQQLNHIANEFSNMLSLALSKTYQSIPRLNEDDRLLPILHHLSSGYTIXXXXXXXXXXX 300
           QFQQLNHIANEFS  LS  + KTYQ +PRLNEDDRLLPILHHLSSGY I           
Sbjct: 240 QFQQLNHIANEFSTKLSTEMLKTYQHLPRLNEDDRLLPILHHLSSGYAIVDFQQQGNEYG 299

Query: 301 XXXGEVTATSVYSDKIRENFPLCAKNLMNGLKENHHLRYQGRQQLSFFLKGIGMDVDEAL 360
              G++TA  VYSD+I  NFPLCAKNLM GL+ NHHLRYQGRQQLS FLKGIG++VDEAL
Sbjct: 300 ADNGDITAKMVYSDEIVSNFPLCAKNLMRGLQTNHHLRYQGRQQLSLFLKGIGLNVDEAL 359

Query: 361 QFWSDAFTSGGHMTADKFTKEYRYNFRHNYGLEGNRINYKPWDCRTILSRPRPSRGEYHG 420
           +FWSDAF   G M+ DKF KEY+YNFRHNYGLEGNRINYKPWDCRTILS+PRP+RGE+HG
Sbjct: 360 KFWSDAFGRNGGMSIDKFNKEYKYNFRHNYGLEGNRINYKPWDCRTILSKPRPARGEFHG 419

Query: 421 CPYRDWNADRLSMELSQGMSLTPAQVTSVLDSVQRTEYTIACTKVFEMTHGGAANVEVND 480
           CPYRDWN ++LS ELSQ + LTP QVT VLDS QR E+T+ACTKVFE+TH G++  E+N+
Sbjct: 420 CPYRDWNVEKLSSELSQNLKLTPTQVTGVLDSCQRNEFTVACTKVFELTH-GSSTTEINE 478

Query: 481 QTHIAHPNLYYERSRQFQK 499
           Q+HIAHPNLYY+RSRQ QK
Sbjct: 479 QSHIAHPNLYYDRSRQLQK 497

>YKL045W (PRI2) [3214] chr11 (353138..354724) DNA primase large
           subunit (DNA polymerase alpha 58 kDa subunit), involved
           in synthesis of RNA primers for Okazaki fragments [1587
           bp, 528 aa]
          Length = 528

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/509 (64%), Positives = 397/509 (77%), Gaps = 15/509 (2%)

Query: 1   MFRQAKRRITSRRNFAG---------QVGDSSG--KFILDGXXXXXXXXXXXXXXXXXXX 49
           MFRQ+KRRI SR+NF+           VG+++   + IL                     
Sbjct: 1   MFRQSKRRIASRKNFSSYDDIVKSELDVGNTNAANQIILSSSSSEEEKKLYARLYESKLS 60

Query: 50  FYQMPPKGEITLEQFEVWAINRLKVLLEIESCIQRNKSPKEMEIIVKPLLNKLLPSTSDD 109
           FY +PP+GEITLEQFE+WAI+RLK+LLEIESC+ RNKS KE+E I+KP   KLLP  ++ 
Sbjct: 61  FYDLPPQGEITLEQFEIWAIDRLKILLEIESCLSRNKSIKEIETIIKPQFQKLLPFNTES 120

Query: 110 LQDRKKDYYSHFILRLCFCRSKELRDKVIRSETALLKLRFNMLTSRDQAKFVQTLNLPFL 169
           L+DRKKDYYSHFILRLCFCRSKELR+K +R+ET L K+RFNMLTS DQ KFVQ+L+LP L
Sbjct: 121 LEDRKKDYYSHFILRLCFCRSKELREKFVRAETFLFKIRFNMLTSTDQTKFVQSLDLPLL 180

Query: 170 QFITDEEKEQLSTQLYQTISSALQFQLNLTDETQRRQYFNQEKFIKLPFESVIDLVGSRQ 229
           QFI++EEK +LS QLYQT+S++LQFQLNL +E QR+QYF QEKFIKLPFE+VI+LVG+R 
Sbjct: 181 QFISNEEKAELSHQLYQTVSASLQFQLNLNEEHQRKQYFQQEKFIKLPFENVIELVGNRL 240

Query: 230 VFIKKGYAYLPQFQQLNHIANEFSNMLSLALSKTYQSIPRLNEDDRLLPILHHLSSGYTI 289
           VF+K GYAYLPQFQQLN ++NEF++ L+  L KTYQ +PRLNEDDRLLPIL+HLSSGYTI
Sbjct: 241 VFLKDGYAYLPQFQQLNLLSNEFASKLNQELIKTYQYLPRLNEDDRLLPILNHLSSGYTI 300

Query: 290 X--XXXXXXXXXXXXXGEVTATSVYSDKIRENFPLCAKNLMNGLKENHHLRYQGRQQLSF 347
                            E+ A SV+S++I  N+PLC KNLM GLK+NHHLRY GRQQLS 
Sbjct: 301 ADFNQQKANQFSENVDDEINAQSVWSEEISSNYPLCIKNLMEGLKKNHHLRYYGRQQLSL 360

Query: 348 FLKGIGMDVDEALQFWSDAFTSGGHMTADKFTKEYRYNFRHNYGLEGNRINYKPWDCRTI 407
           FLKGIG+  DEAL+FWS+AFT  G+MT +KF KEYRY+FRHNYGLEGNRINYKPWDC TI
Sbjct: 361 FLKGIGLSADEALKFWSEAFTRNGNMTMEKFNKEYRYSFRHNYGLEGNRINYKPWDCHTI 420

Query: 408 LSRPRPSRGEYHGCPYRDWNADRLSMELSQGMSLTPAQVTSVLDSVQRTEYTIACTKVFE 467
           LS+PRP RG+YHGCP+RDW+ +RLS EL + M LT AQ+ SVLDS Q+ EYTIACTKVFE
Sbjct: 421 LSKPRPGRGDYHGCPFRDWSHERLSAEL-RSMKLTQAQIISVLDSCQKGEYTIACTKVFE 479

Query: 468 MTHGGA-ANVEVNDQTHIAHPNLYYERSR 495
           MTH  A A++E+ +QTHIAHPNLY+ERSR
Sbjct: 480 MTHNSASADLEIGEQTHIAHPNLYFERSR 508

>Scas_625.9
          Length = 524

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/514 (63%), Positives = 389/514 (75%), Gaps = 16/514 (3%)

Query: 1   MFRQAKRRITSRRNFAGQVGDSSG-----------KFILDGXXXXXXXXXXXXXXXXXXX 49
           MFRQ KRRI+SRRNF      S             +FIL G                   
Sbjct: 1   MFRQNKRRISSRRNFDSSPFGSDNKNGNENNGGANQFILPGSTTEEEKTLYNNIYDSKIS 60

Query: 50  FYQMPPKGEITLEQFEVWAINRLKVLLEIESCIQRNKSPKEMEIIVKPLLNKLLPSTSDD 109
           FY+  P+GEITLEQFEVWAI+RLK+LLEIESC+ RNK+ KE+E ++KP   KLLP  +D 
Sbjct: 61  FYEARPQGEITLEQFEVWAIDRLKILLEIESCLSRNKTLKEIETLIKPQFQKLLPFNTDS 120

Query: 110 LQDRKKDYYSHFILRLCFCRSKELRDKVIRSETALLKLRFNMLTSRDQAKFVQTLNLPFL 169
             D+KKDYYSHFILRLCFCR+KELR+K IR+ET L K+RFNMLTS DQ KFV++LNL  L
Sbjct: 121 FLDKKKDYYSHFILRLCFCRTKELREKFIRAETLLFKIRFNMLTSFDQIKFVKSLNLSKL 180

Query: 170 QFITDEEKEQLSTQLYQTISSALQFQLNLTDETQRRQYFNQEKFIKLPFESVIDLVGSRQ 229
           QFITDEEK +LS +LYQTI+ AL +QLNLTDE QR+ +F  EKFIKLPFE+VI+LVG+RQ
Sbjct: 181 QFITDEEKTELSDKLYQTITPALIYQLNLTDENQRKLFFQNEKFIKLPFENVIELVGNRQ 240

Query: 230 VFIKKGYAYLPQFQQLNHIANEFSNMLSLALSKTYQSIPRLNEDDRLLPILHHLSSGYTI 289
            FI+KG+ Y+PQFQQLN I+ EFSN L+ AL KTYQ +PRLNEDDRLLPIL+HLSSGYTI
Sbjct: 241 AFIRKGFIYIPQFQQLNLISTEFSNKLNEALMKTYQFLPRLNEDDRLLPILNHLSSGYTI 300

Query: 290 XXXXXXXXXXXXXXG---EVTATSVYSDKIRENFPLCAKNLMNGLKENHHLRYQGRQQLS 346
                         G   E+ A +VYS++I  N+PLC KNL  GLKE+ HL+Y GRQQLS
Sbjct: 301 ADFNENSKFGMYQNGNDDEINAQTVYSEEISANYPLCIKNLFRGLKEHGHLKYHGRQQLS 360

Query: 347 FFLKGIGMDVDEALQFWSDAFTSGGHMTADKFTKEYRYNFRHNYGLEGNRINYKPWDCRT 406
            FLKGIG+  DE+L+FWS+AFT  G MT DKF KEYRYNFRHNYGLEGNRINYKPWDCRT
Sbjct: 361 LFLKGIGLSADESLKFWSEAFTKNGRMTVDKFNKEYRYNFRHNYGLEGNRINYKPWDCRT 420

Query: 407 ILSRPRPSRGEYHGCPYRDWNADRLSMELSQGMSLTPAQVTSVLDSVQRTEYTIACTKVF 466
           ILS+PRP RGEYHGCPYRDWN D+L+ EL + M+LTP+Q+ S+LDS ++TEYTIACTK F
Sbjct: 421 ILSKPRPGRGEYHGCPYRDWNPDKLTAEL-RSMNLTPSQIASILDSCEKTEYTIACTKTF 479

Query: 467 EMTHG-GAANVEVNDQTHIAHPNLYYERSRQFQK 499
           E TH     ++E++DQTHI+HPNLY+ERSRQ QK
Sbjct: 480 EFTHNTTGTDLEIDDQTHISHPNLYFERSRQLQK 513

>CAGL0L01749g 184351..185859 highly similar to sp|P20457
           Saccharomyces cerevisiae YKL045w PRI2, start by
           similarity
          Length = 502

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/501 (64%), Positives = 382/501 (76%), Gaps = 8/501 (1%)

Query: 1   MFRQAKRRITSRRNFAGQVGDSSGKFILDGXXXXXXXXXXXXXXXXXXXFYQMPPKGEIT 60
           MFRQ+K+R++ RRNFA   GD+S   I+                     FY +PP+GEIT
Sbjct: 1   MFRQSKKRVSMRRNFAEDRGDASA-IIIGATTTEEEKKLYQRIYENKLSFYDIPPQGEIT 59

Query: 61  LEQFEVWAINRLKVLLEIESCIQRNKSPKEMEIIVKPLLNKL-LPSTSDDLQDRKKDYYS 119
           LE+FE+WAI+RLK+LLEIESC+ RNK+ KE+E I+KPL  K  + +  D  +DRKK+YYS
Sbjct: 60  LEEFEIWAIDRLKLLLEIESCLARNKTLKEIEGIIKPLFKKYNIFNNMDTFEDRKKEYYS 119

Query: 120 HFILRLCFCRSKELRDKVIRSETALLKLRFNMLTSRDQAKFVQTLNLPFLQFITDEEKEQ 179
           HFILRLCFC+SKELRDK +R ET LL+LRFNML+S DQAKFV++LNLP LQFI +EEK +
Sbjct: 120 HFILRLCFCKSKELRDKFVRIETMLLRLRFNMLSSTDQAKFVKSLNLPSLQFIDEEEKAE 179

Query: 180 LSTQLYQTISSALQFQLNLTDETQRRQYFNQEKFIKLPFESVIDLVGSRQVFIKKGYAYL 239
           LSTQLYQTIS  LQF LNL DE QR+ YF  EKFIKLPFESVI+LVG+RQVF+K GYAYL
Sbjct: 180 LSTQLYQTISRDLQFTLNLADEQQRQLYFKNEKFIKLPFESVIELVGNRQVFLKNGYAYL 239

Query: 240 PQFQQLNHIANEFSNMLSLALSKTYQSIPRLNEDDRLLPILHHLSSGYTIXXXXX-XXXX 298
           PQFQQLN IANEFS  L   L KTYQ +PRLNEDDRL+PIL+HLSSGYTI          
Sbjct: 240 PQFQQLNLIANEFSTKLQEELIKTYQYLPRLNEDDRLIPILNHLSSGYTIADSGSFDSQF 299

Query: 299 XXXXXGEVTATSVYSDKIRENFPLCAKNLMNGLKENHHLRYQGRQQLSFFLKGIGMDVDE 358
                 E+ A SV+S++I +++PL  KNL  GLKEN+HLRY GRQQL+ FLKGIG+ VDE
Sbjct: 300 GNNEDNEINAKSVWSEEISKHYPLSVKNLFYGLKENNHLRYHGRQQLTLFLKGIGLSVDE 359

Query: 359 ALQFWSDAFTSGGHMTADKFTKEYRYNFRHNYGLEGNRINYKPWDCRTILSRPRPSRGEY 418
           AL+FW DAFT    MT +KF KEYRYN RH+YGLEGNRINYKPWDCRTILS+PRP+RGEY
Sbjct: 360 ALKFWHDAFTKNNKMTTEKFNKEYRYNIRHSYGLEGNRINYKPWDCRTILSKPRPNRGEY 419

Query: 419 HGCPYRDWNADRLSMELSQGMSLTPAQVTSVLDSVQRTEYTIACTKVFEMTHGGAANVEV 478
           HGCP+RDWN DRL+ ELS+ M LT  Q+T VLDS  + EYTIACTKVFEMTH    NV  
Sbjct: 420 HGCPFRDWNHDRLTSELSK-MGLTTQQITDVLDSCDKHEYTIACTKVFEMTH----NVPE 474

Query: 479 NDQTHIAHPNLYYERSRQFQK 499
            +  HI+HPNLY+ERSRQ +K
Sbjct: 475 GESMHISHPNLYFERSRQLEK 495

>KLLA0F04818g 469283..470764 similar to sp|P20457 Saccharomyces
           cerevisiae YKL045w PRI2 DNA-directed DNA polymerase
           alpha, 58 KD subunit (DNA primase) singleton, start by
           similarity
          Length = 493

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/496 (61%), Positives = 371/496 (74%), Gaps = 12/496 (2%)

Query: 1   MFRQAKRRITSRRNFAGQVGDSSGKFILDGXXXXXXXXXXXXXXXXXXXFYQMPPKGEIT 60
           MFRQ K+R+ +RRNF   VGD   +  + G                   +Y++PPKGEIT
Sbjct: 1   MFRQTKKRVANRRNF---VGDDQNRIDVTGYGNQDDGMQYDILYPTKLTWYRLPPKGEIT 57

Query: 61  LEQFEVWAINRLKVLLEIESCIQRNKSPKEMEIIVKPLLNKLLPSTSDDLQDRKKDYYSH 120
           LEQFE WAI+RLKVLLE+ES  QRNKS KE+E  +KP+L+  L +  +D + RKKDYYSH
Sbjct: 58  LEQFETWAIDRLKVLLELESLWQRNKSMKEIETTIKPVLSSKL-NLGNDNESRKKDYYSH 116

Query: 121 FILRLCFCRSKELRDKVIRSETALLKLRFNMLTSRDQAKFVQTLNLPFLQFITDEEKEQL 180
           FILRLCFCRSKELRDK +R+ET L K+RF MLT++DQ  F+ +L+LP++  I +EEK+ L
Sbjct: 117 FILRLCFCRSKELRDKFVRAETLLFKIRFQMLTTQDQLNFISSLDLPYVNSIDEEEKQSL 176

Query: 181 STQLYQTISSALQFQLNLTDETQRRQYFNQEKFIKLPFESVIDLVGSRQVFIKKGYAYLP 240
           ST+LYQT+S  L FQLNLT+ETQRRQ+FN+EK+ KLP E+V+DLVGSRQ+FIKKG+AY+P
Sbjct: 177 STELYQTVSHLLTFQLNLTEETQRRQFFNREKYYKLPMENVMDLVGSRQIFIKKGWAYVP 236

Query: 241 QFQQLNHIANEFSNMLSLALSKTYQSIPRLNEDDRLLPILHHLSSGYTIXXXXXXXXXXX 300
           QFQQLN I+NEFS+ L   L  TYQ IP+LNEDDR+LPILHHLSSGY +           
Sbjct: 237 QFQQLNLISNEFSDCLQTELMGTYQMIPKLNEDDRILPILHHLSSGYVV--TESQELNGA 294

Query: 301 XXXGEVTATSVYSDKIRENFPLCAKNLMNGLKENHHLRYQGRQQLSFFLKGIGMDVDEAL 360
               E T  SV + K+ E+FPLCAK LM  L+ NHHLRYQGRQQLSFFLKGIG+ VDEAL
Sbjct: 295 GVNDEFTHRSVKTKKVMEHFPLCAKQLMEQLQTNHHLRYQGRQQLSFFLKGIGLSVDEAL 354

Query: 361 QFWSDAFTSGGHMTADKFTKEYRYNFRHNYGLEGNRINYKPWDCRTILSRPRPSRGEYHG 420
           QFW+++FTSGG MT D+F KEY+YNFRHNYGLEGNRINYKPWDCRTILS+PRPSRGEYHG
Sbjct: 355 QFWTESFTSGGKMTVDQFNKEYKYNFRHNYGLEGNRINYKPWDCRTILSKPRPSRGEYHG 414

Query: 421 CPYRDWNADRLSMELSQGMSLTPAQVTSVLDSVQRTEYTIACTKVFEMTHGGAANVEVND 480
           CPYRD++ D+L   L + MSLT  QV SV++S Q+ +YTIACTKVFE  H          
Sbjct: 415 CPYRDYHPDKLVATLKE-MSLTQQQVNSVVESCQQQDYTIACTKVFEAVHKTTTA----- 468

Query: 481 QTHIAHPNLYYERSRQ 496
              I HPN Y+ERSRQ
Sbjct: 469 DLQIVHPNQYFERSRQ 484

>ABR056C [647] [Homologous to ScYKL045W (PRI2) - SH]
           (498192..499661) [1470 bp, 489 aa]
          Length = 489

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/500 (53%), Positives = 344/500 (68%), Gaps = 18/500 (3%)

Query: 1   MFRQAKRRITSRRNFAGQVGDSSGKFILDGXXXXXXXXXXXXXXXXXXXFYQMPPKGEIT 60
           MFRQ+KRR+  RR+  G    + G  IL G                   FY +PP GEIT
Sbjct: 1   MFRQSKRRVAQRRHGDG----ADGATILAGLTAEEEQARYDQLYPAKLSFYALPPVGEIT 56

Query: 61  LEQFEVWAINRLKVLLEIESCIQRNKSPKEMEIIVKPLLNKLLPSTSDDLQDRKKDYYSH 120
           L+QFE WAI+RLKVLLE+ES IQRN++ +E+E  +KPLL KLL    ++ + R+KDYYSH
Sbjct: 57  LDQFETWAIDRLKVLLELESLIQRNRAGRELEQAMKPLLGKLL-PLGEEQEARRKDYYSH 115

Query: 121 FILRLCFCRSKELRDKVIRSETALLKLRFNMLTSRDQAKFVQTLNLPFLQFITDEEKEQL 180
           FILRLCFCR+ ELR++ +R+ETAL +LRF MLTS DQA+FVQ+L+LP +QFI + EK+ L
Sbjct: 116 FILRLCFCRTAELRERFVRAETALFRLRFQMLTSADQARFVQSLDLPLVQFIDEAEKQAL 175

Query: 181 STQLYQTISSALQFQLNLTDETQRRQYFNQEKFIKLPFESVIDLVGSRQVFIKKGYAYLP 240
             QLY  ++  L  QL LTDE QRRQ+F  E+F+KLPFESVIDLVG R V ++ G+AYLP
Sbjct: 176 GAQLYDAVAPQLLHQLQLTDEAQRRQFFQHERFLKLPFESVIDLVGPRHVLLRGGWAYLP 235

Query: 241 QFQQLNHIANEFSNMLSLALSKTYQSIPRLNEDDRLLPILHHLSSGYTIXXXXXXXXXXX 300
           QF QLNHIA E++  L+  L  TYQ +P L  DDRL PIL HLS+G+ +           
Sbjct: 236 QFMQLNHIAAEYAARLATDLRATYQHLPALAGDDRLPPILAHLSAGHVV------APPPP 289

Query: 301 XXXGEVTATSVYSDKIRENFPLCAKNLMNGLKENHHLRYQGRQQLSFFLKGIGMDVDEAL 360
              G +TA  + ++ +R   PLCA+ L++GL  NHHLRY GRQQL+ FLKG GM  D+AL
Sbjct: 290 PTGGGLTAADLAAEPVRAALPLCARGLLDGLAANHHLRYLGRQQLALFLKGAGMSADDAL 349

Query: 361 QFWSDAFTSGGHMTADKFTKEYRYNFRHNYGLEGNRINYKPWDCRTILSRPRPSRGEYHG 420
           +FW+DAFT+G   + D+F +EYRY  RH YGLEGNRINY+PWDCRTIL++PRP+R E+HG
Sbjct: 350 RFWADAFTAGP-TSLDRFNREYRYALRHTYGLEGNRINYRPWDCRTILAKPRPARNEFHG 408

Query: 421 CPYRDWNADRLSMELSQGMSLTPAQVTSVLDSVQRTEYTIACTKVFEMTHGGAA-----N 475
           CPYRDW  DRL+  L+      PA V +V D+  R EYT+ACT VF+  HG  A     +
Sbjct: 409 CPYRDWAPDRLAAALAAMQLAPPA-VAAVRDACARREYTLACTHVFDACHGHVAPSAPGH 467

Query: 476 VEVNDQTHIAHPNLYYERSR 495
           V   D +HI HPN ++ER+R
Sbjct: 468 VPAPDMSHIVHPNQFFERAR 487

>Kwal_27.10213
          Length = 936

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 53/127 (41%), Gaps = 3/127 (2%)

Query: 156 DQAKFVQTLNLPFLQFITDEEKEQLSTQLYQTISSALQFQLNLTDETQRRQYFNQEK--F 213
           D AK    LN  F     D     +    Y T++S L+   +L +  Q RQ+  Q    F
Sbjct: 768 DIAKLSSLLNSSFYTGTPDRH-SMIGAPAYLTVTSPLRRFPDLINHLQIRQHLTQNPLPF 826

Query: 214 IKLPFESVIDLVGSRQVFIKKGYAYLPQFQQLNHIANEFSNMLSLALSKTYQSIPRLNED 273
            KL  + +I  + SR + I+K       F  L H+ +   +     +S    SIPR+   
Sbjct: 827 SKLDIDEMIWHLQSRDLVIRKAARDSASFWTLKHLKSLQDSSPDRKISVMVTSIPRMGFV 886

Query: 274 DRLLPIL 280
             +LP L
Sbjct: 887 RCVLPDL 893

>YPL085W (SEC16) [5359] chr16 (387062..393649) Hydrophilic protein
            required for autophagy and vesicle formation in ER to
            Golgi transport [6588 bp, 2195 aa]
          Length = 2195

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 54/124 (43%), Gaps = 25/124 (20%)

Query: 165  NLPFLQFITDEEKEQLSTQ-LYQTISSALQFQLNLTDETQRRQYFNQEKFIKLPFESVID 223
            NLP+   I D    Q S Q ++ T  +A + Q+      +  Q+ N EK +K        
Sbjct: 1501 NLPYTHRIGD--SLQGSPQRIHNTQFAAAEPQMASLRRVRTDQHTN-EKALK-------- 1549

Query: 224  LVGSRQVFIKKGYAYLPQFQQLNHIANEFSNMLSLALSKTYQSIPRLNEDDRLLPILHHL 283
               S+Q+  KK  AY PQF Q NH         S+ + K+  ++P L  D    P L  +
Sbjct: 1550 ---SQQILEKKSTAYTPQFGQ-NH---------SVPMEKSNSNVPSLFADFPAPPKLGTV 1596

Query: 284  SSGY 287
             S Y
Sbjct: 1597 PSNY 1600

>ADL093W [1648] [Homologous to ScYIL026C (IRR1) - SH]
           complement(518397..521759) [3363 bp, 1120 aa]
          Length = 1120

 Score = 30.4 bits (67), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 55/116 (47%), Gaps = 9/116 (7%)

Query: 103 LPSTSDDLQDRKKDYYSHF--ILRLCFCRSKELRDKVIRSETALLKLRFNMLTSRDQAKF 160
           L ST  D+Q  +    S+   I++LCF    +  D+ IRSE+ L   ++          F
Sbjct: 334 LESTIADIQGTRTVLESNIENIIKLCFVHRFKDVDETIRSESVLHLAKW---LENYPEHF 390

Query: 161 VQTLNLPFLQFITDEEKEQLSTQLYQTISSALQFQ----LNLTDETQRRQYFNQEK 212
            +   L +  ++  +    +  Q+ +T+S  ++F      N+TD++  RQ+F + K
Sbjct: 391 FKATYLKYFGWLLSDTSSVVRLQVLKTLSDLVKFINKQFRNMTDDSSLRQFFERFK 446

>YOR227W (YOR227W) [5018] chr15 (762825..766565) Protein of unknown
           function, interacts with Glc7p [3741 bp, 1246 aa]
          Length = 1246

 Score = 30.0 bits (66), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 4/66 (6%)

Query: 194 FQLNLTDETQRRQYFNQEKFI-KLPFESVIDLVGSRQVF---IKKGYAYLPQFQQLNHIA 249
           F LN T+ T         K++ +LP    +DL    Q+F   +  GY Y PQF QL  I 
Sbjct: 722 FTLNSTNITSVDDMSYILKYLSRLPSIKFLDLSNLPQLFPGILTSGYKYFPQFPQLKRIH 781

Query: 250 NEFSNM 255
            +F ++
Sbjct: 782 FDFDDL 787

>KLLA0E11099g 979660..981042 some similarities with sp|Q03508
           Saccharomyces cerevisiae YMR265c singleton, hypothetical
           start
          Length = 460

 Score = 29.6 bits (65), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 54/118 (45%), Gaps = 19/118 (16%)

Query: 151 MLTSRDQAKFVQTLNLPFLQFITDEE-----------KEQLSTQLYQT--ISSALQF--- 194
           +LT R +A+F + +     QF  D E           KEQ++T  Y+T  I S L F   
Sbjct: 116 LLTGRSEAQFTRVIEEAMKQFQEDFELSRGFDAVCLKKEQMTTASYKTSLIVSLLDFYSN 175

Query: 195 --QLNLTDETQRRQYFNQEKFIKLPFESVIDLVGSRQVFIKKGYAYLPQFQQLNHIAN 250
             Q+++ D+ +R     +E F+K   E+V   +    V +   + YLP   ++  + N
Sbjct: 176 VNQISIYDDRERHCKMFRE-FLKNYAETVRPALIPSVVIVPAIFYYLPSDVEIELVHN 232

>CAGL0F03157g complement(307854..310826) similar to sp|P32898
           Saccharomyces cerevisiae YDR430c, start by similarity
          Length = 990

 Score = 29.3 bits (64), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 2/66 (3%)

Query: 429 DRLSMELSQGMSLTPAQVTSVLDSVQRTEYTIACTKVFEMTHGGAANVEVNDQTHIAHPN 488
           D + +EL   +SL  A +T +    + T Y     ++   T G + N+ VN       PN
Sbjct: 574 DMIPLELYPFLSLFAASLTHL--GTKTTPYGAIDNEIKLHTGGISTNISVNADPTTLQPN 631

Query: 489 LYYERS 494
           LY++ S
Sbjct: 632 LYFDMS 637

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.135    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,136,293
Number of extensions: 619644
Number of successful extensions: 1801
Number of sequences better than 10.0: 21
Number of HSP's gapped: 1837
Number of HSP's successfully gapped: 21
Length of query: 499
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 393
Effective length of database: 12,926,601
Effective search space: 5080154193
Effective search space used: 5080154193
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)