Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.820065264333670.0
Sklu_2411.1168758513161e-174
Scas_709.5175954411281e-145
YMR019W (STB4)94956611151e-140
KLLA0D12672g86593900.011
CAGL0I02552g1005247860.028
Kwal_23.6537552113850.042
YOR380W (RDR1)546112820.087
KLLA0C10923g77576820.088
KLLA0A09251g688288810.12
Sklu_2023.3658177750.66
Scas_680.25738290740.82
Kwal_23.4370692409721.5
Sklu_2321.390678711.7
KLLA0F02299g872116702.2
Kwal_23.2905881150693.0
YIR023W (DAL81)97049693.5
KLLA0F02387g727135684.2
KLLA0C17820g64859675.5
YOR301W (RAX1)43562666.1
CAGL0I07755g105377676.2
YLR014C (PPR1)904116666.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.8200
         (643 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.8200                                                         1301   0.0  
Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement     511   e-174
Scas_709.51                                                           439   e-145
YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding prote...   434   e-140
KLLA0D12672g complement(1076011..1078608) gi|125903|sp|P08657|LA...    39   0.011
CAGL0I02552g 227257..230274 weakly similar to sp|P38699 Saccharo...    38   0.028
Kwal_23.6537                                                           37   0.042
YOR380W (RDR1) [5153] chr15 (1051286..1052926) Protein with simi...    36   0.087
KLLA0C10923g complement(939148..941475) similar to sp|P07272 Sac...    36   0.088
KLLA0A09251g 808253..810319 some similarities with sp|P38699 Sac...    36   0.12 
Sklu_2023.3 YHR178W, Contig c2023 2677-4653 reverse complement         33   0.66 
Scas_680.25                                                            33   0.82 
Kwal_23.4370                                                           32   1.5  
Sklu_2321.3 YLR014C, Contig c2321 8747-11467                           32   1.7  
KLLA0F02299g 205549..208167 no similarity, hypothetical start          32   2.2  
Kwal_23.2905                                                           31   3.0  
YIR023W (DAL81) [2687] chr9 (399774..402686) Transcriptional act...    31   3.5  
KLLA0F02387g complement(213669..215852) similar to sp|P47988 Sac...    31   4.2  
KLLA0C17820g 1586564..1588510 similar to sp|P32641 Saccharomyces...    30   5.5  
YOR301W (RAX1) [5085] chr15 (880961..882268) Protein involved in...    30   6.1  
CAGL0I07755g complement(745315..748476) similar to tr|Q12180 Sac...    30   6.2  
YLR014C (PPR1) [3432] chr12 complement(172267..174981) Transcrip...    30   6.8  

>Kwal_26.8200
          Length = 652

 Score = 1301 bits (3367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 626/643 (97%), Positives = 626/643 (97%)

Query: 1   MDNNLGESCTKHRMECSYGSDVYARRVTAVSALPEKPGFSGVPPPSAGGPCGYVXXXXXX 60
           MDNNLGESCTKHRMECSYGSDVYARRVTAVSALPEKPGFSGVPPPSAGGPCGYV      
Sbjct: 1   MDNNLGESCTKHRMECSYGSDVYARRVTAVSALPEKPGFSGVPPPSAGGPCGYVSAAGAS 60

Query: 61  XXXXXXXXXXXDNTSPSLQASPWQRYSLGKYRFHRRHHNLVPYYLGKALSASLPPALVRK 120
                      DNTSPSLQASPWQRYSLGKYRFHRRHHNLVPYYLGKALSASLPPALVRK
Sbjct: 61  TAGASTIGASTDNTSPSLQASPWQRYSLGKYRFHRRHHNLVPYYLGKALSASLPPALVRK 120

Query: 121 HALRAPRLQYYGWNMSGGHYLKLGSSATHFHDTRSWRWDFTQDLQRGIVEKLATFFFQHV 180
           HALRAPRLQYYGWNMSGGHYLKLGSSATHFHDTRSWRWDFTQDLQRGIVEKLATFFFQHV
Sbjct: 121 HALRAPRLQYYGWNMSGGHYLKLGSSATHFHDTRSWRWDFTQDLQRGIVEKLATFFFQHV 180

Query: 181 NRFVSIVHEQVFWQQFRSGLLNPGPKLGPTDLFEAILNLMVVIALRFTDTGATGDDRAAK 240
           NRFVSIVHEQVFWQQFRSGLLNPGPKLGPTDLFEAILNLMVVIALRFTDTGATGDDRAAK
Sbjct: 181 NRFVSIVHEQVFWQQFRSGLLNPGPKLGPTDLFEAILNLMVVIALRFTDTGATGDDRAAK 240

Query: 241 NTVLTKDEVTWIDAQHHPRLEDALFEHAYTVVAHLSFEWESFELIQAWLLITVYLRTCHR 300
           NTVLTKDEVTWIDAQHHPRLEDALFEHAYTVVAHLSFEWESFELIQAWLLITVYLRTCHR
Sbjct: 241 NTVLTKDEVTWIDAQHHPRLEDALFEHAYTVVAHLSFEWESFELIQAWLLITVYLRTCHR 300

Query: 301 QVSCWQALSRAVQMCNGMSLFLDKFPENSTAYDECRARNCYWTTFVLDRLVSFQTGRFPE 360
           QVSCWQALSRAVQMCNGMSLFLDKFPENSTAYDECRARNCYWTTFVLDRLVSFQTGRFPE
Sbjct: 301 QVSCWQALSRAVQMCNGMSLFLDKFPENSTAYDECRARNCYWTTFVLDRLVSFQTGRFPE 360

Query: 361 LAMPGPEMVSPDVAPDSWLSSESIALYKLALLMTRCQKRYGQDLTILETNDMTAQLSQWF 420
           LAMPGPEMVSPDVAPDSWLSSESIALYKLALLMTRCQKRYGQDLTILETNDMTAQLSQWF
Sbjct: 361 LAMPGPEMVSPDVAPDSWLSSESIALYKLALLMTRCQKRYGQDLTILETNDMTAQLSQWF 420

Query: 421 HENAPSLDYNHLCARQVFLTYLDVRIALEIRGLYQLLDLDGDIPPQVPTSAIPLNATSLI 480
           HENAPSLDYNHLCARQVFLTYLDVRIALEIRGLYQLLDLDGDIPPQVPTSAIPLNATSLI
Sbjct: 421 HENAPSLDYNHLCARQVFLTYLDVRIALEIRGLYQLLDLDGDIPPQVPTSAIPLNATSLI 480

Query: 481 DLVSQILGHFESIVEEGKFFQPWWLNLSLLFTSSIICLTLIQGGLQLARARVLLEKSFKI 540
           DLVSQILGHFESIVEEGKFFQPWWLNLSLLFTSSIICLTLIQGGLQLARARVLLEKSFKI
Sbjct: 481 DLVSQILGHFESIVEEGKFFQPWWLNLSLLFTSSIICLTLIQGGLQLARARVLLEKSFKI 540

Query: 541 WHYIEDARPPNPPEMAAECLWCLKMLNHMFCQRLKSCAKRLESSIGLDHVDDSVNDNKFR 600
           WHYIEDARPPNPPEMAAECLWCLKMLNHMFCQRLKSCAKRLESSIGLDHVDDSVNDNKFR
Sbjct: 541 WHYIEDARPPNPPEMAAECLWCLKMLNHMFCQRLKSCAKRLESSIGLDHVDDSVNDNKFR 600

Query: 601 QFGKVERGSDANSSAPELDNSPFSQAHGEDNLLAHLQWFDQWL 643
           QFGKVERGSDANSSAPELDNSPFSQAHGEDNLLAHLQWFDQWL
Sbjct: 601 QFGKVERGSDANSSAPELDNSPFSQAHGEDNLLAHLQWFDQWL 643

>Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement
          Length = 687

 Score =  511 bits (1316), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 257/585 (43%), Positives = 368/585 (62%), Gaps = 44/585 (7%)

Query: 81  SPWQRYSLGKYRFHRRHHNLVPYYLGKALSASLPPALVRKHALRAPRLQYYGWNMSGGHY 140
           SPWQ +SL KYRFHRR+ NL+PYYLG++L  SLPP  ++ H L+ PR+Q YGWNMSGGHY
Sbjct: 118 SPWQTFSLDKYRFHRRYQNLLPYYLGQSLMQSLPPQTIQHHNLKTPRVQNYGWNMSGGHY 177

Query: 141 LKLGSSATHFHDTRSWRWDFTQDLQRGIVEKLATFFFQHVNRFVSIVHEQVFWQQFRSGL 200
           LK GS      D+     +F   +Q  IV KL  F+F H+N   SIVHEQVF QQF +G 
Sbjct: 178 LKNGS------DSSLDIINFDDPVQLDIVNKLLRFYFDHLNPVFSIVHEQVFLQQFNTGF 231

Query: 201 LNPGPKLGPTDLFEAILNLMVVIALRFTDTGATGDDRAAKNTVLTKDEVTWIDAQHHPRL 260
           LN   +   + LF ++L L++  +LRF +  +      ++    ++ ++ W+  + +  L
Sbjct: 232 LNK--RRNSSKLFISMLYLILATSLRFYEGYS-----QSQPVAFSQHQLDWL-FKTNSSL 283

Query: 261 EDALFEHAYTVVAHLSFEWESFELIQAWLLITVYLRTCHRQVSCWQALSRAVQMCNGMSL 320
           E+ LF  A+ +V+ LSFEWESFELIQ+WLLI  YLRTCHRQ SCW AL  A++MC GM+L
Sbjct: 284 EERLFHFAHEIVSRLSFEWESFELIQSWLLIAFYLRTCHRQTSCWNALGSAIRMCKGMAL 343

Query: 321 FLDKFPENSTAYDECRARNCYWTTFVLDRLVSFQTGRFPELAMPGPEMVSPDVAPDSWLS 380
           +L++FP+  T Y+E + +NC+W+ F++D+++SFQ GR+P+L++P  +M  PD  PD W  
Sbjct: 344 YLNRFPQRHTLYEETKVKNCFWSCFIMDKVISFQMGRYPDLSLPAEQMPPPDRNPDGWFH 403

Query: 381 SESIALYKLALLMTRCQKRYGQDLTILETNDMTAQLSQWFHENAPSLDYNHLCARQVFLT 440
            E+I +Y+L+L+++ CQKR G+DL++ E   +  +L+ WF    P   +  L ++QV  T
Sbjct: 404 EETIQMYRLSLIISDCQKRDGEDLSVNEVQILKQRLTNWFRFFTP---HETLYSKQVLFT 460

Query: 441 YLDVRIALEIRGLYQLLD---LDGDIPPQVPTSAIPLNATSLIDLVSQILGHFESIVEEG 497
           YLD+ + L IRGL+QL++   +    PP +      L A S        L   E++ +  
Sbjct: 461 YLDISLTLGIRGLFQLINPPVITDVTPPALLLDLSSLLANS-----RTFLDSLETVEKSN 515

Query: 498 KFFQPWWLNLSLLFTSSIICLTLIQGGLQLARARVLLEKSFKIWHYIEDARPPNPPEMAA 557
           + F PWWLNLSLLF  S+ C+T++  GL+L +A+ LL +SF IW+ +      NPPEMA 
Sbjct: 516 ELFIPWWLNLSLLFAVSVSCITVLHAGLKLQQAQSLLRQSFSIWNSLVSLHAKNPPEMAK 575

Query: 558 ECLWCLKMLNHMFCQRLKSCAKRLESSIGLDHVDDSVNDNKFRQFGK---------VERG 608
           ECLWCLKMLNHM C RL++  + L    G+DH D S+N N+F QFGK         VE G
Sbjct: 576 ECLWCLKMLNHMSCLRLQTSMQNLRQIFGIDHGDSSLNKNRFAQFGKAGDNEEDNDVELG 635

Query: 609 SD----------ANSSAPELDNSPFSQAHGEDNLLAHLQWFDQWL 643
            +          A +S+P L+   F     +D+L A+LQWFDQW+
Sbjct: 636 QEDAHTKDVSVSATTSSPMLNPPTFETLLQDDDLFANLQWFDQWV 680

>Scas_709.51
          Length = 759

 Score =  439 bits (1128), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 221/544 (40%), Positives = 326/544 (59%), Gaps = 26/544 (4%)

Query: 81  SPWQRYSLGKYRFHRRHHNLVPYYLGKALSASLPPALVRKHALRAPRLQYYGWNMSGGHY 140
           SPWQ +S  KYRFHRR+ N++P   GK+L ++LPP L++++ L  PR+Q Y WNMSGGHY
Sbjct: 146 SPWQSFSYDKYRFHRRYQNVLPNKFGKSLLSALPPQLIQENNLETPRIQNYAWNMSGGHY 205

Query: 141 LKLGSSATHFHDTRSWRWDFTQDLQRGIVEKLATFFFQHVNRFVSIVHEQVFWQQFRSGL 200
           LK      H +++    ++F   L    V KL TF+F+ +N+   I+HE++FW QF +G 
Sbjct: 206 LKF--EQMHENNSSLLFFNFDNPLHLSTVTKLLTFYFKQINKPYGIIHEEMFWNQFNNGF 263

Query: 201 LNPGPKLGPT-DLFEAILNLMVVIALRFTDTGATGDDRAAKNTVLTKDEVTWIDAQHHPR 259
           L  G +   +  LF ++L L++ I++RF +    G   ++ + + T  E   +  Q   R
Sbjct: 264 LQQGKQNNKSAKLFTSMLYLVLTISIRFYE----GLPASSLDQLFTPQEQELVHRQRILR 319

Query: 260 LEDALFEHAYTVVAHLSFEWESFELIQAWLLITVYLRTCHRQVSCWQALSRAVQMCNGMS 319
            E+ +F HAY++V+ L+FEWESFELIQ+WLLI  YLRTC+RQ+SCW ALSRA+ MCNGMS
Sbjct: 320 NEEYMFGHAYSIVSKLTFEWESFELIQSWLLIAFYLRTCYRQISCWNALSRAINMCNGMS 379

Query: 320 LFLDKFPENSTAYDECRARNCYWTTFVLDRLVSFQTGRFPELAMPGPEMVSPDVAPDSWL 379
           L+L++FPE  + YDE +A +C+W+ F++D+L+SFQ GR  +L+MP   M  P   PD+W 
Sbjct: 380 LYLNRFPEVHSTYDEVKAWHCFWSCFIMDKLISFQLGRLYQLSMPVTNMNQP-TNPDTWF 438

Query: 380 SSESIALYKLALLMTRCQKRYGQDLTILETNDMTAQLSQWFHENAPSLDYNH-------- 431
             E+I L++L+ ++   QK+  Q+L I E+  +  ++ +W      S + N         
Sbjct: 439 HDETIQLFQLSKIVMDFQKKEAQELDIQESLQLRGEMDKWLDNFMKSQEDNSSSSLLFTN 498

Query: 432 --LCARQVFLTYLDVRIALEIRGLYQLLDLDGDIPPQVPTS---AIPLNATSLIDLVSQI 486
             L   Q FL+YLD+R+  E+R L+ L++     PP   +      P++  SLI      
Sbjct: 499 QPLYQLQPFLSYLDIRVTFELRYLFCLIN-----PPSYTSPLSYTFPIDIPSLIKHCQLS 553

Query: 487 LGHFESIVEEGKFFQPWWLNLSLLFTSSIICLTLIQGGLQLARARVLLEKSFKIWHYIED 546
           L     I  +  FF PWWLNLS LF+  ++ + LI  G++      +L+KS K+W  +E 
Sbjct: 554 LDLLTGINSKDFFFVPWWLNLSQLFSIGLVSVVLIHAGIETVAMTTILDKSMKLWQSLET 613

Query: 547 ARPPNPPEMAAECLWCLKMLNHMFCQRLKSCAKRLESSIGLDHVDDSVNDNKFRQFGKVE 606
           A P NPP M  +CLWC++MLN M C RL     +  S +G    D+S N NKF QFGKV 
Sbjct: 614 ASPKNPPVMLPQCLWCIRMLNQMCCIRLSLSQSKFASIVGEHGGDNSHNKNKFSQFGKVG 673

Query: 607 RGSD 610
              D
Sbjct: 674 ENED 677

>YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding protein,
           contains a Zn[2]-Cys[6] fungal-type binuclear cluster
           domain in the N-terminal region [2850 bp, 949 aa]
          Length = 949

 Score =  434 bits (1115), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 225/566 (39%), Positives = 332/566 (58%), Gaps = 37/566 (6%)

Query: 81  SPWQRYSLGKYRFHRRHHNLVPYYLGKALSASLPPALVRKHALRAPRLQYYGWNMSGGHY 140
           SPWQ +SL KYRFHRR+ N++PYYLG ++   L P  +    L+ PR+Q YGWN+SGGHY
Sbjct: 306 SPWQTFSLDKYRFHRRYQNILPYYLGVSILKDLSPQTIEYAKLKRPRVQNYGWNLSGGHY 365

Query: 141 LKL-GSSATHFHDTR--SWRWDFTQDLQRGIVEKLATFFFQHVNRFVSIVHEQVFWQQFR 197
           LK  G   +   + R  S  +DF   +   ++ KL  ++F  +N   SI+HE  FWQQ+ 
Sbjct: 366 LKYKGDFRSQEKNIRHESKFFDFDDPVHLSLINKLLRYYFDEINPVFSIIHEATFWQQYN 425

Query: 198 SGLLNPGPKLGPT-DLFEAILNLMVVIALRFTD---TGATGDDRAAKNTV-LTKDEVTWI 252
           +  L  G +   + +LF ++L L++   LRF +    G  G    +  ++ +T +E + +
Sbjct: 426 NKFLRQGKQNNSSANLFTSMLYLILSTTLRFREGHLDGQKGQGTYSNTSLNITFEEKSIL 485

Query: 253 DAQHHPRLEDALFEHAYTVVAHLSFEWESFELIQAWLLITVYLRTCHRQVSCWQALSRAV 312
             +  P +E+ LF++AY ++  L+FEWESFELIQ+WLLIT Y RTC+RQ +CW ALS+AV
Sbjct: 486 IKK--PSIEENLFKYAYLIINTLTFEWESFELIQSWLLITFYFRTCYRQTACWNALSQAV 543

Query: 313 QMCNGMSLFLDKFPENSTAYDECRARNCYWTTFVLDRLVSFQTGRFPELAMPGPEMVSPD 372
            MCNGMSL+L+KFPE  + YDE +A +C+W  F++D+L+SFQ GRF +L++P  EM    
Sbjct: 544 NMCNGMSLYLNKFPEIHSTYDESKAWHCFWCCFIMDKLISFQMGRFYQLSLPASEMCEQM 603

Query: 373 ---------VAPDSWLSSESIALYKLALLMTRCQKRYGQDLTILETNDMTAQLSQWF--- 420
                       D W   E+  +  L++++T+  KR  QDL + ET  + +QL QW+   
Sbjct: 604 NLVKSKKFLQEEDDWFHEETFQMLDLSIIVTQFLKRDAQDLNLNETVQLRSQLGQWYDTF 663

Query: 421 ----HENAPSLDYNHLCARQVFLTYLDVRIALEIRGLYQLLDLDGDIPPQVPTSAIPL-- 474
                 NA   +Y +    Q F+TYLD+R+  E+R L+ L      I P    +   L  
Sbjct: 664 IVGSQTNAYDDNYRYFYQVQPFMTYLDIRLTFEVRQLFCL------IAPSSTANNKSLEY 717

Query: 475 --NATSLIDLVSQILGHFESIVEEGKFFQPWWLNLSLLFTSSIICLTLIQGGLQLARARV 532
             +   LI      + +   I     FF PWWLNLS LFT ++IC+  +  G+ + + + 
Sbjct: 718 VVDTELLISHCQMAIENLAEITRSNLFFVPWWLNLSQLFTVNLICIIYLHAGIAVTQNKA 777

Query: 533 LLEKSFKIWHYIEDARPPNPPEMAAECLWCLKMLNHMFCQRLKSCAKRLESSIGLDHVDD 592
           +++   +IW  +E ++P N P M  ECLWCLKMLNHMFC RL+  A +LE+++G DH DD
Sbjct: 778 IMQSCQEIWRTLECSKPKNRPSMLPECLWCLKMLNHMFCIRLRDSALQLEATLGTDHGDD 837

Query: 593 SVNDNKFRQFGKV-ERGSDANSSAPE 617
           + N NKF QF KV +  +D    A E
Sbjct: 838 TPNRNKFEQFKKVGDNDADVEVDAGE 863

>KLLA0D12672g complement(1076011..1078608)
           gi|125903|sp|P08657|LAC9_KLULA Kluyveromyces lactis
           Lactose regulatory protein LAC9, start by similarity
          Length = 865

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 46/93 (49%), Gaps = 2/93 (2%)

Query: 265 FEHAYTVVAHLSFEWESFELIQAWLLITVYLRTCHRQVSCWQALSRAVQMCNGMSLFLDK 324
           +++A + ++    E  S +L  A +L+T Y++  H+  + W  +     M   + L  D 
Sbjct: 450 YQNALSYLSTAVLETGSTDLTIALILLTHYVQKMHKPNTAWSLIGLCSHMATSLGLHRD- 508

Query: 325 FPENSTAYDECRARNCYWTTFVLDRLVSFQTGR 357
            P NST +D+   R  +WT +     +S +TGR
Sbjct: 509 LP-NSTIHDQQLRRVLWWTIYCTGCDLSLETGR 540

>CAGL0I02552g 227257..230274 weakly similar to sp|P38699
           Saccharomyces cerevisiae YHR178w STB5 SIN3 binding
           protein, hypothetical start
          Length = 1005

 Score = 37.7 bits (86), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 51/247 (20%), Positives = 103/247 (41%), Gaps = 46/247 (18%)

Query: 164 LQRGIVEKLATFFFQHVNRFVSIVHEQVFWQQFRS--------GLLNPGPKLGPTDLFEA 215
           +++ ++EK  + +F+H +R   +V +  F ++  +         L    P+L  T +FE 
Sbjct: 399 IKKSLLEKFVSAYFEHNHRLFPMVDKVTFLKKLATINSFESIEMLAVNNPELPKTFIFE- 457

Query: 216 ILNLMVVIALRFTDTGATGDDRAAKNTVLTKDEVTWIDAQHHPRLEDALFEH-AYTVVAH 274
              + +++A+     G T   RA K   LT D             E  L+EH AY  + +
Sbjct: 458 ---IYMIMAI-----GCTTLQRAGK---LTTD-------------EGHLYEHLAYLAMRN 493

Query: 275 LS--FEWESFELIQAWLLITVYLRTCHRQVSCWQ----ALSRAVQMCNGMSLFLDKFPEN 328
                  +    ++  +L+ +Y     + VS W     A+  A+++     L   +  + 
Sbjct: 494 FRDILHQQDITTLRCLILLGIYSFFEPKGVSSWTISGIAMRLAIELGLNRPLTAKEMGDM 553

Query: 329 STAYDECRARNCYWTTFVLDRLVSFQTGRFP-----ELAMPGPEMVSPDVAPDSWLSSES 383
           S    E R R  +W+ +  +R+V+   GR       ++ +P P  +      D  +++  
Sbjct: 554 SAVEVESRYR-VFWSAYCFERVVATSLGRVSAIDDEDIGIPLPRALYDSEKEDIEVTNLI 612

Query: 384 IALYKLA 390
           I+L K+ 
Sbjct: 613 ISLRKMG 619

>Kwal_23.6537
          Length = 552

 Score = 37.4 bits (85), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 52/113 (46%), Gaps = 13/113 (11%)

Query: 257 HPRLEDALFEHAYTVVAHLSFEWE-SFELIQAWLLITVYLRTCHRQVSCWQALSRAVQMC 315
           H R  D + ++A  ++   +F  + S E I AW+L ++YLR   R    W A    + + 
Sbjct: 216 HARELD-IVQYAKDILEDPTFSSQPSIEQISAWVLRSIYLRATARPHVAWLASCMTMHLV 274

Query: 316 NGMSLF--LDKF--------PENSTAYDEC-RARNCYWTTFVLDRLVSFQTGR 357
              +L   +DK         P    A   C RAR  +W  + ++ ++S++ GR
Sbjct: 275 EATALHHEVDKVELATRNDAPLPPRANSVCERARRLFWCAWCINTIISYEYGR 327

>YOR380W (RDR1) [5153] chr15 (1051286..1052926) Protein with
           similarity to transcription factors, has Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region [1641 bp, 546 aa]
          Length = 546

 Score = 36.2 bits (82), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 46/112 (41%), Gaps = 12/112 (10%)

Query: 257 HPRLEDALFEHAYTVVAHLSF-EWESFELIQAWLLITVYLRTCHRQVSCWQALSRAVQMC 315
           HPR  D + ++A  ++   +F    + E + AW+L T+YLR   R    W A    + + 
Sbjct: 222 HPREMD-IVQYAKGILDDPTFSRIPTVEQVSAWVLRTIYLRATSRPHVAWLASCVTIHLS 280

Query: 316 NGMSL----------FLDKFPENSTAYDECRARNCYWTTFVLDRLVSFQTGR 357
             + L            +  P   T       R  +W  + ++ ++S+  GR
Sbjct: 281 EAIGLHHEIDREDIAISNNVPPKRTTVVSEHTRRLFWCAWSINTILSYDYGR 332

>KLLA0C10923g complement(939148..941475) similar to sp|P07272
           Saccharomyces cerevisiae YLR014c PPR1 transcription
           factor regulating pyrimidine pathway, hypothetical start
          Length = 775

 Score = 36.2 bits (82), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 32/76 (42%)

Query: 282 FELIQAWLLITVYLRTCHRQVSCWQALSRAVQMCNGMSLFLDKFPENSTAYDECRARNCY 341
            E +Q  LLI VY          W  L  A+++C  + L  +K  +N   +     R  +
Sbjct: 364 LEALQGLLLIAVYSLMRPTVPGLWYTLGSAIRLCVDLGLHAEKLNKNYEPFIRDVRRRLF 423

Query: 342 WTTFVLDRLVSFQTGR 357
           W  + +DR V    GR
Sbjct: 424 WCCYSMDRQVCAYFGR 439

>KLLA0A09251g 808253..810319 some similarities with sp|P38699
           Saccharomyces cerevisiae YHR178w STB5 SIN3 binding
           protein, hypothetical start
          Length = 688

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 57/288 (19%), Positives = 116/288 (40%), Gaps = 39/288 (13%)

Query: 150 FHDTRSWRWDFTQDLQRGIVEKLATFFFQHVNRFVSIVHEQVFWQQFRSGLLNPGPKLGP 209
           F   R+       +++R + ++    FF+H ++   ++++  F  +  +  +    KL  
Sbjct: 237 FKGGRTTPMKMPLNIERPLYDRFIAAFFKHNHKSYPLMNKIEFLNKVST--IRDFNKLPE 294

Query: 210 TDLFEAILNLMVVIALRFTDTGATGDDRAAKNTVLTKDEVTWIDAQHHPRLEDALFEH-A 268
            +    +  L +++A+     G T   RA    +LT +E             + L EH A
Sbjct: 295 EESNAFVFQLHMIMAI-----GCTTLQRAG---MLTSEE-------------EGLSEHFA 333

Query: 269 YTVVAHLS--FEWESFELIQAWLLITVYLRTCHRQVSCWQALSRAVQMCNGMSLFLDKFP 326
           Y  + +       ++ E I+  LL+ +Y     + VS W      +++C G  L     P
Sbjct: 334 YLAMKNFCPVMHLQNLETIKCLLLLGIYSFFEPKGVSSWTISGLIMRLCIGFGLNRALTP 393

Query: 327 EN----STAYDECRARNCYWTTFVLDRLVSFQTGRFP-----ELAMPGPEMVSPDVAPDS 377
           +     S    E R R  +W  +  +RLV+   GR       ++++P P  +  +   D 
Sbjct: 394 KKLKTMSVIDVEMRYR-AFWAFYSFERLVATSLGRISCLSDDDISVPPPRALFEEEKDDI 452

Query: 378 WLSSESIALYKLALLMTRCQKRYG---QDLTILETNDMTAQLSQWFHE 422
            +++  I+L ++   + R     G   + L   E  ++  +L Q   E
Sbjct: 453 EVTNMMISLRRIGGRIYRKVHSVGAARRKLNAEEKKNVIDKLRQELDE 500

>Sklu_2023.3 YHR178W, Contig c2023 2677-4653 reverse complement
          Length = 658

 Score = 33.5 bits (75), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 76/177 (42%), Gaps = 16/177 (9%)

Query: 261 EDALFEHAYTVVAHLSF----EWESFELIQAWLLITVYLRTCHRQVSCWQALSRAVQMCN 316
           E+ L EH ++ +A   F      ++ E I+  LL+ +Y     + VS W      +++  
Sbjct: 289 EEELSEH-FSYLAMKKFCKVMHAQNVETIKCLLLLGIYSFFEPKGVSSWTISGLMMRLAI 347

Query: 317 GMSL--FLDKFPENSTAYDECRAR-NCYWTTFVLDRLVSFQTGRFP-----ELAMPGPEM 368
           G+ L   L K   ++ +  E   R   +W+ +  +RLVS   GR       ++++P P  
Sbjct: 348 GLGLNRALTKKKMSTMSVIEVEMRYRAFWSFYCFERLVSSSLGRISAIDDDDISIPLPRS 407

Query: 369 VSPDVAPDSWLSSESIALYKLALLMTRCQKRYG---QDLTILETNDMTAQLSQWFHE 422
           +  +   D  ++   I+L K+   + +     G   +  T  E  D+  +L Q   E
Sbjct: 408 LYEEEKEDIEVTRMMISLRKIGGKIYKQVHSVGAGKKKPTATEKQDIINKLRQEIDE 464

>Scas_680.25
          Length = 738

 Score = 33.1 bits (74), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 62/290 (21%), Positives = 117/290 (40%), Gaps = 46/290 (15%)

Query: 164 LQRGIVEKLATFFFQHVNRFVSIVHEQVFWQQFRS--GLLNPGPKLGPTDLFEAILNLMV 221
           + R ++++    +F+H +R   ++ +  F  +  +     N      P  +FE      +
Sbjct: 286 IDRSLLDRFIAAYFKHNHRLFPMIDKIAFLNEVSTMTKFENIETDHDPIFVFE----FYM 341

Query: 222 VIALRFTDTGATGDDRAAKNTVLTKDEVTWIDAQHHPRLEDALFEH-AYTVVAHLS--FE 278
           ++A+     G T   RA    +L  DE            ED L EH +Y  + + S   E
Sbjct: 342 IMAI-----GCTTLRRAG---MLNMDE------------ED-LSEHLSYLAMKNFSHVME 380

Query: 279 WESFELIQAWLLITVYLRTCHRQVSCW--QALSRAVQMCNGMSLFLDKFPENSTAYDECR 336
            ++ E ++  LL+ +Y     R  S W    +   + +  G++  L     N  +  E  
Sbjct: 381 LQNIETLRCLLLLGIYSFFEPRGSSSWTISGIIMRLTIFLGLNRVLTPKKMNMMSAVEVE 440

Query: 337 ARN-CYWTTFVLDRLVSFQTGRFP-----ELAMPGPEMVSPDVAPDSWLSSESIALYKLA 390
           ARN  +W+ +  +RLVS   GR+      E+ +  P  +      +  ++   IAL K+A
Sbjct: 441 ARNRVFWSAYCFERLVSTCLGRYSAIDDDEITIDVPRPLYEGEKDEIEVTRTMIALRKIA 500

Query: 391 LLMTRCQKRYG---QDLTILETNDMTAQLSQ-----WFHENAPSLDYNHL 432
             + +         Q LT+ E  D+   L +     + +E A    +N +
Sbjct: 501 GRIFKQVHSVSVSRQKLTMEERQDIIKNLRKELDDVYMNEQAKMEKHNSM 550

>Kwal_23.4370
          Length = 692

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 80/409 (19%), Positives = 166/409 (40%), Gaps = 61/409 (14%)

Query: 164 LQRGIVEKLATFFFQHVNRFVSIVHEQVFWQQFRSGLLNPGPKLGPTDLFEAILNLMVVI 223
           ++R + ++    +F+H +R   ++++  F  +  +  +    ++        I  L +V+
Sbjct: 249 IERPLYDRFIAAYFKHNHRSYPLINKIEFLNKVST--IRQFEEMEDKYETSFIFQLYMVM 306

Query: 224 ALRFTDTGATGDDRAAKNTVLTKDEVTWIDAQHHPRLEDALFEH-AYTVVAHLS--FEWE 280
           A+     G T   RA    +L+K+E             + L EH AY  +         +
Sbjct: 307 AI-----GCTTLQRAG---ILSKNE-------------EGLSEHFAYLAMKKFCTVMHQQ 345

Query: 281 SFELIQAWLLITVYLRTCHRQVSCWQALSRAVQMCNGM----SLFLDKFPENSTAYDECR 336
           + + I   LL+ +Y     + VS W      +++  G+    +L   K    S    E R
Sbjct: 346 NVDTITCLLLLGIYSFFEPQGVSSWTISGIIMRLTIGLGLHRALTARKIKCMSVVEVEMR 405

Query: 337 ARNCYWTTFVLDRLVSFQTGRFP-----ELAMPGPEMVSPDVAPDSWLSSESIALYKLAL 391
            R  +W+ +  +RLVS   GR       ++++P P  +  +   D  ++   I+L K+  
Sbjct: 406 YR-AFWSFYSFERLVSTSLGRISAIDDDDISVPLPRPLYAEETDDIEVTIMMISLRKMGG 464

Query: 392 LMTRCQKRYG---QDLTILE----TNDMTAQLSQWFHENAPSLDYNHLCA------RQVF 438
           ++ +     G   Q L+  E     ND+  Q+ + +      +   +L A        + 
Sbjct: 465 VIYKKVHSVGAGKQKLSPDEKQQIVNDLRNQVDELYDRERNKIREANLIAFPSQTKSCIS 524

Query: 439 LTYLDVRIALEIRGLYQLLDLDGDIPPQVPTSAIPLNATSLIDLVSQILGHFESIVEEGK 498
               D+ +A+    L  +L     + P+ P  ++ +    L +   Q L H  ++ +  K
Sbjct: 525 FHTSDIWLAMRYAQLQIMLYRPSALIPKPPMESLSI----LGNFCLQALKHTYTLYK--K 578

Query: 499 FFQPWWLNLSLLFTSSIICLTLI----QGGLQLARARVLLEKSFKIWHY 543
             QP  LN   LF +  IC T++    Q  + L  +++ +++  +I  +
Sbjct: 579 KLQP--LNWITLFRTLTICNTMLYCLCQWSIDLIESKIEIQQCVEILQH 625

>Sklu_2321.3 YLR014C, Contig c2321 8747-11467
          Length = 906

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 32/78 (41%)

Query: 280 ESFELIQAWLLITVYLRTCHRQVSCWQALSRAVQMCNGMSLFLDKFPENSTAYDECRARN 339
           +  E +   LLI +Y          W  +  A+++   + L  +K  +N   +     R 
Sbjct: 405 DRLEALAGVLLIAIYSIMRPNVPGVWYIMGSALRLAVDLGLHAEKLNKNYDPFTRELRRR 464

Query: 340 CYWTTFVLDRLVSFQTGR 357
            +W T+ LDR +    GR
Sbjct: 465 LFWCTYALDRQICVHFGR 482

>KLLA0F02299g 205549..208167 no similarity, hypothetical start
          Length = 872

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 53/116 (45%), Gaps = 19/116 (16%)

Query: 262 DALFEHAYTVVAHLSFEWESFELIQAWLLITVYLRTCHRQVSCWQALSRAVQMCNGMSLF 321
           DA+F + + +           E+ Q+ LL++      +   + W     AV+M   +  F
Sbjct: 262 DAIFNNCHFISK------PDIEICQSLLLLSCVKWGHNDYFAAWMLHGCAVRMIQAIQ-F 314

Query: 322 LDKFPENSTAYD----ECRARNCYWTTFVLDRLVS------FQTGRFPELAMPGPE 367
            ++F ++S   D    E R R  +W+ F LDR++S      F   RF ++ +P PE
Sbjct: 315 DERF-QHSCKQDPLLNELRNRT-FWSAFCLDRVISTGEGHCFTVNRFMDVELPLPE 368

>Kwal_23.2905
          Length = 881

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 29/150 (19%), Positives = 58/150 (38%), Gaps = 4/150 (2%)

Query: 280 ESFELIQAWLLITVYLRTCHRQVSCWQALSRAVQMCNGMSLFLDKFPENSTAYDECRARN 339
           +  E +   LLI  Y          W  +  A+++   + L  +K  +N   +     R 
Sbjct: 397 DRMEALAGTLLIAKYSIMRPNVPGVWYTMGSALRLAVDLGLHAEKLNKNYDPFTRDFRRR 456

Query: 340 CYWTTFVLDRLVSFQTGRFPELAMPGPEMVS--PDVAPDSWLSSESIALYKLALLMTRCQ 397
            +W TF LDR +    GR     +P   + +  P    D+ +++ +  +   +L+ +   
Sbjct: 457 LFWCTFSLDRQICAFFGR--PFGIPDENISTEFPSSLDDALITTSADNIEDYSLVKSSMA 514

Query: 398 KRYGQDLTILETNDMTAQLSQWFHENAPSL 427
                 L   +   + AQ+ Q  + +  SL
Sbjct: 515 SYKCISLAFFKIRKIQAQIVQELYAHRASL 544

>YIR023W (DAL81) [2687] chr9 (399774..402686) Transcriptional
           activator for allantoin, 4-aminobutyric acid (GABA), and
           urea catabolic genes; contains a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region [2913 bp, 970 aa]
          Length = 970

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 26/49 (53%)

Query: 148 THFHDTRSWRWDFTQDLQRGIVEKLATFFFQHVNRFVSIVHEQVFWQQF 196
           T  H  + +  D  ++L       L   FF+ ++ F+ I+HE+VF +++
Sbjct: 295 TTLHSKQEYEVDLVENLVHPHGHLLVEIFFKLIHPFLPILHERVFLEKY 343

>KLLA0F02387g complement(213669..215852) similar to sp|P47988
           Saccharomyces cerevisiae YOR337w TEA1 TY1 enhancer
           activator, start by similarity
          Length = 727

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 50/135 (37%), Gaps = 17/135 (12%)

Query: 256 HHPRLEDALFEHAYTVVAHLSFEWESFELI---QAWLLITVYLRTCHRQVSCWQALSRAV 312
           HH  L +  ++ A T +  + FE +S   I   QA L +  Y          W     A+
Sbjct: 324 HH--LSEKYYQIAKTRLLKIVFEEQSIAKITTVQALLCLAFYELGNGENQLAWYFSGLAI 381

Query: 313 QMCNGMSLFLD--------KFPENSTAYD---ECRARNCYWTTFVLDRLVSFQTGRFPEL 361
           ++   M   LD           EN    D   E R+R  YW  ++ D  +    GR P L
Sbjct: 382 RVGYDMGFQLDPKVWITDDSINENQDLSDSELEIRSR-IYWGCYIADHFICLILGRAPSL 440

Query: 362 AMPGPEMVSPDVAPD 376
            +    +   D  P+
Sbjct: 441 TVSNSTVPESDELPE 455

>KLLA0C17820g 1586564..1588510 similar to sp|P32641 Saccharomyces
           cerevisiae YER173w RAD24 cell cycle checkpoint protein
           singleton, start by similarity
          Length = 648

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 586 GLDHVDDSVNDNKFRQFGKVERGSDANSSAP--ELDNSPFSQAHGEDNLLAHLQWFDQW 642
            +  + D ++    R+  KV+R S +  S P   LD+   ++  GE  L + LQW+D++
Sbjct: 9   SISEISDRISRASPRKDKKVKRSSTSVPSFPYTNLDHVDLTRPSGERTLPSELQWYDKF 67

>YOR301W (RAX1) [5085] chr15 (880961..882268) Protein involved in
           determination of budding pattern [1308 bp, 435 aa]
          Length = 435

 Score = 30.0 bits (66), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 28/62 (45%), Gaps = 2/62 (3%)

Query: 563 LKMLNHMFCQRLKSCAKRLESSIGLDHVDDSVNDNKFRQFGKVERGSDANSSAPELDNSP 622
           LK L + F +    C  +  S + L ++ D ++D +F   G     S+ +     +  SP
Sbjct: 231 LKNLTYQFLE--MDCFPKFLSRVALHNIHDEISDWRFHSVGVTNEKSNRSRGQTHISRSP 288

Query: 623 FS 624
           FS
Sbjct: 289 FS 290

>CAGL0I07755g complement(745315..748476) similar to tr|Q12180
           Saccharomyces cerevisiae YOL089c HAL9, hypothetical
           start
          Length = 1053

 Score = 30.4 bits (67), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 35/77 (45%)

Query: 294 YLRTCHRQVSCWQALSRAVQMCNGMSLFLDKFPENSTAYDECRARNCYWTTFVLDRLVSF 353
           YL+  +        LS AV+    MS+      +N +  ++ R R+ +W  F  D+L SF
Sbjct: 503 YLQANYNTELANTILSTAVRFTIDMSMNKKITYKNLSLAEQIRKRSMWWHFFATDKLFSF 562

Query: 354 QTGRFPELAMPGPEMVS 370
              R P L     +M++
Sbjct: 563 TLSRPPMLLEEDMDMLT 579

>YLR014C (PPR1) [3432] chr12 complement(172267..174981)
           Transcription factor regulating pyrimidine pathway,
           contains a Zn[2]-Cys[6] fungal-type binuclear cluster
           domain in the N-terminal region [2715 bp, 904 aa]
          Length = 904

 Score = 30.0 bits (66), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 23/116 (19%), Positives = 46/116 (39%), Gaps = 4/116 (3%)

Query: 267 HAYTVVAHLSFEWESFELIQAWLLITVYLRTCHRQVSCWQALSRAVQMCNGMSLFLDKFP 326
            A   +A L    +  E +   LL+ +Y          W  +   +++   + L  +K  
Sbjct: 423 RATKYIASLFSSSDRLEALAGTLLMVIYSIMRPNVPGVWYTMGSVLRLTVDLGLHSEKIN 482

Query: 327 ENSTAYDECRARNCYWTTFVLDRLVSFQTGRFPELAMPGPEMVS--PDVAPDSWLS 380
           +N  A+     R  +W  + LDR +    GR     +P   + +  P +  DS+++
Sbjct: 483 KNYDAFTREIRRRLFWCVYSLDRQICSYFGR--PFGIPEESITTRYPSLLDDSFIT 536

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.136    0.437 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,282,642
Number of extensions: 884226
Number of successful extensions: 1957
Number of sequences better than 10.0: 27
Number of HSP's gapped: 1981
Number of HSP's successfully gapped: 27
Length of query: 643
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 535
Effective length of database: 12,857,365
Effective search space: 6878690275
Effective search space used: 6878690275
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 65 (29.6 bits)