Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.819032432014510.0
ABR054C3143333725e-42
KLLA0F04862g3162803412e-37
CAGL0L01793g3592942733e-27
YKL042W (SPC42)3633761942e-16
Scas_711.453352751675e-13
Scas_625.7d302961561e-11
Sklu_1963.165588700.90
KLLA0F08899g70352662.7
KLLA0F18700g77081663.0
YDR356W (SPC110)944109629.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.8190
         (320 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.8190                                                          563   0.0  
ABR054C [645] [Homologous to ScYKL042W (SPC42) - SH] (494105..49...   147   5e-42
KLLA0F04862g 476880..477830 some similarities with sp|P36094 Sac...   135   2e-37
CAGL0L01793g 206723..207802 weakly similar to sp|P36094 Saccharo...   109   3e-27
YKL042W (SPC42) [3216] chr11 (358120..359211) Component of the s...    79   2e-16
Scas_711.45                                                            69   5e-13
Scas_625.7d                                                            65   1e-11
Sklu_1963.1 YPL104W, Contig c1963 1525-3492 reverse complement         32   0.90 
KLLA0F08899g 826574..828685 weakly similar to sgd|S0004047 Sacch...    30   2.7  
KLLA0F18700g 1718738..1721050 similar to sp|P38237 Saccharomyces...    30   3.0  
YDR356W (SPC110) [1182] chr4 (1186096..1188930) Spindle pole bod...    28   9.3  

>Kwal_26.8190
          Length = 324

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/320 (87%), Positives = 281/320 (87%)

Query: 1   MNISPTPRRYNSRGYDYPRETDEAFHPFNQEPPMIPSDRIVPEEYRVNSQMINKLIKQNK 60
           MNISPTPRRYNSRGYDYPRETDEAFHPFNQEPPMIPSDRIVPEEYRVNSQMINKLIKQNK
Sbjct: 1   MNISPTPRRYNSRGYDYPRETDEAFHPFNQEPPMIPSDRIVPEEYRVNSQMINKLIKQNK 60

Query: 61  ELTLQLDRKQDEIDRLNVLVGSLRGKLIKYTELNKKLGQTSTHPPRFSPDEDVLQVNKNR 120
           ELTLQLDRKQDEIDRLNVLVGSLRGKLIKYTELNKKLGQTSTHPPRFSPDEDVLQVNKNR
Sbjct: 61  ELTLQLDRKQDEIDRLNVLVGSLRGKLIKYTELNKKLGQTSTHPPRFSPDEDVLQVNKNR 120

Query: 121 QPRESREPDTRDSQLENRIGDIYSKLEALTNLMAGTTLQSPPAVSQDQRDHVLRVPTSAS 180
           QPRESREPDTRDSQLENRIGDIYSKLEALTNLMAGTTLQSPPAVSQDQRDHVLRVPTSAS
Sbjct: 121 QPRESREPDTRDSQLENRIGDIYSKLEALTNLMAGTTLQSPPAVSQDQRDHVLRVPTSAS 180

Query: 181 VSHRPLHGGASEDDILTQESAELKSLEDQIDXXXXXXXXXXXXXXXXXSLNKELLDLMDK 240
           VSHRPLHGGASEDDILTQESAELKSLEDQID                 SLNKELLDLMDK
Sbjct: 181 VSHRPLHGGASEDDILTQESAELKSLEDQIDLLKRKLLIKRENELRKLSLNKELLDLMDK 240

Query: 241 LDVXXXXXXXXXXXXXXXXXXXXXXHCDHCHKSASQSALNGHHNTGAPGAPNSTRNPPYM 300
           LDV                      HCDHCHKSASQSALNGHHNTGAPGAPNSTRNPPYM
Sbjct: 241 LDVSKPSPEPASTSPPAPVSANTTPHCDHCHKSASQSALNGHHNTGAPGAPNSTRNPPYM 300

Query: 301 SMAQALETPTPAQRSAPKPN 320
           SMAQALETPTPAQRSAPKPN
Sbjct: 301 SMAQALETPTPAQRSAPKPN 320

>ABR054C [645] [Homologous to ScYKL042W (SPC42) - SH]
           (494105..495049) [945 bp, 314 aa]
          Length = 314

 Score =  147 bits (372), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 119/333 (35%), Positives = 162/333 (48%), Gaps = 59/333 (17%)

Query: 1   MNISPTPRRYNSRGYDYPRETDEAFH----PFNQEPPMIPSDRIVPEEYRVNSQMINKLI 56
           MNISPTP+RY S  +  PR  +  +H     +++      +DRIVP+EY++NS MI+ LI
Sbjct: 1   MNISPTPKRYQSSNH-MPRAVNHNYHSAVPAYHEHAAGQNADRIVPDEYKINSNMISSLI 59

Query: 57  KQNKELTLQLDRKQDEIDRLNVLVGSLRGKLIKYTELNKKLGQTSTHPPRF--------S 108
           KQNK+L  +LD K  E+++LNVLVGSLRGKLIKYTELNKKL Q      R          
Sbjct: 60  KQNKDLLAKLDEKDRELEKLNVLVGSLRGKLIKYTELNKKL-QAQAQAARVPSPPEPAAE 118

Query: 109 PDEDVLQVNKNRQPRESREPDTRDSQLENRIGDIYSKLEALTNLMAGTTLQSPPAVSQDQ 168
           P  D LQ+     PR  R P   +   + +IG++Y KLE LT ++    L  PPA ++ +
Sbjct: 119 PAADYLQL-----PR--RAPAAEN---DKKIGELYDKLEQLTKVVHQQHLHDPPAPARPR 168

Query: 169 RDHVLRVPTSASVSHRPLHGGASEDDILTQESAELKSLEDQIDXXXXXXXXXXXXXXXXX 228
                R P   +V         S+DDI+  ES+ELK LE+Q+D                 
Sbjct: 169 SPARSRSPARTAV---------SDDDIMISESSELKRLEEQVDQLKRKVLIKSENELRKL 219

Query: 229 SLNKELLDLMDKLDVXXXXXXXXXX--------XXXXXXXXXXXXHCDHCHKSASQSALN 280
           SLN++L DLM KL V                              HC+ CH   ++ AL 
Sbjct: 220 SLNQQLADLMHKLGVSSSSPASSALLFDRQPSPTSAASSAPLAHAHCEQCHH--AEDALK 277

Query: 281 GHHNTGAPGAPNSTRNPPYMSMAQALETPTPAQ 313
                            P M +  AL+TPTP++
Sbjct: 278 K----------------PAMDIKNALQTPTPSR 294

>KLLA0F04862g 476880..477830 some similarities with sp|P36094
           Saccharomyces cerevisiae YKL042w SPC42 spindle pole body
           component singleton, hypothetical start
          Length = 316

 Score =  135 bits (341), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 101/280 (36%), Positives = 129/280 (46%), Gaps = 65/280 (23%)

Query: 37  SDRIVPEEYRVNSQMINKLIKQNKELTLQLDRKQDEIDRLNVLVGSLRGKLIKYTELNKK 96
           ++RIVPEEY+ NS MIN+LIKQNK+L  Q+  KQ+EIDRLNVL+GS R KLIKYTELNKK
Sbjct: 19  NERIVPEEYKYNSSMINELIKQNKDLHKQVTEKQEEIDRLNVLIGSFRAKLIKYTELNKK 78

Query: 97  LG-----------QTSTHPPRF---------SP-----DEDVLQVNKNRQPRESREPDTR 131
           +            Q+    PR+         SP     D + LQ+ KN            
Sbjct: 79  MQRDQQEQQHNRHQSFESKPRYKAEFTSESSSPVSNERDSEYLQIKKN------------ 126

Query: 132 DSQLENRIGDIYSKLEALTNLMAGTTLQSPPAVSQDQRDHVLRVPTSASVSHRPLHGGAS 191
           +   EN+I DIY KLE LTNL+     +      ++  +   R+               S
Sbjct: 127 NRHDENKIDDIYQKLELLTNLVNDAIHKQNNGEQREPSNFNSRI--------------VS 172

Query: 192 EDDILTQESAELKSLEDQIDXXXXXXXXXXXXXXXXXSLNKELLDLMDKLDVXXX----- 246
           +DDI+  ES E K L+DQID                 SLNKEL DLMD+L +        
Sbjct: 173 DDDIIISESQEFKQLQDQIDLLKRKLLIKKENELRKLSLNKELADLMDELSMNSSPSANQ 232

Query: 247 --------XXXXXXXXXXXXXXXXXXXHCDHCH-KSASQS 277
                                      HC+HCH KS +QS
Sbjct: 233 NIDPYSELSSRPKSGQQRRTNEDQQSLHCEHCHLKSHTQS 272

>CAGL0L01793g 206723..207802 weakly similar to sp|P36094
           Saccharomyces cerevisiae YKL042w SPC42, start by
           similarity
          Length = 359

 Score =  109 bits (273), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 94/294 (31%), Positives = 134/294 (45%), Gaps = 59/294 (20%)

Query: 1   MNISPTPRRYNSRGYDY----PRETDEAFHPFNQE------------PPM--------IP 36
           MNISPTP+RYNSRG  Y     R     F P+ +             PP+        + 
Sbjct: 1   MNISPTPKRYNSRGDRYYASQARGKVPEFEPYRKSGLNFNDGYSGINPPVYKNGLHSNLD 60

Query: 37  SDRIVPEEYRVNSQMINKLIKQNKELTLQLDRKQDEIDRLNVLVGSLRGKLIKYTELNKK 96
            D++VPEE ++   +IN LI QNKEL   +  +++EI+RLN+++G  R KL KY+ +N+K
Sbjct: 61  DDKLVPEEIKLQRTVINDLISQNKELQTTVHTQREEIERLNIIIGQFRAKLTKYSVMNRK 120

Query: 97  LGQTSTHPPR---------------------FSPDEDVLQVNK---NRQPRESREPDTRD 132
           L        R                     F   ED +Q+ K   N + ++ + P T D
Sbjct: 121 LEDELRGSERSSNALNKDRNDDRNDSILENSFENAEDYIQIPKLRYNSKGKQDKSPQTND 180

Query: 133 SQLENRIGDIYSKLEA-----LTNLMAGTTLQSPPAVSQDQRDHVLRVPTSASVSHRPLH 187
             L +R+  +   LE       T + + +   SPP  S          P  +S    P  
Sbjct: 181 --LNDRLSQLVQLLEKSQQNNSTKINSNSNDMSPPVCSSATPPERNNKPIMSS----PKI 234

Query: 188 GGASEDDILTQESAELKSLEDQIDXXXXXXXXXXXXXXXXXSLNKELLDLMDKL 241
              SE+DIL QESAELKSLE+QI+                 SL  EL++LMD+L
Sbjct: 235 RDPSEEDILCQESAELKSLENQIELVKKKLLIKRENELRKLSLENELIELMDQL 288

>YKL042W (SPC42) [3216] chr11 (358120..359211) Component of the
           spindle pole body [1092 bp, 363 aa]
          Length = 363

 Score = 79.3 bits (194), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 98/376 (26%), Positives = 155/376 (41%), Gaps = 75/376 (19%)

Query: 1   MNISPTPRRYNSRG-------YDYPRETDE---AFHPFNQEPPMIPSDRIVPEEYRVNSQ 50
           MN SPTP+RY+S+        Y+ P +          +N     I +D++VPEEY+ N++
Sbjct: 1   MNGSPTPKRYSSKSSRLYDDYYNIPYQYSNPTPMNRDYNDVGSRINADKLVPEEYKRNTE 60

Query: 51  MINKLIKQNKELTLQLDRKQDEIDRLNVLVGSLRGKLIKYTELNKKL------------- 97
            INK ++QNKEL  +L  KQ+EI  L  +  +LR KL KY ++ KKL             
Sbjct: 61  FINKAVQQNKELNFKLREKQNEIFELKKIAETLRSKLEKYVDITKKLEDQNLNLQIKISD 120

Query: 98  -------GQTSTHPPRF-------------SPDEDVLQVNKNRQPRESREPDTRD----- 132
                    ++    RF             S + D + V K+R P  +  P T +     
Sbjct: 121 LEKKLSDANSTFKEMRFPKVKDPMVDDDPVSENYDQINVPKHRAPDATGNPRTTNKVSNT 180

Query: 133 SQLENRIGDIYSKLEALTNLMA----GTTLQSPPAVSQDQRDHVL----RVPTSASVSHR 184
           S  ++R+  I   L  LTN +     G   +  P  S    + +L    R+       + 
Sbjct: 181 SDQDSRLKAIERTLSVLTNYVMRSEDGNNDRMSPLPSP--LNTILPINNRLNFQEPKRYN 238

Query: 185 P-LHGGASEDDILTQESAELKSLEDQIDXXXXXXXXXXXXXXXXXSLNKELLDLMDKLDV 243
           P +    S+DDI+  ESAELK +E++I+                 SLN +L +L   +D 
Sbjct: 239 PTVKVNPSDDDIMMYESAELKRVEEEIEELKRKILVRKKHDLRKLSLNNQLQELQSMMD- 297

Query: 244 XXXXXXXXXXXXXXXXXXXXXXHCDHCHKSASQSALNGHHNTGAPGAPNS-----TRNPP 298
                                 H    H+ +SQS+ +   ++ A    ++      R  P
Sbjct: 298 ----------GDDNIKLDNVSKHNHATHRHSSQSSRDYSPSSDACLECSNDLYEKNRVKP 347

Query: 299 YMSMAQALETPTPAQR 314
             +M++   TPTP  R
Sbjct: 348 ENNMSETFATPTPNNR 363

>Scas_711.45
          Length = 335

 Score = 68.9 bits (167), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 74/275 (26%), Positives = 119/275 (43%), Gaps = 49/275 (17%)

Query: 1   MNISPTPRRYNSRGYDYPRET-------------------------DEAFHPFNQEPPMI 35
           MN+SPTP+RY S  ++ PR                           D+   P+       
Sbjct: 1   MNVSPTPKRYISGTFN-PRRVPEPEYNNYHHNYNNHNYQRDNLPRYDDVKRPYQDHL--- 56

Query: 36  PSDRIVPEEYRVNSQMINKLIKQNKELTLQLDRKQDEIDRLNVLVGSLRGKLIKYTELNK 95
             D ++P++ + +++  ++L++ N+ L  +L+ KQ E+++L +L  SL+ KLIKYT L  
Sbjct: 57  -DDALLPDDAKRSNKTFDELVRHNRHLKERLEGKQQEVEKLTILSTSLKEKLIKYTTLTA 115

Query: 96  KLGQTSTHPPRFSPDEDVLQVNKNRQPRES------REPDTRDSQLENRIGD--IYSKLE 147
                     R    ED+ + NK  + R+       +E D+          D  +  K+E
Sbjct: 116 NSNDEIEILKRRI--EDLEKENKRLRRRDELFNEKIKEEDSDKKVFTETTEDDELLEKIE 173

Query: 148 ALTNLMAGTTLQSPPAVSQDQRDHVLRVPTSASVSHRPLHGGASEDDILTQESAELKSLE 207
            LT ++            Q+QR+     P   S   +      +E+ +LTQES ELKSLE
Sbjct: 174 KLTAMILKH--------KQEQRNSGT-TPAKTSWKEQNSKAYPTEETLLTQESLELKSLE 224

Query: 208 DQIDXXXXXXXXXXXXXXXXXSLNKELLDLMDKLD 242
           DQ++                 SLNKELL L   L+
Sbjct: 225 DQVEKIRHKLALKRENEQRKISLNKELLKLKSSLE 259

>Scas_625.7d
          Length = 302

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 54/96 (56%), Gaps = 14/96 (14%)

Query: 2  NISPTPRRYNSRGYDYPRETDEAFHPFNQEPPMIPSDRIVPEEYRVNSQMINKLIKQNKE 61
          NISPTP+RY +  Y                  +  +D ++PEE R+++  IN+LI  N++
Sbjct: 16 NISPTPQRYGTEKY--------------ARYGLRKTDELLPEESRLSNDAINELIDMNRQ 61

Query: 62 LTLQLDRKQDEIDRLNVLVGSLRGKLIKYTELNKKL 97
          L   L  ++DE+DR   L  SL+ KLIKYT LN KL
Sbjct: 62 LKKTLRDREDELDRYGRLTESLQSKLIKYTNLNNKL 97

 Score = 31.6 bits (70), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%)

Query: 195 ILTQESAELKSLEDQIDXXXXXXXXXXXXXXXXXSLNKELLDLMDKL 241
           I+T+ES E+K+LEDQ++                 SL+ ELL+L  KL
Sbjct: 218 IITRESLEIKNLEDQVEELRKKTLLKQENELRKISLSNELLELATKL 264

>Sklu_1963.1 YPL104W, Contig c1963 1525-3492 reverse complement
          Length = 655

 Score = 31.6 bits (70), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 45/88 (51%), Gaps = 16/88 (18%)

Query: 48  NSQMINKLIKQ--NKELTL--QLDRKQDEIDRLNVLVGSLR---GKLIKYTELNKKLGQT 100
           NS+ I  L+K   N  +T+   +DRK   + + N++ G+LR   G +I+  + N  L  +
Sbjct: 34  NSETIENLLKHPVNTSVTINGWIDRKPKRVGK-NLIFGTLRDSNGDVIQIVDSNSLLASS 92

Query: 101 STHPPRFSPDEDVLQVNKNRQPRESREP 128
           +         EDV+Q+     P++ R+P
Sbjct: 93  NV--------EDVIQIKGELAPKKMRDP 112

>KLLA0F08899g 826574..828685 weakly similar to sgd|S0004047
           Saccharomyces cerevisiae YLR057w, start by similarity
          Length = 703

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 4/52 (7%)

Query: 9   RYNSRGYDYPRETDEAFHPFNQEPPMIPSDRI---VPEEYRVNSQMINKLIK 57
           +Y S  YD  +E    FHPF ++  +IP  +I    P+  RV+S   N LIK
Sbjct: 101 KYRSENYD-SKEPFHPFHPFYEKKTVIPYKQISKQYPQLNRVSSIHSNALIK 151

>KLLA0F18700g 1718738..1721050 similar to sp|P38237 Saccharomyces
           cerevisiae YBR058c UBP14 ubiquitin specific protease
           singleton, start by similarity
          Length = 770

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 37/81 (45%), Gaps = 13/81 (16%)

Query: 65  QLDRKQDEIDRLNVLVGSLRGKLIKYTELNKKLGQTSTHPPRFSPDEDVLQVN------K 118
           +LD +Q+ IDRLN       G+ I+Y  L  K   T++  P FS     L +N       
Sbjct: 466 KLDGEQNLIDRLN---DYFSGEKIEYRCLTNKKINTASKVPGFSSFPRTLIINPIRIELI 522

Query: 119 NRQPRESRE----PDTRDSQL 135
           N QP ++ E    P  RD  L
Sbjct: 523 NWQPSKTSEQVVVPGVRDDAL 543

>YDR356W (SPC110) [1182] chr4 (1186096..1188930) Spindle pole body
           component with coiled-coil structure, determines the
           spacing between the ends of microtubules and the central
           plaque [2835 bp, 944 aa]
          Length = 944

 Score = 28.5 bits (62), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 53/109 (48%), Gaps = 13/109 (11%)

Query: 44  EYRVNSQMINKLIKQNKELTLQLDRKQDEIDRLNVLVGSLRGKLIKYTELNKKLGQTSTH 103
           E R  +  +N+L  ++ E+ LQL +KQ+E  RL               ELN+   + S +
Sbjct: 298 ELRKRTNELNELKIKSDEMDLQLKQKQNESKRLK-------------DELNELETKFSEN 344

Query: 104 PPRFSPDEDVLQVNKNRQPRESREPDTRDSQLENRIGDIYSKLEALTNL 152
             + S  E+ L++ KN+      E  T++SQL  + G + S +  LT L
Sbjct: 345 GSQSSAKENELKMLKNKIAELEEEISTKNSQLIAKEGKLASLMAQLTQL 393

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.129    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,804,007
Number of extensions: 397582
Number of successful extensions: 1424
Number of sequences better than 10.0: 48
Number of HSP's gapped: 1407
Number of HSP's successfully gapped: 51
Length of query: 320
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 218
Effective length of database: 13,065,073
Effective search space: 2848185914
Effective search space used: 2848185914
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 61 (28.1 bits)