Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.817659248316600.0
Scas_106.14231405908e-70
ABR055C6781235929e-68
KLLA0F04840g6361045541e-62
YMR016C (SOK2)7851055523e-61
Scas_709.527251105265e-58
Scas_625.85211035138e-58
CAGL0L01771g4351425052e-57
YKL043W (PHD1)3661264889e-56
CAGL0M07634g2571013713e-40
Scas_510.21043801167e-06
KLLA0E05357g754771167e-06
YDL056W (MBP1)833771168e-06
YER111C (SWI4)1093801104e-05
AGL297C970821086e-05
AFR600C815771087e-05
CAGL0D01012g802771042e-04
Sklu_2055.3743771023e-04
Kwal_27.10756922821015e-04
Kwal_26.9359742771005e-04
CAGL0A04565g104178950.002
KLLA0E20867g93378930.004
Sklu_1824.217982880.006
Scas_711.25151585657.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.8176
         (584 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.8176                                                          644   0.0  
Scas_106.1                                                            231   8e-70
ABR055C [646] [Homologous to ScYMR016C (SOK2) - SH; ScYKL043W (P...   232   9e-68
KLLA0F04840g 474544..476454 some similarities with sp|P53438 Sac...   218   1e-62
YMR016C (SOK2) [3980] chr13 complement(303235..305592) Transcrip...   217   3e-61
Scas_709.52                                                           207   5e-58
Scas_625.8                                                            202   8e-58
CAGL0L01771g 196974..198281 some similarities with sp|P36093 Sac...   199   2e-57
YKL043W (PHD1) [3215] chr11 (356393..357493) Transcription facto...   192   9e-56
CAGL0M07634g 763929..764702 similar to sp|P53438 Saccharomyces c...   147   3e-40
Scas_510.2                                                             49   7e-06
KLLA0E05357g 485919..488183 gi|729994|sp|P39679|MBP1_KLULA Kluyv...    49   7e-06
YDL056W (MBP1) [809] chr4 (352877..355378) Transcription factor ...    49   8e-06
YER111C (SWI4) [1542] chr5 complement(382591..385872) Transcript...    47   4e-05
AGL297C [4015] [Homologous to ScYER111C (SWI4) - SH] (147990..15...    46   6e-05
AFR600C [3792] [Homologous to ScYDL056W (MBP1) - SH] (1517341..1...    46   7e-05
CAGL0D01012g 118878..121286 similar to sp|P39678 Saccharomyces c...    45   2e-04
Sklu_2055.3 YDL056W, Contig c2055 5141-7372                            44   3e-04
Kwal_27.10756                                                          44   5e-04
Kwal_26.9359                                                           43   5e-04
CAGL0A04565g 445883..449008 similar to sp|P25302 Saccharomyces c...    41   0.002
KLLA0E20867g complement(1852522..1855323) weakly similar to sp|P...    40   0.004
Sklu_1824.2 YER111C, Contig c1824 4652-5187 reverse complement         39   0.006
Scas_711.25                                                            30   7.9  

>Kwal_26.8176
          Length = 592

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/483 (71%), Positives = 344/483 (71%)

Query: 102 SQLGYQYPGFSGGGSGRPAAVGVSAHDELAGSNASPITYYGEDLGGKARRGMTSSRAHPR 161
           SQLGYQYPGFSGGGSGRPAAVGVSAHDELAGSNASPITYYGEDLGGKARRGMTSSRAHPR
Sbjct: 102 SQLGYQYPGFSGGGSGRPAAVGVSAHDELAGSNASPITYYGEDLGGKARRGMTSSRAHPR 161

Query: 162 EFXXXXXXXXXXXXXXXXXXXXXXXXXXMDPQSLQNXXXXXXXXXXXXXXXXXXXXTTTM 221
           EF                          MDPQSLQN                    TTTM
Sbjct: 162 EFGGSGGGGGSAGSLDGTALLGLAAAGAMDPQSLQNGVGAGGRVAAAAPAGARPRVTTTM 221

Query: 222 WEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKIRHVVKIGS 281
           WEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKIRHVVKIGS
Sbjct: 222 WEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKIRHVVKIGS 281

Query: 282 MHLKGVWIPFDRALAMAQREKIVDLLFPLFVRDIQSVIQQGASTVLVGPAASGATAGGMP 341
           MHLKGVWIPFDRALAMAQREKIVDLLFPLFVRDIQSVIQQGASTVLVGPAASGATAGGMP
Sbjct: 282 MHLKGVWIPFDRALAMAQREKIVDLLFPLFVRDIQSVIQQGASTVLVGPAASGATAGGMP 341

Query: 342 SAGAARANMNQGGASLTSNXXXXXXXXXXXXXTHQPVSNYGAYQPVVDYGYATRPMMSAP 401
           SAGAARANMNQGGASLTSN             THQPVSNYGAYQPVVDYGYATRPMMSAP
Sbjct: 342 SAGAARANMNQGGASLTSNAAAAAAAYYADAATHQPVSNYGAYQPVVDYGYATRPMMSAP 401

Query: 402 GFGSALAGQLAPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXH 461
           GFGSALAGQLAP                                               H
Sbjct: 402 GFGSALAGQLAPAGSMAGSALGLGQSSHSGHLGIGSGLGSNSGGVGVGVSSIGGNGAGSH 461

Query: 462 SNLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHGSSNGSILDSRPAPDSVSSNANT 521
           SNL                                 HGSSNGSILDSRPAPDSVSSNANT
Sbjct: 462 SNLGSGVGTGNNVGRNDGNDGNRSNNNNNAVATGAGHGSSNGSILDSRPAPDSVSSNANT 521

Query: 522 TTPAGGAGSPVMGLAPGFSAQSVPGSLESLSKSGDSHTPGSSHRDSVSQHTNDTVKNEGL 581
           TTPAGGAGSPVMGLAPGFSAQSVPGSLESLSKSGDSHTPGSSHRDSVSQHTNDTVKNEGL
Sbjct: 522 TTPAGGAGSPVMGLAPGFSAQSVPGSLESLSKSGDSHTPGSSHRDSVSQHTNDTVKNEGL 581

Query: 582 TSN 584
           TSN
Sbjct: 582 TSN 584

>Scas_106.1
          Length = 423

 Score =  231 bits (590), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 110/140 (78%), Positives = 116/140 (82%)

Query: 218 TTTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKIRHVV 277
           TTTMWEDE TLCYQVEA GVSVVRRADNDMINGTKLLNV KMTRGRRDGILKAEKIRHVV
Sbjct: 157 TTTMWEDEKTLCYQVEACGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKAEKIRHVV 216

Query: 278 KIGSMHLKGVWIPFDRALAMAQREKIVDLLFPLFVRDIQSVIQQGASTVLVGPAASGATA 337
           KIGSMHLKGVWIPFDRALAMAQREKIVDLLFPLFVRDIQSVIQQGA +     + +  TA
Sbjct: 217 KIGSMHLKGVWIPFDRALAMAQREKIVDLLFPLFVRDIQSVIQQGAPSAPYPSSTADVTA 276

Query: 338 GGMPSAGAARANMNQGGASL 357
               +   + AN N   +SL
Sbjct: 277 SVATNNSNSTANKNAISSSL 296

>ABR055C [646] [Homologous to ScYMR016C (SOK2) - SH; ScYKL043W
           (PHD1) - SH] (495331..497367) [2037 bp, 678 aa]
          Length = 678

 Score =  232 bits (592), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 107/123 (86%), Positives = 115/123 (93%), Gaps = 2/123 (1%)

Query: 218 TTTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKIRHVV 277
           TTTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEK+RHVV
Sbjct: 332 TTTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKVRHVV 391

Query: 278 KIGSMHLKGVWIPFDRALAMAQREKIVDLLFPLFVRDIQSVIQQGASTVLVGPAASGATA 337
           KIGSMHLKGVWIPF+RALA+AQREKIVD+LFPLFVRDIQSVIQQ ++T   GPA +GA  
Sbjct: 392 KIGSMHLKGVWIPFERALALAQREKIVDMLFPLFVRDIQSVIQQTSTT--SGPAENGAKL 449

Query: 338 GGM 340
           G +
Sbjct: 450 GKL 452

>KLLA0F04840g 474544..476454 some similarities with sp|P53438
           Saccharomyces cerevisiae YMR016c SOK2 regulatory protein
           in the PKA signal transduction pathway, hypothetical
           start
          Length = 636

 Score =  218 bits (554), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 101/104 (97%)

Query: 218 TTTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKIRHVV 277
           TTTMWEDE+TLCYQVEANGVSVVRRADNDMINGTKLLNV +MTRGRRDGILKAEKIRHVV
Sbjct: 366 TTTMWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTRMTRGRRDGILKAEKIRHVV 425

Query: 278 KIGSMHLKGVWIPFDRALAMAQREKIVDLLFPLFVRDIQSVIQQ 321
           KIGSMHLKGVWIPF+RAL MAQREKIVDLL+ LFVRDIQS+IQQ
Sbjct: 426 KIGSMHLKGVWIPFERALVMAQREKIVDLLYALFVRDIQSIIQQ 469

>YMR016C (SOK2) [3980] chr13 complement(303235..305592)
           Transcription factor with dual roles as both activator
           and repressor, negatively regulates meiosis, involved in
           regulation of cAMP-dependent kinase-stimulated growth,
           pseudohyphal differentiation, and sporulation [2358 bp,
           785 aa]
          Length = 785

 Score =  217 bits (552), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 92/105 (87%), Positives = 100/105 (95%)

Query: 218 TTTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKIRHVV 277
           TTTMWEDE TLCYQVEANG+SVVRRADNDM+NGTKLLNV KMTRGRRDGILKAEKIRHVV
Sbjct: 416 TTTMWEDEKTLCYQVEANGISVVRRADNDMVNGTKLLNVTKMTRGRRDGILKAEKIRHVV 475

Query: 278 KIGSMHLKGVWIPFDRALAMAQREKIVDLLFPLFVRDIQSVIQQG 322
           KIGSMHLKGVWIPF+RALA+AQREKI D L+PLF+RDIQSV++Q 
Sbjct: 476 KIGSMHLKGVWIPFERALAIAQREKIADYLYPLFIRDIQSVLKQN 520

>Scas_709.52
          Length = 725

 Score =  207 bits (526), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 90/110 (81%), Positives = 99/110 (90%)

Query: 218 TTTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKIRHVV 277
           TTTMWEDE T+CYQVEANGVSVVRRADNDMINGTKLLNV KMTRGRRDGILK+EKIRHVV
Sbjct: 387 TTTMWEDERTICYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKSEKIRHVV 446

Query: 278 KIGSMHLKGVWIPFDRALAMAQREKIVDLLFPLFVRDIQSVIQQGASTVL 327
           KIGSMHLKGVW+PF+RA  MA RE I+DLL+PLFVRDI+SV++Q    V 
Sbjct: 447 KIGSMHLKGVWVPFERARLMAGREHILDLLYPLFVRDIESVLKQTRPVVF 496

>Scas_625.8
          Length = 521

 Score =  202 bits (513), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 96/103 (93%)

Query: 219 TTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKIRHVVK 278
           TTMWEDE TLCYQVE NGV+VVRRADNDMINGTKLLNV KMTRGRRDGIL+AEK+R V+K
Sbjct: 212 TTMWEDERTLCYQVECNGVAVVRRADNDMINGTKLLNVTKMTRGRRDGILRAEKVRSVIK 271

Query: 279 IGSMHLKGVWIPFDRALAMAQREKIVDLLFPLFVRDIQSVIQQ 321
           IGSMHLKGVWIPFDRAL MA+REKIVDLL+PLFV+DI S++ Q
Sbjct: 272 IGSMHLKGVWIPFDRALMMAKREKIVDLLYPLFVKDINSILSQ 314

>CAGL0L01771g 196974..198281 some similarities with sp|P36093
           Saccharomyces cerevisiae YKL043w PHD1 or sp|P53438
           Saccharomyces cerevisiae YMR016c SOK2, hypothetical
           start
          Length = 435

 Score =  199 bits (505), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 110/142 (77%), Gaps = 5/142 (3%)

Query: 219 TTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKIRHVVK 278
           TT+WEDE+TLCYQVEANGVSVVRRADNDMINGTKLLNV KMTRG+RDGIL++EK R VVK
Sbjct: 205 TTIWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGKRDGILRSEKYRKVVK 264

Query: 279 IGSMHLKGVWIPFDRALAMAQREKIVDLLFPLFVRDIQSVIQQGAS-TVLVGPAASGATA 337
           IGSMHLKGVWIPF+RAL +A+REKIVDLL+PLFVRDI SV++     + LV P     T 
Sbjct: 265 IGSMHLKGVWIPFERALFIAKREKIVDLLYPLFVRDITSVLKTSLKPSSLVIPMQDNTTV 324

Query: 338 GG----MPSAGAARANMNQGGA 355
                 +P++    +N  Q  +
Sbjct: 325 TSKIYQLPASNHVISNATQSSS 346

>YKL043W (PHD1) [3215] chr11 (356393..357493) Transcription factor
           involved in regulation of filamentous growth [1101 bp,
           366 aa]
          Length = 366

 Score =  192 bits (488), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 107/126 (84%), Gaps = 2/126 (1%)

Query: 219 TTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKIRHVVK 278
           TTMWEDE+T+CYQVEANG+SVVRRADN+MINGTKLLNV KMTRGRRDGIL++EK+R VVK
Sbjct: 189 TTMWEDENTICYQVEANGISVVRRADNNMINGTKLLNVTKMTRGRRDGILRSEKVREVVK 248

Query: 279 IGSMHLKGVWIPFDRALAMAQREKIVDLLFPLFVRDIQSVI--QQGASTVLVGPAASGAT 336
           IGSMHLKGVWIPF+RA  +AQRE+I+D L+PLFV+DI+S++  ++ ++   + P +S A 
Sbjct: 249 IGSMHLKGVWIPFERAYILAQREQILDHLYPLFVKDIESIVDARKPSNKASLTPKSSPAP 308

Query: 337 AGGMPS 342
               PS
Sbjct: 309 IKQEPS 314

>CAGL0M07634g 763929..764702 similar to sp|P53438 Saccharomyces
           cerevisiae YMR016c SOK2 or sp|P36093 Saccharomyces
           cerevisiae YKL043w PHD1, hypothetical start
          Length = 257

 Score =  147 bits (371), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 79/101 (78%)

Query: 219 TTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKIRHVVK 278
           TT WEDEHT+C+ V  NGV+VVRRADNDM+NGTKLLNV  MTRGRRDGILK E +R VVK
Sbjct: 124 TTYWEDEHTICHGVNHNGVTVVRRADNDMVNGTKLLNVTGMTRGRRDGILKNEPVRDVVK 183

Query: 279 IGSMHLKGVWIPFDRALAMAQREKIVDLLFPLFVRDIQSVI 319
            G M LKGVWIP DRA A+A++E I   L+PLF+ D+   I
Sbjct: 184 GGPMTLKGVWIPIDRARAIARQEGIEQWLYPLFIDDLHQAI 224

>Scas_510.2
          Length = 1043

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 3/80 (3%)

Query: 229 CYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEK---IRHVVKIGSMHLK 285
           CY        V+RR  +D IN T++  +A  ++  R  +L+ E    +   V+ G    +
Sbjct: 64  CYIKGFESRIVMRRTKDDWINVTQVFKIADFSKAHRTKVLEKESSDMMHEKVQGGYGRFQ 123

Query: 286 GVWIPFDRALAMAQREKIVD 305
           G WIP + AL + Q+ KI D
Sbjct: 124 GTWIPLESALMLVQKYKIND 143

>KLLA0E05357g 485919..488183 gi|729994|sp|P39679|MBP1_KLULA
           Kluyveromyces lactis Transcription factor MBP1 (MBF
           subunit P120), start by similarity
          Length = 754

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 44/77 (57%), Gaps = 3/77 (3%)

Query: 238 SVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKI---RHVVKIGSMHLKGVWIPFDRA 294
           S+++R  ++ +N T +L  AK  + +R  IL+ E I      V+ G    +G WIP + A
Sbjct: 25  SIMKRKADNWVNATHILKAAKFPKAKRTRILEKEVITDTHEKVQGGFGKYQGTWIPLELA 84

Query: 295 LAMAQREKIVDLLFPLF 311
             +A++ +++D L PLF
Sbjct: 85  SKLAEKFEVLDELKPLF 101

>YDL056W (MBP1) [809] chr4 (352877..355378) Transcription factor
           that collaborates with Swi6p to form the MBF
           (Mbp1p-Swi6p) factor for regulation at Mlu1 cell cycle
           box (MCB) elements, has two ankyrin repeats [2502 bp,
           833 aa]
          Length = 833

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 42/77 (54%), Gaps = 3/77 (3%)

Query: 238 SVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKIRHV---VKIGSMHLKGVWIPFDRA 294
           S+++R  +D +N T +L  A   + +R  IL+ E ++     V+ G    +G W+P + A
Sbjct: 24  SIMKRKKDDWVNATHILKAANFAKAKRTRILEKEVLKETHEKVQGGFGKYQGTWVPLNIA 83

Query: 295 LAMAQREKIVDLLFPLF 311
             +A++  + D L PLF
Sbjct: 84  KQLAEKFSVYDQLKPLF 100

>YER111C (SWI4) [1542] chr5 complement(382591..385872) Transcription
           factor that is a component of the SBF (Swi4p-Swi6p)
           complex that regulates expression at promoters
           containing the cell cycle box (CCB) element, contains
           two ankyrin repeats [3282 bp, 1093 aa]
          Length = 1093

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 43/80 (53%), Gaps = 3/80 (3%)

Query: 229 CYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAE--KIRH-VVKIGSMHLK 285
           CY        V+RR  +D IN T++  +A+ ++ +R  IL+ E   ++H  V+ G    +
Sbjct: 50  CYIRGFETKIVMRRTKDDWINITQVFKIAQFSKTKRTKILEKESNDMQHEKVQGGYGRFQ 109

Query: 286 GVWIPFDRALAMAQREKIVD 305
           G WIP D A  +  + +I+D
Sbjct: 110 GTWIPLDSAKFLVNKYEIID 129

>AGL297C [4015] [Homologous to ScYER111C (SWI4) - SH]
           (147990..150902) [2913 bp, 970 aa]
          Length = 970

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 3/82 (3%)

Query: 229 CYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEK--IRH-VVKIGSMHLK 285
           CY        V+RR  +D +N T++  VA  ++ +R  IL+ E   I H  ++ G    +
Sbjct: 33  CYCRGKESSIVMRRLHDDWVNITQVFKVATFSKTQRTKILEKESADISHEKIQGGYGRFQ 92

Query: 286 GVWIPFDRALAMAQREKIVDLL 307
           G WIP D A  +  + +I D++
Sbjct: 93  GTWIPLDSAKGLVAKYEITDIV 114

>AFR600C [3792] [Homologous to ScYDL056W (MBP1) - SH]
           (1517341..1519788) [2448 bp, 815 aa]
          Length = 815

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 45/77 (58%), Gaps = 3/77 (3%)

Query: 238 SVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKIRHV---VKIGSMHLKGVWIPFDRA 294
           S+++R  +D +N T +L  AK  + +R  IL+ E I+     V+ G    +G W+P D A
Sbjct: 31  SIMKRKADDWVNATHILKAAKFAKAKRTRILEKEVIKDTHEKVQGGFGKYQGTWVPLDIA 90

Query: 295 LAMAQREKIVDLLFPLF 311
             +AQ+ ++++ L PLF
Sbjct: 91  RRLAQKFEVLEELRPLF 107

>CAGL0D01012g 118878..121286 similar to sp|P39678 Saccharomyces
           cerevisiae YDL056w MBP1 transcription factor, start by
           similarity
          Length = 802

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 43/77 (55%), Gaps = 3/77 (3%)

Query: 238 SVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKIRHV---VKIGSMHLKGVWIPFDRA 294
           S+++R ++  +N T +L  A   + +R  IL+ E ++ +   V+ G    +G W+P + A
Sbjct: 24  SIMKRKNDGWVNATHILKAANFAKAKRTRILEKEVLKEMHEKVQGGFGKYQGTWVPLNIA 83

Query: 295 LAMAQREKIVDLLFPLF 311
           + +A++  +   L PLF
Sbjct: 84  INLAEKFDVYQDLKPLF 100

 Score = 29.6 bits (65), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 25/56 (44%)

Query: 526 GGAGSPVMGLAPGFSAQSVPGSLESLSKSGDSHTPGSSHRDSVSQHTNDTVKNEGL 581
           GG  SP++ L P +S QS P   +   K  D  T    +  S    +N TV  E L
Sbjct: 311 GGGTSPIISLIPRYSVQSRPQVTDINEKVNDYLTKLVDYFISNEMKSNKTVPQELL 366

>Sklu_2055.3 YDL056W, Contig c2055 5141-7372
          Length = 743

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 44/77 (57%), Gaps = 3/77 (3%)

Query: 238 SVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKIRHV---VKIGSMHLKGVWIPFDRA 294
           S+++R  +D +N T +L  AK  + +R  IL+ E I+ +   V+ G    +G W+P D A
Sbjct: 27  SIMKRKADDWVNATHILKAAKFAKAKRTRILEKEVIKDIHEKVQGGFGKYQGTWVPLDIA 86

Query: 295 LAMAQREKIVDLLFPLF 311
             +A +  +++ L PLF
Sbjct: 87  RKLASKFDVMEELKPLF 103

>Kwal_27.10756
          Length = 922

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 43/82 (52%), Gaps = 3/82 (3%)

Query: 229 CYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEK--IRH-VVKIGSMHLK 285
           CY        V+RR  +D +N T++  +A  ++ +R  IL+ E   ++H  ++ G    +
Sbjct: 46  CYCRGQESRIVMRRCMDDWVNITQVFKIASFSKTQRTKILEKESNMVKHEKIQGGYGRFQ 105

Query: 286 GVWIPFDRALAMAQREKIVDLL 307
           G WIP + A  + Q+  + D++
Sbjct: 106 GTWIPLENAHYLVQKYSVSDVV 127

>Kwal_26.9359
          Length = 742

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 44/77 (57%), Gaps = 3/77 (3%)

Query: 238 SVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKIRHV---VKIGSMHLKGVWIPFDRA 294
           S+++R ++D +N T +L  AK  + +R  IL+ E I+     V+ G    +G W+P D A
Sbjct: 25  SIMKRKEDDWVNATHILKAAKFAKAKRTRILEKEVIKDTHEKVQGGFGKYQGTWVPLDIA 84

Query: 295 LAMAQREKIVDLLFPLF 311
             +A + +++  L PLF
Sbjct: 85  RNLAAKFEVLSELKPLF 101

>CAGL0A04565g 445883..449008 similar to sp|P25302 Saccharomyces
           cerevisiae YER111c SWI4, start by similarity
          Length = 1041

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 229 CYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAE--KIRH-VVKIGSMHLK 285
           CY        V+RR  +D +N T++  +A+ ++ +R  IL+ E   ++H  V+ G    +
Sbjct: 52  CYIRGQESNIVMRRTMDDWVNVTQVFKIAQFSKTQRTKILEKESTNMKHEKVQGGYGRFQ 111

Query: 286 GVWIPFDRALAMAQREKI 303
           G W+P + A  M  +  I
Sbjct: 112 GTWVPLEAAKFMTTKYNI 129

>KLLA0E20867g complement(1852522..1855323) weakly similar to
           sp|P25302 Saccharomyces cerevisiae YER111c SWI4
           transcription factor, start by similarity
          Length = 933

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 41/78 (52%), Gaps = 3/78 (3%)

Query: 229 CYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAE--KIRH-VVKIGSMHLK 285
           CY  +     ++RR +++ +N T++      T+ +R  IL+ E  +I+H  ++ G    +
Sbjct: 109 CYTKDKPPCLIMRRCNDNWLNITQVFKAGSFTKAQRTKILEKEANEIKHEKIQGGYGRFQ 168

Query: 286 GVWIPFDRALAMAQREKI 303
           G WIP++    + ++  I
Sbjct: 169 GTWIPWESTKYLVEKYNI 186

>Sklu_1824.2 YER111C, Contig c1824 4652-5187 reverse complement
          Length = 179

 Score = 38.5 bits (88), Expect = 0.006,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 43/82 (52%), Gaps = 3/82 (3%)

Query: 229 CYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEK--IRH-VVKIGSMHLK 285
           CY        V+RR  ++ +N T++  +A  ++ +R  IL+ E   ++H  ++ G    +
Sbjct: 28  CYCRGKESKIVMRRCQDNWVNITQVFKIASFSKTQRTKILEKESNDMKHEKIQGGYGRFQ 87

Query: 286 GVWIPFDRALAMAQREKIVDLL 307
           G WIP + A  +  + K+ D++
Sbjct: 88  GTWIPLENARYLVSKYKVDDII 109

>Scas_711.25
          Length = 1515

 Score = 29.6 bits (65), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 43/85 (50%), Gaps = 12/85 (14%)

Query: 509  RPAPDSVSSNANTTTPAGGAGSPVMGLAPGFSAQSVPGSLE-SLSKSGDSHTPGSS---- 563
            RP+P+ V  N     P+     PV+    G ++ + P S++ ++ ++ +S TP SS    
Sbjct: 1067 RPSPEVVYQNLEKFFPSADLDKPVVE---GMASPTSPRSIDHNIFQTTNSDTPRSSAPTS 1123

Query: 564  ----HRDSVSQHTNDTVKNEGLTSN 584
                 + ++S+   DT+KN  L +N
Sbjct: 1124 PIAHSKPTLSESPTDTLKNPSLRNN 1148

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.128    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,949,660
Number of extensions: 369036
Number of successful extensions: 1418
Number of sequences better than 10.0: 44
Number of HSP's gapped: 1430
Number of HSP's successfully gapped: 46
Length of query: 584
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 477
Effective length of database: 12,891,983
Effective search space: 6149475891
Effective search space used: 6149475891
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 64 (29.3 bits)