Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.817233633117940.0
Sklu_2168.454033115930.0
KLLA0D11242g53433115380.0
YMR015C (ERG5)53833115300.0
CAGL0M07656g53533115260.0
Scas_709.5352333115160.0
ABR053C51533214010.0
KLLA0E03553g5272002282e-20
YHR007C (ERG11)5302001943e-16
Sklu_2436.115321991935e-16
CAGL0E04334g5332251936e-16
ADR162W5291991901e-15
Kwal_47.183235362041873e-15
Scas_699.205382041696e-13
KLLA0C06743g5132321092e-05
CAGL0F02607g498214984e-04
Sklu_1634.3524155930.002
Kwal_47.18804508209860.011
KLLA0C19206g511221860.012
KLLA0D11638g39173720.47
Sklu_1987.252367710.67
AFR020W65667700.88
Scas_515.288740663.0
AFR661W117923638.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.8172
         (331 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.8172                                                          695   0.0  
Sklu_2168.4 YMR015C, Contig c2168 6356-7978 reverse complement        618   0.0  
KLLA0D11242g complement(959973..961577) highly similar to sp|P54...   597   0.0  
YMR015C (ERG5) [3979] chr13 complement(300868..302484) Cytochrom...   593   0.0  
CAGL0M07656g 765772..767379 highly similar to sp|P54781 Saccharo...   592   0.0  
Scas_709.53                                                           588   0.0  
ABR053C [644] [Homologous to ScYMR015C (ERG5) - SH] (492258..493...   544   0.0  
KLLA0E03553g 329904..331487 highly similar to sp|P10614 Saccharo...    92   2e-20
YHR007C (ERG11) [2293] chr8 complement(120085..121677) Cytochrom...    79   3e-16
Sklu_2436.11 YHR007C, Contig c2436 26015-27613 reverse complement      79   5e-16
CAGL0E04334g complement(415351..416952) highly similar to sp|P10...    79   6e-16
ADR162W [1904] [Homologous to ScYHR007C (ERG11) - SH] complement...    78   1e-15
Kwal_47.18323                                                          77   3e-15
Scas_699.20                                                            70   6e-13
KLLA0C06743g complement(590585..592126) similar to sp|P21595 Sac...    47   2e-05
CAGL0F02607g complement(253736..255232) similar to sp|P21595 Sac...    42   4e-04
Sklu_1634.3 YDR402C, Contig c1634 2102-3676 reverse complement         40   0.002
Kwal_47.18804                                                          38   0.011
KLLA0C19206g 1711813..1713348 weakly similar to sp|O48923 Glycin...    38   0.012
KLLA0D11638g 995087..996262 similar to ca|CA4405|IPF8773 Candida...    32   0.47 
Sklu_1987.2 YBL015W, Contig c1987 2738-4309                            32   0.67 
AFR020W [3212] [Homologous to ScYBL015W (ACH1) - SH] complement(...    32   0.88 
Scas_515.2                                                             30   3.0  
AFR661W [3854] [Homologous to ScYGL140C - NSH] complement(164245...    29   8.0  

>Kwal_26.8172
          Length = 336

 Score =  695 bits (1794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/331 (100%), Positives = 331/331 (100%)

Query: 1   MEKFVTYSAEKNFEPQVYFHELREIMCALSLKAFCGDYITESQIRKVADDYYLVTAALEL 60
           MEKFVTYSAEKNFEPQVYFHELREIMCALSLKAFCGDYITESQIRKVADDYYLVTAALEL
Sbjct: 1   MEKFVTYSAEKNFEPQVYFHELREIMCALSLKAFCGDYITESQIRKVADDYYLVTAALEL 60

Query: 61  VNFPIILPFTKTWYGQRTADMTMKIFEKCAQMAKDHIAAGGKPKCVMDAWCELMHNAKNK 120
           VNFPIILPFTKTWYGQRTADMTMKIFEKCAQMAKDHIAAGGKPKCVMDAWCELMHNAKNK
Sbjct: 61  VNFPIILPFTKTWYGQRTADMTMKIFEKCAQMAKDHIAAGGKPKCVMDAWCELMHNAKNK 120

Query: 121 NDEDSRLFHREFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVMQKIREEQLRV 180
           NDEDSRLFHREFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVMQKIREEQLRV
Sbjct: 121 NDEDSRLFHREFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVMQKIREEQLRV 180

Query: 181 RNNDPSKPLSLDLIDEMKYTYMVVKETLRYRPPVIMVPYVVKNKFPIAPNYTAPKGAMLI 240
           RNNDPSKPLSLDLIDEMKYTYMVVKETLRYRPPVIMVPYVVKNKFPIAPNYTAPKGAMLI
Sbjct: 181 RNNDPSKPLSLDLIDEMKYTYMVVKETLRYRPPVIMVPYVVKNKFPIAPNYTAPKGAMLI 240

Query: 241 PTLYPALHDPEVYDDPEEFIPERWVEGSPANEAKKNWLVFGSGSHVCLGQTYVMMTFTAL 300
           PTLYPALHDPEVYDDPEEFIPERWVEGSPANEAKKNWLVFGSGSHVCLGQTYVMMTFTAL
Sbjct: 241 PTLYPALHDPEVYDDPEEFIPERWVEGSPANEAKKNWLVFGSGSHVCLGQTYVMMTFTAL 300

Query: 301 IGKFAMYTNWEHKVTPLSEKIKVFATIFPKD 331
           IGKFAMYTNWEHKVTPLSEKIKVFATIFPKD
Sbjct: 301 IGKFAMYTNWEHKVTPLSEKIKVFATIFPKD 331

>Sklu_2168.4 YMR015C, Contig c2168 6356-7978 reverse complement
          Length = 540

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/331 (86%), Positives = 315/331 (95%)

Query: 1   MEKFVTYSAEKNFEPQVYFHELREIMCALSLKAFCGDYITESQIRKVADDYYLVTAALEL 60
           +EKFV  S E  +EPQV+FHE+REIMCALSLKAFCGDYITE QIRKVADDYYLVTAALEL
Sbjct: 192 LEKFVELSKENKYEPQVFFHEMREIMCALSLKAFCGDYITEDQIRKVADDYYLVTAALEL 251

Query: 61  VNFPIILPFTKTWYGQRTADMTMKIFEKCAQMAKDHIAAGGKPKCVMDAWCELMHNAKNK 120
           VNFPIILPFTKTWYG++TADMTMKIFE+CAQMAKDHIA+GG   CVMDAWC+LMH+AKN+
Sbjct: 252 VNFPIILPFTKTWYGKKTADMTMKIFEQCAQMAKDHIASGGPTTCVMDAWCKLMHDAKNQ 311

Query: 121 NDEDSRLFHREFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVMQKIREEQLRV 180
           ND DSRL HREF+N+EISEA+FTFLFASQDASSSLACWLFQIVADRPDV++KIREEQL+V
Sbjct: 312 NDADSRLLHREFSNKEISEAIFTFLFASQDASSSLACWLFQIVADRPDVLEKIREEQLKV 371

Query: 181 RNNDPSKPLSLDLIDEMKYTYMVVKETLRYRPPVIMVPYVVKNKFPIAPNYTAPKGAMLI 240
           R NDP+K LSLDLI+EMKYT MVVKE+LRYRPPV+MVPYVVK KFPIAPNY+APKG+MLI
Sbjct: 372 RENDPTKALSLDLIEEMKYTNMVVKESLRYRPPVLMVPYVVKQKFPIAPNYSAPKGSMLI 431

Query: 241 PTLYPALHDPEVYDDPEEFIPERWVEGSPANEAKKNWLVFGSGSHVCLGQTYVMMTFTAL 300
           PTLYPALHDPEVY++P+EFIPERWVEGSPAN+AK+NWLVFGSG HVCLGQTYVMMTFTAL
Sbjct: 432 PTLYPALHDPEVYENPDEFIPERWVEGSPANQAKRNWLVFGSGPHVCLGQTYVMMTFTAL 491

Query: 301 IGKFAMYTNWEHKVTPLSEKIKVFATIFPKD 331
           IGKFAMYT++EHKVTPLSEKIKVFATIFPKD
Sbjct: 492 IGKFAMYTDFEHKVTPLSEKIKVFATIFPKD 522

>KLLA0D11242g complement(959973..961577) highly similar to sp|P54781
           Saccharomyces cerevisiae YMR015c ERG5 C-22 sterol
           desaturase, start by similarity
          Length = 534

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/331 (82%), Positives = 304/331 (91%)

Query: 1   MEKFVTYSAEKNFEPQVYFHELREIMCALSLKAFCGDYITESQIRKVADDYYLVTAALEL 60
           +EKF+  S E  +E +V+FH++REIMCALSLKAFCGDYITE QIRKVADDYYLVTAALEL
Sbjct: 186 IEKFIELSKENKYEARVFFHDMREIMCALSLKAFCGDYITEDQIRKVADDYYLVTAALEL 245

Query: 61  VNFPIILPFTKTWYGQRTADMTMKIFEKCAQMAKDHIAAGGKPKCVMDAWCELMHNAKNK 120
           VNFPII+P+TKTWYG++TADMTMKIFE+CAQMAKDHIAAGG+  CV+DAWC LMH AKNK
Sbjct: 246 VNFPIIIPYTKTWYGKKTADMTMKIFEQCAQMAKDHIAAGGESTCVLDAWCSLMHEAKNK 305

Query: 121 NDEDSRLFHREFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVMQKIREEQLRV 180
           +D DS+L+HREFTNRE+SEA+FTFLFASQDASSSLACW+FQI+ADRPDVM  IREEQLRV
Sbjct: 306 DDADSKLYHREFTNREMSEAIFTFLFASQDASSSLACWIFQIIADRPDVMANIREEQLRV 365

Query: 181 RNNDPSKPLSLDLIDEMKYTYMVVKETLRYRPPVIMVPYVVKNKFPIAPNYTAPKGAMLI 240
           RNNDP+  LS+DLIDEMKYT MVVKETLRYRPPVIMVPY VK  FP+ P Y+APKG+MLI
Sbjct: 366 RNNDPNVKLSMDLIDEMKYTNMVVKETLRYRPPVIMVPYYVKKSFPVVPTYSAPKGSMLI 425

Query: 241 PTLYPALHDPEVYDDPEEFIPERWVEGSPANEAKKNWLVFGSGSHVCLGQTYVMMTFTAL 300
           PTLYPALHDPEVY+DP+EFIPERWVEGS AN+AKKNWLVFG G HVCLGQTYVM TFT L
Sbjct: 426 PTLYPALHDPEVYEDPDEFIPERWVEGSAANQAKKNWLVFGCGPHVCLGQTYVMQTFTGL 485

Query: 301 IGKFAMYTNWEHKVTPLSEKIKVFATIFPKD 331
           IGKFAM+++WEHKVTPLSEKIKVFATIFPKD
Sbjct: 486 IGKFAMFSDWEHKVTPLSEKIKVFATIFPKD 516

>YMR015C (ERG5) [3979] chr13 complement(300868..302484) Cytochrome
           P450, delta 22(23) sterol desaturase, catalyzes an
           intermediate pathway step in the biosynthesis of
           ergosterol [1617 bp, 538 aa]
          Length = 538

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/331 (81%), Positives = 307/331 (92%)

Query: 1   MEKFVTYSAEKNFEPQVYFHELREIMCALSLKAFCGDYITESQIRKVADDYYLVTAALEL 60
           M+KFV  S E N+EPQV+FHE+REI+CALSL +FCG+YITE Q+RK+ADDYYLVTAALEL
Sbjct: 190 MDKFVRLSKENNYEPQVFFHEMREILCALSLNSFCGNYITEDQVRKIADDYYLVTAALEL 249

Query: 61  VNFPIILPFTKTWYGQRTADMTMKIFEKCAQMAKDHIAAGGKPKCVMDAWCELMHNAKNK 120
           VNFPII+P+TKTWYG++TADM MKIFE CAQMAKDHIAAGGKP CVMDAWC+LMH+AKN 
Sbjct: 250 VNFPIIIPYTKTWYGKKTADMAMKIFENCAQMAKDHIAAGGKPVCVMDAWCKLMHDAKNS 309

Query: 121 NDEDSRLFHREFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVMQKIREEQLRV 180
           ND+DSR++HREFTN+EISEAVFTFLFASQDASSSLACWLFQIVADRPDV+ KIREEQL V
Sbjct: 310 NDDDSRIYHREFTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLAV 369

Query: 181 RNNDPSKPLSLDLIDEMKYTYMVVKETLRYRPPVIMVPYVVKNKFPIAPNYTAPKGAMLI 240
           RNND S  L+LDLI++MKYT MV+KETLRYRPPV+MVPYVVK  FP++PNYTAPKGAMLI
Sbjct: 370 RNNDMSTELNLDLIEKMKYTNMVIKETLRYRPPVLMVPYVVKKNFPVSPNYTAPKGAMLI 429

Query: 241 PTLYPALHDPEVYDDPEEFIPERWVEGSPANEAKKNWLVFGSGSHVCLGQTYVMMTFTAL 300
           PTLYPALHDPEVY++P+EFIPERWVEGS A+EAKKNWLVFG G HVCLGQTYVM+TF AL
Sbjct: 430 PTLYPALHDPEVYENPDEFIPERWVEGSKASEAKKNWLVFGCGPHVCLGQTYVMITFAAL 489

Query: 301 IGKFAMYTNWEHKVTPLSEKIKVFATIFPKD 331
           +GKFA+YT++ H VTPLSEKIKVFATIFPKD
Sbjct: 490 LGKFALYTDFHHTVTPLSEKIKVFATIFPKD 520

>CAGL0M07656g 765772..767379 highly similar to sp|P54781
           Saccharomyces cerevisiae YMR015c C-22 sterol desaturase,
           start by similarity
          Length = 535

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/331 (81%), Positives = 307/331 (92%)

Query: 1   MEKFVTYSAEKNFEPQVYFHELREIMCALSLKAFCGDYITESQIRKVADDYYLVTAALEL 60
           +EKFV  S E N+EPQ++FHE+REI+CALSL++FCGDYI+E QIRK+ADDYYLVTAALEL
Sbjct: 187 IEKFVELSKENNYEPQIFFHEMREILCALSLRSFCGDYISEDQIRKIADDYYLVTAALEL 246

Query: 61  VNFPIILPFTKTWYGQRTADMTMKIFEKCAQMAKDHIAAGGKPKCVMDAWCELMHNAKNK 120
           VNFPIILPFTKTWYG+RTADM MKIFE CAQ AKDHIAAGGKP CVMD WC+LMH+AKN+
Sbjct: 247 VNFPIILPFTKTWYGKRTADMAMKIFESCAQRAKDHIAAGGKPICVMDNWCKLMHDAKNR 306

Query: 121 NDEDSRLFHREFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVMQKIREEQLRV 180
            D+DSRL HREFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDV+ KIREEQLRV
Sbjct: 307 TDDDSRLLHREFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLRV 366

Query: 181 RNNDPSKPLSLDLIDEMKYTYMVVKETLRYRPPVIMVPYVVKNKFPIAPNYTAPKGAMLI 240
           R  D +K L +DL+D+M+YT+MVVKETLRYRPPV+MVPYVVKNKFP+ P+Y APKG+MLI
Sbjct: 367 REGDINKRLDIDLVDKMEYTHMVVKETLRYRPPVLMVPYVVKNKFPVVPDYQAPKGSMLI 426

Query: 241 PTLYPALHDPEVYDDPEEFIPERWVEGSPANEAKKNWLVFGSGSHVCLGQTYVMMTFTAL 300
            TLYPALHDPEVY++P++FIPERWVEGSPANEAKKNWLVFG G HVCLGQTYVM+T TAL
Sbjct: 427 ATLYPALHDPEVYENPDDFIPERWVEGSPANEAKKNWLVFGCGPHVCLGQTYVMITMTAL 486

Query: 301 IGKFAMYTNWEHKVTPLSEKIKVFATIFPKD 331
           IGKFA++T+++HKVTPLSEKIKVFATIFPKD
Sbjct: 487 IGKFALFTDFKHKVTPLSEKIKVFATIFPKD 517

>Scas_709.53
          Length = 523

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/331 (79%), Positives = 309/331 (93%)

Query: 1   MEKFVTYSAEKNFEPQVYFHELREIMCALSLKAFCGDYITESQIRKVADDYYLVTAALEL 60
           ++KF+  S E N+EPQV+FHE+REI+CALSL+AFCG+YITE QIRK+ADDYYLVTAALEL
Sbjct: 175 LQKFIEISKENNYEPQVFFHEMREILCALSLRAFCGEYITEDQIRKIADDYYLVTAALEL 234

Query: 61  VNFPIILPFTKTWYGQRTADMTMKIFEKCAQMAKDHIAAGGKPKCVMDAWCELMHNAKNK 120
           VNFPII+PFTKTWYG+RTAD  MKIFE+CAQM+KD+IA GGKP CVMDAWC+LMH+AK K
Sbjct: 235 VNFPIIIPFTKTWYGKRTADAAMKIFEQCAQMSKDYIAKGGKPICVMDAWCKLMHDAKTK 294

Query: 121 NDEDSRLFHREFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVMQKIREEQLRV 180
           NDEDSR+ HREF+N+EISEA+FTFLFASQDASSSLACWLFQIVADRPD+++KIR+EQ+ V
Sbjct: 295 NDEDSRILHREFSNKEISEAIFTFLFASQDASSSLACWLFQIVADRPDILEKIRKEQMEV 354

Query: 181 RNNDPSKPLSLDLIDEMKYTYMVVKETLRYRPPVIMVPYVVKNKFPIAPNYTAPKGAMLI 240
           RNND S  L+++LID+MKYT MV+KETLRYRPPV+MVPYVVK KFP+ PNYTAPKG+MLI
Sbjct: 355 RNNDMSTELNIELIDKMKYTNMVIKETLRYRPPVLMVPYVVKEKFPVTPNYTAPKGSMLI 414

Query: 241 PTLYPALHDPEVYDDPEEFIPERWVEGSPANEAKKNWLVFGSGSHVCLGQTYVMMTFTAL 300
           PTLYP+LHDPEVY++P+EFIPERW EGSPA+EAKKNWLVFG G HVCLGQTYVM+TF AL
Sbjct: 415 PTLYPSLHDPEVYENPDEFIPERWEEGSPASEAKKNWLVFGCGPHVCLGQTYVMITFAAL 474

Query: 301 IGKFAMYTNWEHKVTPLSEKIKVFATIFPKD 331
           +GKFA+YT++EHK+TPLSEKIKVFATIFPKD
Sbjct: 475 LGKFALYTDFEHKITPLSEKIKVFATIFPKD 505

>ABR053C [644] [Homologous to ScYMR015C (ERG5) - SH]
           (492258..493805) [1548 bp, 515 aa]
          Length = 515

 Score =  544 bits (1401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/332 (75%), Positives = 295/332 (88%), Gaps = 1/332 (0%)

Query: 1   MEKFVTYSAEKNFEPQVYFHELREIMCALSLKAFCGDYITESQIRKVADDYYLVTAALEL 60
           M KFV +S E ++E +V+FHE+RE++CALSLKAFCG YIT+ Q+RK+ADDYYLVTAALEL
Sbjct: 166 MAKFVAFSRETDYEHRVFFHEMREMLCALSLKAFCGSYITDDQVRKIADDYYLVTAALEL 225

Query: 61  VNFPIILPFTKTWYGQRTADMTMKIFEKCAQMAKDHIAAGGKPKCVMDAWCELMHNAKNK 120
           VNFP+ILPFTKTWYG+RTADM MKIFE+CAQ AK HIAAGG+P CV+DAWC+LM +AK K
Sbjct: 226 VNFPLILPFTKTWYGKRTADMAMKIFERCAQEAKQHIAAGGEPTCVVDAWCKLMLDAKAK 285

Query: 121 NDEDSRLFHREFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVMQKIREEQLRV 180
           +D DSRL HR+FTNRE+SEA+FTFLFASQDASSSLACWLFQIVADRPDV+ KIREEQL V
Sbjct: 286 DDADSRLLHRKFTNREMSEALFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLAV 345

Query: 181 RNNDPSKPLSLDLIDEMKYTYMVVKETLRYRPPVIMVPYVVKNKFPIAPNYTAPKGAMLI 240
           R NDPS PLSL+LID+MKYT+M VKE LRYRPPV+MVPY V   F ++ +YTAPKG+ML+
Sbjct: 346 RRNDPSVPLSLELIDQMKYTHMAVKECLRYRPPVLMVPYQVHEAFAVSADYTAPKGSMLV 405

Query: 241 PTLYPALHDPEVYDDPEEFIPERW-VEGSPANEAKKNWLVFGSGSHVCLGQTYVMMTFTA 299
            T+YPALHDP VY++P+++IPERW  E SPAN+AKKNWLVFGSG HVCLGQ YV MTFTA
Sbjct: 406 ATMYPALHDPAVYENPDDYIPERWDGEQSPANQAKKNWLVFGSGPHVCLGQKYVFMTFTA 465

Query: 300 LIGKFAMYTNWEHKVTPLSEKIKVFATIFPKD 331
           LIGKFA++T ++HKVT LSEKIKVFATIFP+D
Sbjct: 466 LIGKFALFTEFDHKVTSLSEKIKVFATIFPQD 497

>KLLA0E03553g 329904..331487 highly similar to sp|P10614
           Saccharomyces cerevisiae YHR007c ERG11 cytochrome P450
           lanosterol 14a-demethylase, start by similarity
          Length = 527

 Score = 92.4 bits (228), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 96/200 (48%), Gaps = 22/200 (11%)

Query: 131 EFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVMQKIREEQLRVRNNDPSKPLS 190
           + T++EI+  +   L   Q  S++ + W+   +A+RPD+ +K+ EEQ++V +N  +K L+
Sbjct: 299 KMTDQEIANLLIGVLMGGQHTSAATSAWVILHLAERPDIQEKLYEEQMKVLDNG-TKELT 357

Query: 191 LDLIDEMKYTYMVVKETLRYRPPVIMVPYVVKNKFPIAPN--YTAPKG-AMLIPTLYPAL 247
            DL+ EM      +KETLR   P+  +   V N  P+ PN  Y  PKG  +L+   Y  L
Sbjct: 358 FDLLQEMPLLNQTIKETLRLHHPLHSLFRKVMNDMPV-PNSSYVVPKGHHVLVSPGYCHL 416

Query: 248 HDPEVYDDPEEFIPERWVE----------------GSPANEAKKNWLVFGSGSHVCLGQT 291
            D + + +  EF P RW                  GS +      +L FG G H C+G+ 
Sbjct: 417 QD-KYFPNASEFNPNRWDNDAASSYASNEKVDYGFGSISKGVSSPYLPFGGGRHRCIGEH 475

Query: 292 YVMMTFTALIGKFAMYTNWE 311
           +  M    ++  +     W+
Sbjct: 476 FAYMQLGTILSNYIRTLTWK 495

>YHR007C (ERG11) [2293] chr8 complement(120085..121677) Cytochrome
           P450 (lanosterol 14alpha-demethylase), essential for
           biosynthesis of ergosterol [1593 bp, 530 aa]
          Length = 530

 Score = 79.3 bits (194), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 91/200 (45%), Gaps = 20/200 (10%)

Query: 131 EFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVMQKIREEQLRVRNNDPSKPLS 190
           + T++EI+  +   L   Q  S++ + W+   +A+RPDV Q++ EEQ+RV +    K L+
Sbjct: 298 KMTDQEIANLLIGVLMGGQHTSAATSAWILLHLAERPDVQQELYEEQMRVLDGG-KKELT 356

Query: 191 LDLIDEMKYTYMVVKETLRYRPPV-IMVPYVVKNKFPIAPNYTAPKG-AMLIPTLYPALH 248
            DL+ EM      +KETLR   P+  +   V+K+      +Y  P G  +L+   Y  L 
Sbjct: 357 YDLLQEMPLLNQTIKETLRMHHPLHSLFRKVMKDMHVPNTSYVIPAGYHVLVSPGYTHLR 416

Query: 249 DPEVYDDPEEFIPERWVE----------------GSPANEAKKNWLVFGSGSHVCLGQTY 292
           D E + +  +F   RW +                G+ +      +L FG G H C+G+ +
Sbjct: 417 D-EYFPNAHQFNIHRWNKDSASSYSVGEEVDYGFGAISKGVSSPYLPFGGGRHRCIGEHF 475

Query: 293 VMMTFTALIGKFAMYTNWEH 312
                  L+  F     W +
Sbjct: 476 AYCQLGVLMSIFIRTLKWHY 495

>Sklu_2436.11 YHR007C, Contig c2436 26015-27613 reverse complement
          Length = 532

 Score = 79.0 bits (193), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 89/199 (44%), Gaps = 22/199 (11%)

Query: 131 EFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVMQKIREEQLRVRNNDPSKPLS 190
           + T++EI+  +   L   Q  S++ + WL   +A++P++ +++  EQ+RV +N   K L+
Sbjct: 299 KMTDQEIANLLIGVLMGGQHTSAATSAWLLLHLAEKPELQEELYAEQMRVLDNG-KKELT 357

Query: 191 LDLIDEMKYTYMVVKETLRYRPPVIMVPYVVKNKFPIAPN--YTAPKG-AMLIPTLYPAL 247
            DL+ EM      +KETLR   P+  +   V    P+ PN  Y  PKG  +L+   Y  L
Sbjct: 358 YDLLQEMPLLNQTIKETLRMHHPLHSIFRKVMRDLPV-PNTSYVVPKGHHVLVSPGYAHL 416

Query: 248 HDPEVYDDPEEFIPERWVE----------------GSPANEAKKNWLVFGSGSHVCLGQT 291
            D E +     F P RW                  GS +      +L FG G H C+G+ 
Sbjct: 417 RD-EYFPHAATFDPHRWDNDAASSYSSSEQVDYGFGSVSKGVSSPYLPFGGGRHRCVGEH 475

Query: 292 YVMMTFTALIGKFAMYTNW 310
           +       ++  +     W
Sbjct: 476 FAYCQLGTIMSVYIRTLKW 494

>CAGL0E04334g complement(415351..416952) highly similar to sp|P10614
           Saccharomyces cerevisiae YHR007c ERG11, start by
           similarity
          Length = 533

 Score = 79.0 bits (193), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 99/225 (44%), Gaps = 30/225 (13%)

Query: 108 DAWCELMHNAKNKNDEDSRLFHREFTNREISEAVFTFLFASQDASSSLACWLFQIVADRP 167
           D   ELM N+  K+         + T++EI+  +   L   Q  S++ + W    +A+RP
Sbjct: 283 DLIDELMKNSTYKDGT-------KMTDQEIANLLIGVLMGGQHTSAATSAWCLLHLAERP 335

Query: 168 DVMQKIREEQLRVRNNDPSKPLSLDLIDEMKYTYMVVKETLRYRPPVIMVPYVVKNKFPI 227
           DV +++ +EQ+RV NND +K L+ D +  M     ++KETLR   P+  +   V     I
Sbjct: 336 DVQEELYQEQMRVLNND-TKELTYDDLQNMPLLNQMIKETLRLHHPLHSLFRKVMRDVAI 394

Query: 228 APN--YTAPKG-AMLIPTLYPALHDPEVYDDPEEFIPERWVEGSPANEAKKN-------- 276
            PN  Y  P+   +L+   Y  L + E +  P EF   RW   + ++ A           
Sbjct: 395 -PNTSYVVPRDYHVLVSPGYTHLQE-EFFPKPNEFNIHRWDGDAASSSAAGGDEVDYGFG 452

Query: 277 ---------WLVFGSGSHVCLGQTYVMMTFTALIGKFAMYTNWEH 312
                    +L FG G H C+G+ +       L+  F     W +
Sbjct: 453 AISKGVSSPYLPFGGGRHRCIGELFAYCQLGVLMSIFIRTMKWRY 497

>ADR162W [1904] [Homologous to ScYHR007C (ERG11) - SH]
           complement(987458..989047) [1590 bp, 529 aa]
          Length = 529

 Score = 77.8 bits (190), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 89/199 (44%), Gaps = 20/199 (10%)

Query: 131 EFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVMQKIREEQLRVRNNDPSKPLS 190
           + T+++I+  +   L   Q  S++ + W+   +A+RPD+ +++ EEQ+RV +   +K L+
Sbjct: 296 KMTDQQIANLLIGVLMGGQHTSAATSAWVLLHLAERPDIQEELYEEQMRVLDGG-AKELT 354

Query: 191 LDLIDEMKYTYMVVKETLRYRPPVIMVPYVVKNKFPIAPN--YTAPKGAMLIPTLYPALH 248
            +L+ EM     V+KETLR   P+  +   V    P+ PN  Y  PK   ++ +      
Sbjct: 355 YELLQEMPLLNQVIKETLRMHHPLHSLFRKVTRDMPV-PNTSYVIPKDHYVLASPGFCHL 413

Query: 249 DPEVYDDPEEFIPERWVE----------------GSPANEAKKNWLVFGSGSHVCLGQTY 292
             E + + +EF P RW                  G+ +      +L FG G H C+G+ +
Sbjct: 414 SEEYFPNAKEFNPHRWDNDAASSVSTGEKVDYGFGAISKGVSSPYLPFGGGRHRCIGEGF 473

Query: 293 VMMTFTALIGKFAMYTNWE 311
             M    +         W 
Sbjct: 474 AYMQLGTIFSVVVRSMKWH 492

>Kwal_47.18323
          Length = 536

 Score = 76.6 bits (187), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 90/204 (44%), Gaps = 22/204 (10%)

Query: 131 EFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVMQKIREEQLRVRNNDPSKPLS 190
           + T++EI+  +   L   Q  S++ + W+   +A+RPD+ +++  EQ+ V +N   K L+
Sbjct: 303 KMTDQEIANLLIGVLMGGQHTSAATSAWMLLHLAERPDLQEELYAEQMEVLDNG-KKELT 361

Query: 191 LDLIDEMKYTYMVVKETLRYRPPVIMVPYVVKNKFPI-APNYTAPKGA-MLIPTLYPALH 248
            +L+ +M      +KETLR   P+  +   V+   P+    Y  P+G  +L+   Y  L 
Sbjct: 362 YELLQQMPLLNQTIKETLRMHHPLHSIFRRVERDLPVPKTQYVVPRGHFVLVSPGYCHLQ 421

Query: 249 DPEVYDDPEEFIPERWVE----------------GSPANEAKKNWLVFGSGSHVCLGQTY 292
           D E +     F P RW                  G+ +      +L FG G H C+G+ +
Sbjct: 422 D-EYFPKANTFDPHRWNNDYKSSYATGEEVDYGFGAISKGVSSPYLPFGGGRHRCIGEHF 480

Query: 293 VMMTFTALIGKFAMYTNWEHKVTP 316
                  L+  +     W  K TP
Sbjct: 481 AYCQLGVLMSVYIRTVKW--KFTP 502

>Scas_699.20
          Length = 538

 Score = 69.7 bits (169), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 87/204 (42%), Gaps = 30/204 (14%)

Query: 131 EFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVMQKIREEQLRVRNNDPSKPLS 190
           + T+ EI+  +   L   Q  S++ + W    +A+RPDV +++ +EQ+RV +N   K ++
Sbjct: 305 KMTDPEIANLLIGVLMGGQHTSAATSAWCLLHLAERPDVQEELYQEQMRVLDNG-KKEIT 363

Query: 191 LDLIDEMKYTYMVVKETLRYRPPVIMVPYVVKNKFPIAPNYTAPKGAMLIPTLYPALHDP 250
            DL+++M     ++KETLR   P+    + +  K  +  +   P  + +IP  Y  L  P
Sbjct: 364 YDLLEQMPLLNQMIKETLRLHHPL----HSLFRK--VIRDMQVPNTSYVIPKDYFVLVSP 417

Query: 251 EVYDDPEEFIPE-------RWVE----------------GSPANEAKKNWLVFGSGSHVC 287
                 E + P+       RW                  G+        +L FG G H C
Sbjct: 418 GYTHLQEHYFPQAHSFNIHRWDNDAESSYVVGEEVDYGFGAITKGVTSPYLPFGGGRHRC 477

Query: 288 LGQTYVMMTFTALIGKFAMYTNWE 311
           +G+ Y       ++ +F     W 
Sbjct: 478 IGEHYAYCQLGVIMAEFIREMKWH 501

>KLLA0C06743g complement(590585..592126) similar to sp|P21595
           Saccharomyces cerevisiae YDR402c DIT2 cytochrome P450 56
           singleton, start by similarity
          Length = 513

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/232 (25%), Positives = 91/232 (39%), Gaps = 43/232 (18%)

Query: 113 LMHNAK--NKNDEDSRLFH----REFTNREISEAVFTFLFASQDASSSLACWLFQIVADR 166
           L+HN K    N+  + L      +  T+ ++ + +   L A  +    L   LF ++A  
Sbjct: 258 LIHNYKFEQTNNAAAGLIREWKLQGITDEQLKDNLVIILVAGHENPQLLLSTLFYLLAKH 317

Query: 167 PDVMQKIREEQLRVRNNDPSKPLSLDLIDEMKYTYMVVKETLRYRPPV-IMVPYVVKNKF 225
            +    IREE L V  N+       D+++  K T  +  E LR  PP+  ++      K 
Sbjct: 318 QNWQYAIREELLSVDRNE-------DILNSFKLTAFIY-EALRMFPPLGQIINRRTTRKC 369

Query: 226 PIAPNYTAPKGAMLIPTLYPALHDPEVYDD-PEEFIPERWVEGSPANEAKKNW------- 277
            + P     K       +Y       V+ +  ++FIPERW E S  NE   NW       
Sbjct: 370 QLGPGIIIDKDVYCGYNVYGTGTATSVWGETAKQFIPERWGENS--NELANNWKKHKYDA 427

Query: 278 --LVFGSGSHVCLGQT-----------YVMMTFTALIGKFAMYTNWEHKVTP 316
               F  G   CLG+            YV+M F        ++  W+ K+TP
Sbjct: 428 SMSAFHGGRRSCLGEKLALMEMKYVLYYVLMNF-----HIELHPQWKEKMTP 474

>CAGL0F02607g complement(253736..255232) similar to sp|P21595
           Saccharomyces cerevisiae YDR402c DIT2 cytochrome P450,
           hypothetical start
          Length = 498

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 51/214 (23%), Positives = 86/214 (40%), Gaps = 26/214 (12%)

Query: 131 EFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVMQ-KIREEQLRVRNNDPSKPL 189
           E T +++++ +   L A  +        L  ++    D  Q  IR E L    N+ S+  
Sbjct: 277 ELTYKQLTDNIVILLVAGHENPQLFISNLIYLLGKYHDTWQVDIRNEILNNEENNLSE-- 334

Query: 190 SLDLIDEMKYTYMVVKETLRYRPPV-IMVPYVVKNKFPIAPNYTAPKGAMLIPTLYPALH 248
            L L++   Y      E LRY PP+ +++      +  + P    PK   +    Y   H
Sbjct: 335 -LPLLNSFLY------ECLRYYPPLSVIINRKTTKRCMLGPGIVVPKDTYVGYHNYSTCH 387

Query: 249 DPEVYDDPEE-FIPERWVEGSPANEAKKNWLV---------FGSGSHVCLGQTYVMMTFT 298
           D   +    + F P RW  G       K W           F  G   CLG+  V ++  
Sbjct: 388 DSNFWGHTSDIFDPTRW--GKDIETINKAWKTTKNNCILNTFHGGKRACLGEKLVFVSTR 445

Query: 299 ALIGKFAMYTNWEHKVTPL-SEKIKVFATIFPKD 331
            +I +F   +++E K++PL  E++     + PKD
Sbjct: 446 IIIAEFL--SSFEWKLSPLWVEQMTHAGPLCPKD 477

>Sklu_1634.3 YDR402C, Contig c1634 2102-3676 reverse complement
          Length = 524

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 64/155 (41%), Gaps = 19/155 (12%)

Query: 179 RVRNNDPSKPLSLDLIDEMKYTYMVVKETLRYRPPVIMVPYVVKNKFPI-APNYTAPKGA 237
           +VR  +  +  S+  I E+        E +R  PP+  +     +K  +   +   PKG+
Sbjct: 354 QVRLREELRSCSMTEIHELPLLNAFFFECIRMYPPLGQIINRCTSKTCVLGRDIVIPKGS 413

Query: 238 MLIPTLYPALHDPEVY-DDPEEFIPERWVEGSPANEAKKNWL---------VFGSGSHVC 287
            +   +Y       V+ +D  EF PERW  G   NE    W           F  G   C
Sbjct: 414 YVGYNVYATGRSRTVWGNDSNEFRPERW--GLSYNEVMDTWRHSKNSCAMSAFHGGRRAC 471

Query: 288 LGQ----TYVMMTFTALIGKFA--MYTNWEHKVTP 316
           LG+    T + +T   ++ +F   +  +W+ K+TP
Sbjct: 472 LGEKLALTELRITVAEMLTQFQWRLAPDWKDKMTP 506

>Kwal_47.18804
          Length = 508

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/209 (19%), Positives = 79/209 (37%), Gaps = 29/209 (13%)

Query: 126 RLFHRE-FTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVMQKIREEQLRVRNND 184
           R ++RE  + +++ + +   + A  +    L    F +          +REE        
Sbjct: 292 RSYNREEISKKQLIDNIVIIMVAGHENPQLLLTTCFYMFGKNRKWQDLVREE-------- 343

Query: 185 PSKPLSLDLIDEMKYTYMVVKETLRYRPPVI-MVPYVVKNKFPIAPNYTAPKGAMLIPTL 243
             +   ++ ++++      + E +R  PP+  ++      K  +  +   P+   L   +
Sbjct: 344 -VQGCGIENLNDLPLLNSFIFECIRMYPPLSQIINRCTTKKCVLGTDIVLPENVYLGYNV 402

Query: 244 YPALHDPEVY-DDPEEFIPERWVEGSPANEAKKNW---------LVFGSGSHVCLGQTYV 293
           Y        + D+ + FIPERW  G+   E  K W           F  G   CLG+   
Sbjct: 403 YSTGRYKSAWGDNADCFIPERW--GNNIEEITKEWRHRKNTCAMAAFHGGRRACLGEKLA 460

Query: 294 MM----TFTALIGKF--AMYTNWEHKVTP 316
           +M       A++  F   +  +W  KVTP
Sbjct: 461 LMEVRIAMAAVLKNFEWTLAASWVDKVTP 489

>KLLA0C19206g 1711813..1713348 weakly similar to sp|O48923 Glycine
           max Cytochrome P450 71D10 (EC 1.14.-.-), hypothetical
           start
          Length = 511

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 89/221 (40%), Gaps = 35/221 (15%)

Query: 135 REISEAVFTF----------LFASQDASSSLACWLFQIVADRPDVMQKIREEQLRVRN-- 182
           R +    FTF          LFA+ + +S++  W    +    +   ++R E L+V+   
Sbjct: 287 RHVESGKFTFNNWIQTIDEILFANIEVTSTVMAWALVEMGSNIEEQNRLRCEILKVKEQS 346

Query: 183 -----NDPSKPLSLDLIDEMKYTYMVVKETLRYRP------PVIMVPYVVKNKFPIAPNY 231
                N  + P+   +     Y    V ETLR  P      P I    +  +   I+PN 
Sbjct: 347 SKDDFNKETDPMQRYMKLTDTYLQYCVWETLRMHPLLWFSFPEISSETLFIDGIRISPNT 406

Query: 232 TAPKGAMLIPTLYPALHDPEVYDD-PEEFIPERWVEGSPANEAKKNWLVFGSGSHVCLGQ 290
                   I    P  +  +   D  ++F P R+ E     +A  + + FG+GS  CLG+
Sbjct: 407 PIVVDQYQINYNSPIWNPSDKPKDFGKKFAPSRF-ENITLRDALYSQVTFGAGSRKCLGR 465

Query: 291 TYVMMTFTALIGKFAMYTNWEHKVTPLSEKIKVFATIFPKD 331
            +  +    LI     Y   ++KVT L+EK++     F KD
Sbjct: 466 NFAEL----LIKSELAYILSKYKVT-LTEKVE-----FSKD 496

>KLLA0D11638g 995087..996262 similar to ca|CA4405|IPF8773 Candida
           albicans putative cytochrome P450 (by homology),
           hypothetical start
          Length = 391

 Score = 32.3 bits (72), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 16/73 (21%), Positives = 31/73 (42%), Gaps = 13/73 (17%)

Query: 255 DPEEFIPERWVEGSPANEAKKNW-----------LVFGSGSHVCLGQTYVMMTFTALIGK 303
           +P +F P RW+      E ++ +             FG G+ +CLG    +M     I +
Sbjct: 264 NPRQFNPARWLRDETTGETEQEYEKRLTKMNNSMFTFGQGNRMCLGMNLALMEMKYCIAQ 323

Query: 304 FAMYTNWEHKVTP 316
             +Y+ +   ++P
Sbjct: 324 --LYSRYTTDISP 334

>Sklu_1987.2 YBL015W, Contig c1987 2738-4309
          Length = 523

 Score = 32.0 bits (71), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 15/67 (22%), Positives = 37/67 (55%)

Query: 107 MDAWCELMHNAKNKNDEDSRLFHREFTNREISEAVFTFLFASQDASSSLACWLFQIVADR 166
           ++ W E++ ++     E+  L +   T+  ++EA F   F + D+ S   C   Q+V++ 
Sbjct: 297 LNVWTEVLQDSFLDLFENGSLDYATATSIRLTEAGFERFFENWDSFSKKLCLRSQVVSNN 356

Query: 167 PDVMQKI 173
           P++++++
Sbjct: 357 PEIIRRL 363

>AFR020W [3212] [Homologous to ScYBL015W (ACH1) - SH]
           complement(472535..474505) [1971 bp, 656 aa]
          Length = 656

 Score = 31.6 bits (70), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 36/67 (53%)

Query: 107 MDAWCELMHNAKNKNDEDSRLFHREFTNREISEAVFTFLFASQDASSSLACWLFQIVADR 166
           +  W E++ ++     E+  L     T+  ++EA F   FA+ D  SS  C   Q+V++ 
Sbjct: 430 LTVWTEVLQDSFLDLFENGSLEFATATSIRLTEAGFEKFFANWDEYSSKLCLRSQVVSNS 489

Query: 167 PDVMQKI 173
           P++++++
Sbjct: 490 PEMIRRL 496

>Scas_515.2
          Length = 887

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 3/40 (7%)

Query: 221 VKNKFPIAPNYTAPKGAMLIPTLYPALHDPEVYDDPEEFI 260
           +K + P++ N T P G +L PT   AL   +++D+ E FI
Sbjct: 353 IKAQRPLSKNETGPLGLILAPTRELAL---QIHDEIERFI 389

>AFR661W [3854] [Homologous to ScYGL140C - NSH]
           complement(1642457..1645996) [3540 bp, 1179 aa]
          Length = 1179

 Score = 28.9 bits (63), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 16/23 (69%)

Query: 52  YLVTAALELVNFPIILPFTKTWY 74
           + VT AL L +FP+ +P T+ WY
Sbjct: 626 FQVTIALTLASFPMYIPATREWY 648

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.136    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,310,965
Number of extensions: 483920
Number of successful extensions: 1163
Number of sequences better than 10.0: 33
Number of HSP's gapped: 1164
Number of HSP's successfully gapped: 33
Length of query: 331
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 229
Effective length of database: 13,065,073
Effective search space: 2991901717
Effective search space used: 2991901717
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)