Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.817049348623520.0
Sklu_2168.347949310711e-142
ABR052W5095178341e-106
Scas_709.544705018271e-105
KLLA0D11220g4775176687e-82
YMR014W (BUD22)5195306082e-72
CAGL0M07678g4731313302e-33
Sklu_1673.223196672.7
YJR141W34781673.4
CAGL0F07293g72463664.7
KLLA0D09955g72475657.4
CAGL0F09075g74637657.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.8170
         (486 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.8170                                                          910   0.0  
Sklu_2168.3 YMR014W, Contig c2168 4667-6106                           417   e-142
ABR052W [643] [Homologous to ScYMR014W (BUD22) - SH] complement(...   325   e-106
Scas_709.54                                                           323   e-105
KLLA0D11220g 958249..959682 weakly similar to sp|Q04347 Saccharo...   261   7e-82
YMR014W (BUD22) [3978] chr13 (298867..300426) Protein with possi...   238   2e-72
CAGL0M07678g complement(767857..769278) similar to sp|Q04347 Sac...   131   2e-33
Sklu_1673.2 YDL018C, Contig c1673 1962-2657 reverse complement         30   2.7  
YJR141W (YJR141W) [3033] chr10 (695821..696864) Protein of unkno...    30   3.4  
CAGL0F07293g complement(710050..712224) highly similar to sp|P53...    30   4.7  
KLLA0D09955g 839640..841814 similar to sp|P38920 Saccharomyces c...    30   7.4  
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...    30   7.7  

>Kwal_26.8170
          Length = 493

 Score =  910 bits (2352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/486 (94%), Positives = 458/486 (94%)

Query: 1   MPKENLIFKLDNLEYQYHHLNNSLDGFQPRLSGTAKTFNAKGKKASKRIQKLLYESNLTE 60
           MPKENLIFKLDNLEYQYHHLNNSLDGFQPRLSGTAKTFNAKGKKASKRIQKLLYESNLTE
Sbjct: 1   MPKENLIFKLDNLEYQYHHLNNSLDGFQPRLSGTAKTFNAKGKKASKRIQKLLYESNLTE 60

Query: 61  VSRALDSLRREIVEKKAYHLENKLASLLEKNLQQQYSSLLKNSNEKNKDRLKTLATLEKS 120
           VSRALDSLRREIVEKKAYHLENKLASLLEKNLQQQYSSLLKNSNEKNKDRLKTLATLEKS
Sbjct: 61  VSRALDSLRREIVEKKAYHLENKLASLLEKNLQQQYSSLLKNSNEKNKDRLKTLATLEKS 120

Query: 121 YTIPGFSKLIAKYRTCKLLVPKLLFTKALREDPPQWLKDNEYVTIFNDKNNTHNPGKVWN 180
           YTIPGFSKLIAKYRTCKLLVPKLLFTKALREDPPQWLKDNEYVTIFNDKNNTHNPGKVWN
Sbjct: 121 YTIPGFSKLIAKYRTCKLLVPKLLFTKALREDPPQWLKDNEYVTIFNDKNNTHNPGKVWN 180

Query: 181 EVIVATEGCERLLSLTMNDKKIKELLSGFDSAMDLFMNKKKEREASQNNTNEQSKPSRAV 240
           EVIVATEGCERLLSLTMNDKKIKELLSGFDSAMDLFMNKKKEREASQNNTNEQSKPSRAV
Sbjct: 181 EVIVATEGCERLLSLTMNDKKIKELLSGFDSAMDLFMNKKKEREASQNNTNEQSKPSRAV 240

Query: 241 PETDERSSEDENGDNDFXXXXXXXXXXXXXXLIDEDEILKQYEGMLVASDEEGEDLTMPS 300
           PETDERSSEDENGDNDF              LIDEDEILKQYEGMLVASDEEGEDLTMPS
Sbjct: 241 PETDERSSEDENGDNDFASSSSEGEDADGSALIDEDEILKQYEGMLVASDEEGEDLTMPS 300

Query: 301 LNPDINYNEVTXXXXXXXXXXXXXXLSDGEEDVPPLKKQKRSQEREDDQSKVKTNLPELM 360
           LNPDINYNEVT              LSDGEEDVPPLKKQKRSQEREDDQSKVKTNLPELM
Sbjct: 301 LNPDINYNEVTDEEPSESENDSDISLSDGEEDVPPLKKQKRSQEREDDQSKVKTNLPELM 360

Query: 361 TGYYSGGSDDEISEDEVAAKQASNEPKRKNRRGQRARQKIWEKKYGHNAKHVQRQVEAEK 420
           TGYYSGGSDDEISEDEVAAKQASNEPKRKNRRGQRARQKIWEKKYGHNAKHVQRQVEAEK
Sbjct: 361 TGYYSGGSDDEISEDEVAAKQASNEPKRKNRRGQRARQKIWEKKYGHNAKHVQRQVEAEK 420

Query: 421 SERERKKQEYEARVAKRAARAQDREATTRKRPSDPKTWEAPAKDAPIHPSWEAKKMAEEK 480
           SERERKKQEYEARVAKRAARAQDREATTRKRPSDPKTWEAPAKDAPIHPSWEAKKMAEEK
Sbjct: 421 SERERKKQEYEARVAKRAARAQDREATTRKRPSDPKTWEAPAKDAPIHPSWEAKKMAEEK 480

Query: 481 QKGAKF 486
           QKGAKF
Sbjct: 481 QKGAKF 486

>Sklu_2168.3 YMR014W, Contig c2168 4667-6106
          Length = 479

 Score =  417 bits (1071), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 232/493 (47%), Positives = 314/493 (63%), Gaps = 29/493 (5%)

Query: 1   MPKENLIFKLDNLEYQYHHLNNSLDGFQPRLSGTAKTFNAKGKKASKRIQKLLYESNLTE 60
           MPKENLIFKLDNLEYQYH+LNN+LD F+PRLS T K F+AKGKK SK+I KLL ++ L  
Sbjct: 1   MPKENLIFKLDNLEYQYHYLNNTLDDFKPRLSSTNKLFHAKGKKTSKKISKLLSDATLDS 60

Query: 61  VSRALDSLRREIVEKKAYHLENKLASLLEKNLQQQYSSLLKNSNEKNKDR--LKTLATLE 118
           VS+ LD LR+  +EKK YHL+ +L S LEK LQQQY +L K + +K  D+  LK L  ++
Sbjct: 61  VSQQLDDLRQSFLEKKVYHLQKRLESYLEKALQQQYDALPKKAEQKENDKKNLKALEDIK 120

Query: 119 KSYTIPGFSKLIAKYRTCKLLVPKLLFTKALREDPPQWLKDNEYVTIFNDKNNTHNPGKV 178
             +T   FS+LIAK +  +L++ K+  TK L+E+PPQW + ++ + ++ DK +  NP  V
Sbjct: 121 SDFTFTKFSQLIAKSKIVRLVISKITPTKTLKENPPQWFESSDILHVYRDKEDECNPSNV 180

Query: 179 WNEVIVATEGCERLLSLTMNDKKIKELLSGFDSAMDLFMNKKKEREASQNNTNEQSKPSR 238
           WN+V++  EGCE+LLS+ MN KK KEL+  FD  MD+F+   +E++          K S 
Sbjct: 181 WNKVVMKIEGCEKLLSVMMNSKKYKELIDSFDRGMDVFLGINREKKLQNKKVEANKKSSN 240

Query: 239 AVPETDERSSEDENGDNDFXXXXXXXXXXXXXXLIDEDEILKQYEGMLVASDEE--GEDL 296
           A+   D+ S ED   D                   DE+ +++QY+GML  SDEE   ++ 
Sbjct: 241 AL---DDDSGEDFTDDG-----VSDREDDAEFSTADEEALVQQYKGMLAGSDEEDDADEQ 292

Query: 297 TMPSLNPDINYNEVTXXXXXXXXXXXXXXLSDGEEDVPPLKKQKRSQEREDDQSKVKTNL 356
               L+P+++YNEVT               +D E     L+++++ +E    + K K  L
Sbjct: 293 QGYHLDPNVDYNEVTDEEP-----------TDNE---SELEEEEKLEEPPKKKQKNKAQL 338

Query: 357 PELMTGYYSGGSDDEISEDEVAAKQASNEPKRKNRRGQRARQKIWEKKYGHNAKHVQRQV 416
           PELM GY+SGGSDDEI +D +A +Q SNEPKRKNRRGQRARQKIWEKKYG NAKHVQRQ 
Sbjct: 339 PELMAGYFSGGSDDEIEDDRIAKEQLSNEPKRKNRRGQRARQKIWEKKYGKNAKHVQRQH 398

Query: 417 EAEKSERERKKQEYEARVAKRAA---RAQDREATTRKRPSDPKTWEAPAKDAPIHPSWEA 473
           E +K ERE+++ EYE RVAKRAA   R  +      +R  + K  +   ++ PIHPSW+A
Sbjct: 399 EKDKEEREKRQVEYEERVAKRAANSVRLAEEAREKAQRLEERKRQQEEKRNDPIHPSWQA 458

Query: 474 KKMAEEKQKGAKF 486
           KK AEE+ K  KF
Sbjct: 459 KKQAEERLKNVKF 471

>ABR052W [643] [Homologous to ScYMR014W (BUD22) - SH]
           complement(490427..491956) [1530 bp, 509 aa]
          Length = 509

 Score =  325 bits (834), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 205/517 (39%), Positives = 297/517 (57%), Gaps = 47/517 (9%)

Query: 1   MP--KENLIFKLDNLEYQYHHLNNSLDGFQPRLSGTAKTFNAKGKKASKRIQKLLYESNL 58
           MP  K NL++KLD+ EYQYH LNN++  F PRL  TAK +N +GKKA++R++KLL     
Sbjct: 1   MPLNKPNLVYKLDHAEYQYHLLNNTVAEFHPRLGATAKYYNPQGKKAAQRVEKLLAGLTA 60

Query: 59  TEVSRALDSLRREIVEKKAYHLENKLASLLEKNLQQQYSSLLKN--SNEKNKDRLKTLAT 116
             + + + SL+ E+++ K +H+E+KL+ LL K L+ Q + L KN   +E+   +L+ L  
Sbjct: 61  DGLLQQISSLKAELLDHKVHHVESKLSHLLVKQLENQATVLRKNPKKDEQRNSKLQVLEG 120

Query: 117 LEKSYTIPGFSKLIAKYRTCKLLVPKLLFTKALREDPPQWLKDNEYVTIFNDKNNTHNPG 176
           +++      F +LI + +  K+++ K+  TKAL+ DPP W +++  +  F +K +  NPG
Sbjct: 121 VQRGPGFEQFVRLIVRSKVVKIVLGKICPTKALKNDPPAWFQNHRILQQFGNKEDECNPG 180

Query: 177 KVWNEVIVATEGCERLLSLTMNDKKIKELLSGFDSAMDLFMNKKKEREASQNNTNEQSKP 236
           +VW EV+ A  G E+L+S  ++ K  ++LL+  ++++DL +  KKER   + N++   K 
Sbjct: 181 RVWKEVVQAVAGGEQLVSQLLSTKAARDLLAALEASVDLVLGTKKER---RQNSDAAEKT 237

Query: 237 SRAVPETDERSSEDE--------------NGDNDFXXXXXXXXXXXXXXLIDEDEILKQY 282
           + A      RS+E E               G                   +DED ++ QY
Sbjct: 238 AVAA-----RSAEGEDDSSSSDNAASDIDEGAASESEEENSDDEAARSPSVDEDALVSQY 292

Query: 283 EGMLVASDEEGEDLTMPSLNPDINYNEVT----XXXXXXXXXXXXXXLSDGEEDVPPLKK 338
            GML ASDEE +D     L+P+++YNEVT                   SD +   PPLKK
Sbjct: 293 AGMLAASDEEDDDPDGYHLDPNVDYNEVTDEEPDQSADETIQPDADDSSDSDSSAPPLKK 352

Query: 339 QKRSQEREDDQSKVKTNLPELMTGYYSGGSDDEISEDEVAAKQASNE-PKRKNRRGQRAR 397
           QK         SK K  LP LM GYYSG  D +  E ++A K    E PKRKNRRGQRAR
Sbjct: 353 QK--------TSKTKVQLPALMAGYYSGDDDSDAEEHDLAGKAEPLEPPKRKNRRGQRAR 404

Query: 398 QKIWEKKYGHNAKHVQRQVEAEKSERERKKQEYEARVAKRAAR----AQDREA--TTRKR 451
           QKIWEKKYG NAKH+Q+Q E E+ ER RK++EYE R AKR A+    A+ R A   +  R
Sbjct: 405 QKIWEKKYGRNAKHIQQQFEKEREERARKQREYEERAAKRPAKEAELARTRPAFKDSAIR 464

Query: 452 PSDPKTWEAPAKDAP--IHPSWEAKKMAEEKQKGAKF 486
            ++P   ++ AK     +HPSWEAKK+++EKQK AKF
Sbjct: 465 AAEPGAAKSAAKPVAQELHPSWEAKKLSQEKQKAAKF 501

>Scas_709.54
          Length = 470

 Score =  323 bits (827), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 213/501 (42%), Positives = 296/501 (59%), Gaps = 54/501 (10%)

Query: 1   MPKENLIFKLDNLEYQYHHLNNSLDGFQPRLSGTAKTFNAKGKKASKRIQKLLYESNLTE 60
           MPK+NL+FKLDNLEYQ H+LNN+LD F+PRL+ T K +NAKG+K  K+++KLL E  + +
Sbjct: 1   MPKDNLLFKLDNLEYQQHYLNNTLDSFEPRLNQTRKFYNAKGRKTIKKVEKLLNEIKIED 60

Query: 61  VSRALDSLRREIVEKKAYHLENKLASLLEKNLQQQYSSLLKNSNEKNKDRLKTLATLEKS 120
           V R L+ ++ EI +KK +H EN L   L K L+ + S L+KN ++       TL  ++  
Sbjct: 61  VERQLNEIKLEIFDKKIHHFENNLTKNLIKLLENENSKLIKNFDK------TTLEAIKNQ 114

Query: 121 YTIPGFSKLIAKYRTCKLLVPKLLFTKALREDPPQWLKDNEYVTIFNDKNNTHNPGKVWN 180
           Y IP F+KL+   ++ KL   K++      ED PQW   + Y  I+ DKNN  NP ++WN
Sbjct: 115 YGIPQFAKLLCLSKSIKLTTGKIVPKSKKIEDTPQWFVKHNYWEIYQDKNNEFNPSRIWN 174

Query: 181 EVIVATEGCERLLSLTMNDKKIKELLSGFDSAMDLFM--NKKKEREASQNNTNEQSKPSR 238
           EVI+  +  + L+SL MNDKK+K+++  F++ MD+F+  NK K+ +  +N  N+ S  + 
Sbjct: 175 EVIMKIKKSDALVSLIMNDKKVKDIIQSFENGMDVFLGINKGKKLQREKNGLNKASSSNN 234

Query: 239 AVPETDERSSEDENGDNDFXXXXXXXXXXXXXXLIDEDEILKQYEGMLVAS-DEEGEDLT 297
            V   ++ +SED   D                  IDEDEIL QYEGML AS DEEGE+ +
Sbjct: 235 EVEMQEDDASED---DELTERPALRRETRDEDQEIDEDEILNQYEGMLAASDDEEGEEAS 291

Query: 298 MPSLNPDINYNEVTXXXXXXXXXXXXXXLSDGEEDVPPLKKQKRSQEREDDQSKVKTNLP 357
              L+  INYNEVT                         +         ++ S+ K  LP
Sbjct: 292 --GLDKTINYNEVTDE-----------------------EPSDDEDSESEEPSRKKPKLP 326

Query: 358 ELMTGYYSGG--SDDEISEDEVAAKQASNEPKRKNRRGQRARQKIWEKKYGHNAKHVQRQ 415
           ELM GYYSGG  SDDE  ED++A +Q SN+P+RKNRRGQRAR+KIWEKKYG  AKHVQR+
Sbjct: 327 ELMGGYYSGGESSDDE-KEDKIAREQMSNKPQRKNRRGQRARRKIWEKKYGSQAKHVQRE 385

Query: 416 VEAEKSERERKKQEYEARVA---------KRAARAQDREATTRKRPSD-PKTWEAPAKDA 465
           VE E  ER++++  YE R A         ++  R  + E  +++  S  PK  E  A+  
Sbjct: 386 VEKEFEERKQRQIAYEERAAKRAAKEEAFQKMVREHELERESKQGQSKWPKVKEPQAE-- 443

Query: 466 PIHPSWEAKKMAEEKQKGAKF 486
             HPSW AK++AEEK+K AKF
Sbjct: 444 --HPSWVAKRVAEEKEKNAKF 462

>KLLA0D11220g 958249..959682 weakly similar to sp|Q04347
           Saccharomyces cerevisiae YMR014w singleton, start by
           similarity
          Length = 477

 Score =  261 bits (668), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 185/517 (35%), Positives = 268/517 (51%), Gaps = 79/517 (15%)

Query: 1   MPKENLIFKLDNLEYQYHHLNNSLDGFQPRLSGTAKTFNAKGKKASKRIQKLLYESNLTE 60
           M K+NLIFKLDNLEYQ H++NN  + FQPR   T + FN+K +K +K++ KLL  ++  +
Sbjct: 1   MGKDNLIFKLDNLEYQIHYMNNEAEQFQPRFKQTLQFFNSKSRKTNKKVTKLLEAADKQK 60

Query: 61  VSRALDSLRREIVEKKAYHLENKLASLLEKNLQQQYSSLLKNSNEKNKDRLKTLATLEKS 120
           ++  + SLR +I+++K +H+           LQ+  +  +KN           L   E  
Sbjct: 61  INGEISSLRLKILDQKIHHV-----------LQRLQTHWIKNP----------LILREPE 99

Query: 121 YTIPGFSKLIAKYRTCKLLVPKLLFTKALREDPPQWLKDNEYVTIFNDKNNTHNPGKVWN 180
               G  + I KY +   LV   +      +  P+W +++E+  I NDK N  NP +++N
Sbjct: 100 VAKIGAEQFI-KYMSYSKLVKLTMSLMGGNKTCPEWFREHEFYQISNDKTNELNPSRIYN 158

Query: 181 EVIVATEGCERLLSLTMNDKKIKELLSGFDSAMDLFMNKKKEREASQNNTNEQSKPSRAV 240
            V  +      L+S  +N+K +K+L+  +++ + + +N+K +    ++ T   +K S+  
Sbjct: 159 GVF-SKNKLNSLVSKLLNNKNVKDLIQTYENGIHVILNEKDK--IQKDTTTASTKQSKT- 214

Query: 241 PETDERSSEDENGDNDFXXXXXXXXXXXXXXLIDE-------------DEIL-KQYEGML 286
               E +S D+N D                 L++E             +E+L KQY+G+L
Sbjct: 215 --KSEDTSTDKNIDGVSKTEKGATESESESDLLEENSEREAPELDSETEELLSKQYDGLL 272

Query: 287 VASDEEGEDLTMPSLNPDINYNEVTXXXXXXXXXXXXXXLSDGEEDVPPLKKQKRSQERE 346
           V SDEE E      L+P I+YN+VT                  EED       +  +E  
Sbjct: 273 VGSDEESEPEFQ--LDPTIDYNQVT-----------------DEEDKEEYSADEDDEENS 313

Query: 347 DDQS------KVKTNLPELMTGYYSGGSDDEISEDEVAAKQASNEPKRKNRRGQRARQKI 400
           D  S      K K NLPELM GY SG  ++++ +D+VA KQ +  P +KNRRGQRARQKI
Sbjct: 314 DSDSGEPSNKKPKYNLPELMNGYISGDEEEDL-DDKVARKQIAAVPVKKNRRGQRARQKI 372

Query: 401 WEKKYGHNAKHVQRQVEAEKSERERKKQEYEARVAKRAARAQDREATTRKRPSD------ 454
           WEKKYG  AKHVQRQ+E E  ERE ++QEYE R AKR A+A       RKR S       
Sbjct: 373 WEKKYGSQAKHVQRQLEKEHKERETRQQEYEQRQAKREAKAAQLAEQQRKRVSQYNSQSS 432

Query: 455 -----PKTWEAPAKDAPIHPSWEAKKMAEEKQKGAKF 486
                P        D PIHPSWEAK++AEEKQK  KF
Sbjct: 433 TSNIPPPPQPVITADKPIHPSWEAKRIAEEKQKNVKF 469

>YMR014W (BUD22) [3978] chr13 (298867..300426) Protein with possible
           role in bud site polarity, has possible coiled-coil
           domain [1560 bp, 519 aa]
          Length = 519

 Score =  238 bits (608), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 193/530 (36%), Positives = 272/530 (51%), Gaps = 63/530 (11%)

Query: 1   MPKENL--IFKLDNLEYQYHHLNNSLDGFQPRLSGTAKTFNAKGKKASKRIQKLLYESNL 58
           MP E+   I+KLD LEYQYH+L  SL  F+PR   TAK +N  GKK  K+I+KLL    L
Sbjct: 1   MPSESSVSIYKLDQLEYQYHYLTKSLQKFEPRYPKTAKLYNCIGKKNKKKIEKLLNSLEL 60

Query: 59  TEVSRALDSLRREIVEKKAYHLENKLASLLEKNLQQ---QYSSLLKNSNEKNK----DRL 111
             + + LD    +++  K ++ E  L+  +++ +Q+   + SS +K++ +KNK    D  
Sbjct: 61  KTLDKELDESYSKLLNNKIHYYETHLSKCIKEQIQKISKKNSSKVKDA-QKNKSPSIDIE 119

Query: 112 KTLATLEKSYTIPGFSKLIAKYRTCKLLVPKL-LFTKALREDP--PQWLKDNEYVTIFND 168
           K LAT     ++   +  + ++R  K+L  ++   +K +  D     WL +N+Y    ND
Sbjct: 120 KMLAT---QLSLDDLALFMTRFRLIKILHQRIKQKSKKIEGDTNNKTWLNNNDYSGYIND 176

Query: 169 KNNTHNPGKVWNEVIVATEGCERLLSLTMNDKKIKELLSGFDSAMDLFMN------KKKE 222
           K +  NP  +WNEVI     CE+L +L    K ++ L   FD ++ L         K K+
Sbjct: 177 KTSKWNPSNIWNEVITKLPSCEKLNALIGQSKIVQNLTESFDLSICLIFGFDVSAMKAKK 236

Query: 223 REASQNNTNEQSKPSRAVPETDERSSEDENGDNDFXXXXXXXXXXXXXXLIDEDEILKQY 282
             A +   N     S    +TD+  +E    D+                  +ED ++K+Y
Sbjct: 237 YGAREKTANANQTHSNIDYDTDD-GNEKNAIDSKSNAIGAQTQSNKETTSDNEDLLIKEY 295

Query: 283 EGMLVASDEEGEDLTMPSLNPDINYNEVTX---XXXXXXXXXXXXXLSDGEEDVPPLKKQ 339
           EGML +S +EGE      LNP+INYNEVT                  SD EE+ P  KK 
Sbjct: 296 EGMLGSSGDEGEGGGY--LNPNINYNEVTDEEPSEASSDEDDSDERFSDSEENEPRRKKP 353

Query: 340 KRSQEREDDQSKVKTNLPELMTGYYSGGSDDE-----------------ISEDEVAAKQA 382
           K              NLPELM GYYSG   +E                  +ED  A +Q 
Sbjct: 354 KLH------------NLPELMAGYYSGNDTEEESDEDNKNVKGKKKKRDTAEDRTAREQM 401

Query: 383 SNEPKRKNRRGQRARQKIWEKKYGHNAKHVQRQVEAEKSERERKKQEYEARVAKRAARAQ 442
           SNEPKRKNRRGQRAR+KIWEKKYG  AKHVQR++E E  +R++++ EYEARVAKR A+A 
Sbjct: 402 SNEPKRKNRRGQRARRKIWEKKYGSQAKHVQRELEKEMEDRKQRQIEYEARVAKREAKAA 461

Query: 443 DREA------TTRKRPSDPKTWEAPAKDAPIHPSWEAKKMAEEKQKGAKF 486
             EA        R+  ++ K  +  A     HPSW AK++AEEK + AKF
Sbjct: 462 SLEASRSREREDRRTETNNKKEKESASTGEEHPSWIAKRLAEEKLQKAKF 511

>CAGL0M07678g complement(767857..769278) similar to sp|Q04347
           Saccharomyces cerevisiae YMR014w, hypothetical start
          Length = 473

 Score =  131 bits (330), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 91/131 (69%), Gaps = 3/131 (2%)

Query: 359 LMTGYYSGGSDDEISEDEVAAKQASNEPKRKNRRGQRARQKIWEKKYGHNAKHVQRQVEA 418
           LM GY SGGSD+EI  D++A +Q   +P++KNRRGQRAR+KIWE+KYG  AKHVQR++E 
Sbjct: 335 LMVGYVSGGSDEEIEVDDIAKEQIEIKPQKKNRRGQRARRKIWEQKYGSKAKHVQREIEK 394

Query: 419 EKSERERKKQEYEARVAKRAARAQDREATTRKRPSDPKTWEAPAK---DAPIHPSWEAKK 475
           E  ++ +++ EYE RVAKRAARA+  E    K+    +  E   K       HPSW AKK
Sbjct: 395 EMEKKRKRQAEYEERVAKRAARAEQNEEYQAKKAEIKREKEEHRKKLEKIEDHPSWVAKK 454

Query: 476 MAEEKQKGAKF 486
           MAE+K+K AKF
Sbjct: 455 MAEDKEKNAKF 465

>Sklu_1673.2 YDL018C, Contig c1673 1962-2657 reverse complement
          Length = 231

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 45/96 (46%), Gaps = 4/96 (4%)

Query: 341 RSQEREDDQSKVKTNLPELMTGYYSGGSDDEISEDEVAAKQASNEPKRKNRRGQRARQKI 400
           RS+ER+ + S V  +  E    +Y G + D+I + E+  K    E +R  RR Q+  Q+ 
Sbjct: 88  RSRERQGEWSFVAVHKGEYSLCFYGGKAYDKIVDVELNHK-CPTEDQRDARRQQKKAQRQ 146

Query: 401 WEKKYGHNAKHVQRQV---EAEKSERERKKQEYEAR 433
            +    H  + +   V   E + S  ER  Q Y+ R
Sbjct: 147 ADSAQDHLHRSLSDSVDMIERQLSVLERNMQYYKTR 182

>YJR141W (YJR141W) [3033] chr10 (695821..696864) Protein of unknown
           function, has low similarity to uncharacterized C.
           albicans Orf6.6830p [1044 bp, 347 aa]
          Length = 347

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 13/81 (16%)

Query: 42  GKKASKRIQKLLYESNLTEVSRALDSLRREIVEKKAYHLENKLASLLEKNLQQQYSSLLK 101
           G K+ KR  KLLY +++T ++R L+   R++VE+  +          E +    YS+ L+
Sbjct: 277 GNKSFKRAMKLLYTNSVTTINRCLN---RQVVEELDFQ---------ETSFNAFYSA-LQ 323

Query: 102 NSNEKNKDRLKTLATLEKSYT 122
           ++N      +K +     SYT
Sbjct: 324 HTNALLPSSMKKIGEWTISYT 344

>CAGL0F07293g complement(710050..712224) highly similar to sp|P53134
           Saccharomyces cerevisiae YGL114w, start by similarity
          Length = 724

 Score = 30.0 bits (66), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 31/63 (49%)

Query: 81  ENKLASLLEKNLQQQYSSLLKNSNEKNKDRLKTLATLEKSYTIPGFSKLIAKYRTCKLLV 140
           EN L+ L+    Q+QY+S   +  + N   LK +  L +++TI     +IA +      +
Sbjct: 221 ENALSPLINAEAQRQYNSTSPSDIQPNNVYLKNITILVQTFTISSIYTVIAYFVPVIKAI 280

Query: 141 PKL 143
           P L
Sbjct: 281 PFL 283

>KLLA0D09955g 839640..841814 similar to sp|P38920 Saccharomyces
           cerevisiae YMR167w MLH1 DNA mismatch repair protein,
           start by similarity
          Length = 724

 Score = 29.6 bits (65), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 9/75 (12%)

Query: 57  NLTEVSRALDSLRREIVEKKAYHLENKLASLLEKNLQQQYSSLLKNSNEK--NKDRLKTL 114
           N+T++   +D+LR E +++    +  KL S+  K +  +Y S+   +N+   NK R+K++
Sbjct: 557 NITKILENIDTLRIETIQE----IIEKLTSM--KEMMNEYFSIEIETNDGGWNKARIKSI 610

Query: 115 ATLEKSYTIPGFSKL 129
             L K Y  P  SKL
Sbjct: 611 PLLLKDYN-PPLSKL 624

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score = 29.6 bits (65), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 21/37 (56%)

Query: 364 YSGGSDDEISEDEVAAKQASNEPKRKNRRGQRARQKI 400
           Y+ G+    SED ++  +A NEP + + +G    QKI
Sbjct: 57  YAMGTTGVASEDVISRMKAMNEPAKTSTQGNNVNQKI 93

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.308    0.126    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,723,675
Number of extensions: 758343
Number of successful extensions: 5339
Number of sequences better than 10.0: 311
Number of HSP's gapped: 4957
Number of HSP's successfully gapped: 383
Length of query: 486
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 380
Effective length of database: 12,926,601
Effective search space: 4912108380
Effective search space used: 4912108380
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 63 (28.9 bits)