Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.816450049322570.0
Sklu_2168.250049212681e-171
Scas_709.555194769031e-116
ABR051C4844017551e-94
KLLA0D11198g5154967293e-90
YMR013C (SEC59)5194036883e-84
CAGL0M07700g4873386472e-78
YJR066W (TOR1)247055730.97
Sklu_2105.3948103701.8
Sklu_2089.228676664.0
KLLA0E04653g106053649.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.8164
         (493 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.8164                                                          874   0.0  
Sklu_2168.2 YMR013C, Contig c2168 1038-2540 reverse complement        493   e-171
Scas_709.55                                                           352   e-116
ABR051C [642] [Homologous to ScYMR013C (SEC59) - SH] (487498..48...   295   1e-94
KLLA0D11198g complement(954239..955786) some similarities with s...   285   3e-90
YMR013C (SEC59) [3977] chr13 complement(295178..296737) Dolichol...   269   3e-84
CAGL0M07700g <772282..773746 similar to sp|P20048 Saccharomyces ...   253   2e-78
YJR066W (TOR1) [2960] chr10 (559330..566742) Protein kinase invo...    33   0.97 
Sklu_2105.3 YEL061C, Contig c2105 5732-8578 reverse complement         32   1.8  
Sklu_2089.2 YEL009C, Contig c2089 2909-3769                            30   4.0  
KLLA0E04653g complement(418094..421276) similar to sp|P53273 Sac...    29   9.4  

>Kwal_26.8164
          Length = 500

 Score =  874 bits (2257), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/493 (89%), Positives = 440/493 (89%)

Query: 1   MSKQDAEERQAIAKENEEFSIFDQLMGPEKMAQLLLLGGTVHLAVLKLMVTEKDSALFQX 60
           MSKQDAEERQAIAKENEEFSIFDQLMGPEKMAQLLLLGGTVHLAVLKLMVTEKDSALFQ 
Sbjct: 1   MSKQDAEERQAIAKENEEFSIFDQLMGPEKMAQLLLLGGTVHLAVLKLMVTEKDSALFQA 60

Query: 61  XXXXXXXXXXXXXXSYRTKIANNGEWGTDLQRISGFVPDFNVXXXXXXXXXXXXXFARDL 120
                         SYRTKIANNGEWGTDLQRISGFVPDFNV             FARDL
Sbjct: 61  ALAAAVAVVVGLGVSYRTKIANNGEWGTDLQRISGFVPDFNVLYLLYIPSLLSLLFARDL 120

Query: 121 TVVNMALAFNCTDHPLILRLPLQAIFVLMNNDFGDKRSKNLKAIGINCLIEFLIERIGQL 180
           TVVNMALAFNCTDHPLILRLPLQAIFVLMNNDFGDKRSKNLKAIGINCLIEFLIERIGQL
Sbjct: 121 TVVNMALAFNCTDHPLILRLPLQAIFVLMNNDFGDKRSKNLKAIGINCLIEFLIERIGQL 180

Query: 181 KSFDRVESNLFSICLTNVLYLLESSSLHFQVLRHVLLGFLAAVAFNFPLLIITSRFNPYL 240
           KSFDRVESNLFSICLTNVLYLLESSSLHFQVLRHVLLGFLAAVAFNFPLLIITSRFNPYL
Sbjct: 181 KSFDRVESNLFSICLTNVLYLLESSSLHFQVLRHVLLGFLAAVAFNFPLLIITSRFNPYL 240

Query: 241 RSAILSTSFFVVFPLTILYTFEVEGQNPAIWLFDYITSNDIRVRIIAGWLSCLVILVPNI 300
           RSAILSTSFFVVFPLTILYTFEVEGQNPAIWLFDYITSNDIRVRIIAGWLSCLVILVPNI
Sbjct: 241 RSAILSTSFFVVFPLTILYTFEVEGQNPAIWLFDYITSNDIRVRIIAGWLSCLVILVPNI 300

Query: 301 MIFKSNFSLNTSRKIWHFLILALIAVPFRYDPDFVKISLAGTIVLFLAVEYLRFLKLAPY 360
           MIFKSNFSLNTSRKIWHFLILALIAVPFRYDPDFVKISLAGTIVLFLAVEYLRFLKLAPY
Sbjct: 301 MIFKSNFSLNTSRKIWHFLILALIAVPFRYDPDFVKISLAGTIVLFLAVEYLRFLKLAPY 360

Query: 361 GELLDSKLRSFADFRDERGPXXXXXXXXXXGVATPILINXXXXXXXXXXXXXXXASIVGY 420
           GELLDSKLRSFADFRDERGP          GVATPILIN               ASIVGY
Sbjct: 361 GELLDSKLRSFADFRDERGPIIISYIYLIIGVATPILINGSLVGVISLGVGDSLASIVGY 420

Query: 421 RWGRHQWPGTSKTLEGTFAFILSTSICSLCFKLFLGAFQEITSAQVILACILSGILEGNS 480
           RWGRHQWPGTSKTLEGTFAFILSTSICSLCFKLFLGAFQEITSAQVILACILSGILEGNS
Sbjct: 421 RWGRHQWPGTSKTLEGTFAFILSTSICSLCFKLFLGAFQEITSAQVILACILSGILEGNS 480

Query: 481 VLNDNILIPAYMF 493
           VLNDNILIPAYMF
Sbjct: 481 VLNDNILIPAYMF 493

>Sklu_2168.2 YMR013C, Contig c2168 1038-2540 reverse complement
          Length = 500

 Score =  493 bits (1268), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 253/492 (51%), Positives = 333/492 (67%)

Query: 1   MSKQDAEERQAIAKENEEFSIFDQLMGPEKMAQLLLLGGTVHLAVLKLMVTEKDSALFQX 60
           MSKQ  EER AI +EN+++S  D     E++AQL++LG T+HL V K M  E DS LFQ 
Sbjct: 1   MSKQSEEERNAILEENKDYSFADGFFATERIAQLVILGVTIHLCVDKYMNDENDSLLFQS 60

Query: 61  XXXXXXXXXXXXXXSYRTKIANNGEWGTDLQRISGFVPDFNVXXXXXXXXXXXXXFARDL 120
                         +YRT++ NNG WG ++ R+S F+PDFNV             FAR L
Sbjct: 61  ALTSAVAFVVGSLVNYRTRMVNNGAWGDNVHRLSEFLPDFNVIYLLYLPFMLSLLFARRL 120

Query: 121 TVVNMALAFNCTDHPLILRLPLQAIFVLMNNDFGDKRSKNLKAIGINCLIEFLIERIGQL 180
            +VN A+AFN TD P+ L+LPLQ +FVL+N ++   RS N+KAI IN  + +++E+I  L
Sbjct: 121 VLVNSAMAFNSTDIPVHLKLPLQLVFVLINEEYYTDRSTNMKAIAINVALCYVLEKISDL 180

Query: 181 KSFDRVESNLFSICLTNVLYLLESSSLHFQVLRHVLLGFLAAVAFNFPLLIITSRFNPYL 240
           KS D V+ NLFSI LTNVLYL++S ++HFQ+L+ VL GF+ AV+ N+ L       + YL
Sbjct: 181 KSLDHVDCNLFSILLTNVLYLIDSPTVHFQILQKVLYGFIVAVSVNYALSFPLRYASTYL 240

Query: 241 RSAILSTSFFVVFPLTILYTFEVEGQNPAIWLFDYITSNDIRVRIIAGWLSCLVILVPNI 300
           RS IL +SF ++FPLT+     ++ + P  WL++YI S+D R++II  WL CL++L+PN+
Sbjct: 241 RSLILFSSFSLIFPLTVTRILTIDRKKPLTWLYEYIFSSDTRIKIIFIWLLCLLVLIPNV 300

Query: 301 MIFKSNFSLNTSRKIWHFLILALIAVPFRYDPDFVKISLAGTIVLFLAVEYLRFLKLAPY 360
           MIFKSNFSLNTSRKIWHFLIL L+  P + DP+FVK+SL+GT+VLFL VEYLR+LKL P 
Sbjct: 301 MIFKSNFSLNTSRKIWHFLILFLLIPPLQLDPEFVKVSLSGTVVLFLVVEYLRYLKLEPV 360

Query: 361 GELLDSKLRSFADFRDERGPXXXXXXXXXXGVATPILINXXXXXXXXXXXXXXXASIVGY 420
           G+ LD KLRSF+DFRD+RGP          GV+ PILIN               ASIVG 
Sbjct: 361 GKFLDEKLRSFSDFRDDRGPIIISYIYLIIGVSAPILINGSLVGVISLGVGDSLASIVGG 420

Query: 421 RWGRHQWPGTSKTLEGTFAFILSTSICSLCFKLFLGAFQEITSAQVILACILSGILEGNS 480
           +WGR +WPGT+KT+EGT  FIL+TS  SL  +    +F  I++  V+L CI+SGILEGNS
Sbjct: 421 KWGRIKWPGTNKTVEGTLVFILATSAVSLFCQHRYNSFSPISNGNVVLTCIVSGILEGNS 480

Query: 481 VLNDNILIPAYM 492
           VLNDNILIP +M
Sbjct: 481 VLNDNILIPPFM 492

>Scas_709.55
          Length = 519

 Score =  352 bits (903), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 201/476 (42%), Positives = 283/476 (59%), Gaps = 28/476 (5%)

Query: 28  PEKMAQLLLLGGTVHLAVLKL-MVTEKDSALFQXXXXXXXXXXXXXXXSYRTKIANNGEW 86
           PEK+ Q+ +L  +V L   +   V + D ++F+               S+  +  N+ + 
Sbjct: 52  PEKLIQIFILASSVFLCYKQYGAVDDDDFSIFKNEARVAGMLL-----SFLLRKCNDRDA 106

Query: 87  GTDLQRISGFVPDFNVXXXXXXXXXXXXXFARDLTVVNMALAFNCTDHPLILRLPLQAIF 146
            T        +P F +             F ++LT+ N  LA N  D PL  ++P+QA+F
Sbjct: 107 NT--------LPQFEIVYLLFLPFMTSFLFKKELTIFNSILALNALDIPLYEKIPMQALF 158

Query: 147 VLMNNDFGDKRSKNLKAIGINCLIEFLI----ERIGQLKSFDRVESNLFSICLTNVLYLL 202
           +     F  +    L   G   L+ F I     +IGQLKS D ++ NLFSI LTNVLY++
Sbjct: 159 I----GFSAESDAELWEYGYGMLLNFSICQTLMKIGQLKSLDVIDCNLFSIVLTNVLYMI 214

Query: 203 --ESSSLHFQVLRHVLLGFLAAVAFNFPL--LIITSRFNPYLRSAILSTSFFVVFPLTIL 258
             E  SL FQ+LR  L+ F   VA N+ +  L+   + NP+++S  L + F +VFP+ + 
Sbjct: 215 DPELPSLSFQILRGSLIAFFVTVAINYIISSLLTKMKKNPHIKSLSLFSIFVIVFPILMD 274

Query: 259 YTFEVEG--QNPAIWLFDYITSNDIRVRIIAGWLSCLVILVPNIMIFKSNFSLNTSRKIW 316
              ++E   + P++WL  Y+  +  R  I+  WLS L+IL+PN++IFKSNFSLNTSRKIW
Sbjct: 275 QLIQLESIDERPSMWLLQYVLGSSARKSILLVWLSFLLILIPNVLIFKSNFSLNTSRKIW 334

Query: 317 HFLILALIAVPFRYDPDFVKISLAGTIVLFLAVEYLRFLKLAPYGELLDSKLRSFADFRD 376
           HFLIL LI +PF+ DP FVKI+L+GTIVLFL+VEYLRFL+L P+G  +DSKLRSFADFRD
Sbjct: 335 HFLILLLITMPFQMDPLFVKIALSGTIVLFLSVEYLRFLQLEPFGAYIDSKLRSFADFRD 394

Query: 377 ERGPXXXXXXXXXXGVATPILINXXXXXXXXXXXXXXXASIVGYRWGRHQWPGTSKTLEG 436
           ++GP          G++TP+LIN               ASI+G +WGR+ WPGT KT+EG
Sbjct: 395 DKGPIIISYIYLIIGISTPLLINDSPVGLISLGVGDSLASIIGGKWGRYHWPGTRKTIEG 454

Query: 437 TFAFILSTSICSLCFKLFLGAFQEITSAQVILACILSGILEGNSVLNDNILIPAYM 492
           T +FI+ TSI +   K ++  F +IT + ++  C +SGILEGNS LNDNILIP YM
Sbjct: 455 TLSFIIGTSIVAYILKYYMEYFADITFSNLLWVCTISGILEGNSELNDNILIPTYM 510

>ABR051C [642] [Homologous to ScYMR013C (SEC59) - SH]
           (487498..488952) [1455 bp, 484 aa]
          Length = 484

 Score =  295 bits (755), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 163/401 (40%), Positives = 241/401 (60%), Gaps = 7/401 (1%)

Query: 97  VPDFNVXXXXXXXXXXXXXFARDLTVVNMALAFNCTDHPLILRLPLQAIFVLMNNDFGDK 156
           VP FN              F R+L  VN A+A      P++LR+ LQ + +L        
Sbjct: 76  VPAFNAVYVVYLPVMVSLLFRRELVPVNCAMALGGMQMPVVLRV-LQQLTILYLQPAARG 134

Query: 157 RSKNLKAIGINCLIEFLIERIG--QLKSFDRVESNLFSICLTNVLYLLES-SSLHFQVLR 213
           R    +          +    G  +L+S D V+  L SI LTNVL+++   SS+ FQ+LR
Sbjct: 135 RGFPGRGGVGGAPGGVVGRWRGWSELRSLDMVDCGLLSILLTNVLFVIGGESSVQFQILR 194

Query: 214 HVLLGFLAAVAFNFPLLIITSRFNPYLRSAILSTSFFVVFPLTILYTFEVEG-QNPAIWL 272
             L GFL AV  N+  +    R N Y+R+A+L   F +VFP  IL   +++   N  +WL
Sbjct: 195 ACLYGFLVAVGANYVFVRAYGRRNQYVRTAVLLAVFALVFPSVILAFLDLDDTDNALVWL 254

Query: 273 FDYITSNDIRVRIIAGWLSCLVILVPNIMIFKSNFSLNTSRKIWHFLILALIAVPFRYDP 332
             YI S+ +R++I+AGWL  L +L+P++ + KS+ SLNTSRKIWHF +L L+      +P
Sbjct: 255 IKYIFSSALRMQIMAGWLVFLGVLIPSVFVMKSHLSLNTSRKIWHFALLPLLVCQMAVEP 314

Query: 333 DFVKISLAGTIVLFLAVEYLRFLKLAPYGELLDSKLRSFADFRDERGPXXXXXXXXXXGV 392
           +F  +++AGT+V+FL VEY R++ L P+G+ ++++LR+F DFRDE+GP          GV
Sbjct: 315 EFTTVAIAGTVVVFLIVEYFRYMNLYPFGDYINAQLRTFTDFRDEQGPIIVSYLYLILGV 374

Query: 393 ATPILINXXXXXXXXXXXXXXXASIVGYRWGRHQWPGTSKTLEGTFAFIL-STSICSLCF 451
           + P+LIN               ASI+G R+G++ WPGT+KT+EGT AFI+ S ++C +C 
Sbjct: 375 SFPLLINRSLVGVISLGVGDSLASIIGRRYGKYHWPGTNKTVEGTLAFIVASAALCLVCQ 434

Query: 452 KLFLGAFQEITSAQVILACILSGILEGNSVLNDNILIPAYM 492
           + FL AF+ + +  +ILAC++SGILEGNS LNDNILIP++M
Sbjct: 435 QAFL-AFEGVATRNIILACVVSGILEGNSDLNDNILIPSFM 474

>KLLA0D11198g complement(954239..955786) some similarities with
           sp|P20048 Saccharomyces cerevisiae YMR013c SEC59
           dolichol kinase singleton, hypothetical start
          Length = 515

 Score =  285 bits (729), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 170/496 (34%), Positives = 263/496 (53%), Gaps = 19/496 (3%)

Query: 2   SKQDAEERQAIAKENEEFSIFDQLMGPEKMAQLLLLGGTVHLAVLKLMVTEKDSALFQXX 61
           S  ++  +  +++++    + D++   +++ QL +LG + HL   K       S  F   
Sbjct: 25  SNVNSGSKGNLSRDSIISEVLDKVFEADRVIQLTILGLSSHLVYAKYGSEPWFSQQFSMV 84

Query: 62  XXXXXXXXXXXXXS-YRTKIANNGEWGTDLQRISGFVPDFNVXXXXXXXXXXXXXFARDL 120
                        S  RT +  N             +P FN              F    
Sbjct: 85  TSVLMAYVVNLWMSATRTNLGVNT------------LPTFNTIYLFYMQLLLSTLFVPQY 132

Query: 121 TVVNMALAFNCTDHPLILRLPLQAIFVLMNNDFGDKRSKNLKAIGINCLIEFLIERIGQL 180
            ++N  LAF+ +D  +  ++PLQ IF+LM +D     + ++KA+ +N    F + +  +L
Sbjct: 133 LLLNTVLAFSISDISVFFKIPLQIIFLLMGDDGSANIANDVKALVLNYFFIFGLYKTSKL 192

Query: 181 KSFDRVESNLFSICLTNVLYLLESSSLHFQVLRHVLLGFLAAV----AFNFPLLIITSRF 236
           KS D+ E ++F++  T++L L+ES S++FQV +     F+  V    A ++ L  + +  
Sbjct: 193 KSLDKTECHMFALLCTDILALVESDSIYFQVFQVCFTSFIVLVTVTSAVSYGLESVGA-- 250

Query: 237 NPYLRSAILSTSFFVVFPLTILYTFEVEGQNPAIWLFDYITSNDIRVRIIAGWLSCLVIL 296
             ++R+ +L     V F   I     +    P  WL DYI S+ IR++I+  WL   ++L
Sbjct: 251 TRWIRTLLLLPMIVVGFSYYIQTNLIINNVPPFTWLIDYIGSSMIRLKIMGIWLGSALLL 310

Query: 297 VPNIMIFKSNFSLNTSRKIWHFLILALIAVPFRYDPDFVKISLAGTIVLFLAVEYLRFLK 356
           +P++   KSN+SLNTSRK+WHF IL L+      D +FVKI+LAGT+ LFL VEY+RFL 
Sbjct: 311 LPSVFALKSNWSLNTSRKVWHFAILPLLIPAIMMDSNFVKIALAGTVNLFLIVEYIRFLH 370

Query: 357 LAPYGELLDSKLRSFADFRDERGPXXXXXXXXXXGVATPILINXXXXXXXXXXXXXXXAS 416
           + P G  LD  LRSFADFRDE+GP          G++ P LIN               AS
Sbjct: 371 IYPVGHYLDKHLRSFADFRDEKGPIIISYLYFIIGISLPFLINGSIIGIISLGVGDSLAS 430

Query: 417 IVGYRWGRHQWPGTSKTLEGTFAFILSTSICSLCFKLFLGAFQEITSAQVILACILSGIL 476
           I+G ++GR++WP T KT EGTFAFI +T I ++  K++   F E++   ++L C L+GIL
Sbjct: 431 IIGKKFGRNRWPNTCKTFEGTFAFIAATGITTVIMKVYFNFFTEVSFMNLVLVCFLAGIL 490

Query: 477 EGNSVLNDNILIPAYM 492
           EGNS LNDN+LIP +M
Sbjct: 491 EGNSTLNDNLLIPTFM 506

>YMR013C (SEC59) [3977] chr13 complement(295178..296737) Dolichol
           kinase, mutants accumulate incompletely glycosylated
           protein precursors in ER [1560 bp, 519 aa]
          Length = 519

 Score =  269 bits (688), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 162/403 (40%), Positives = 238/403 (59%), Gaps = 13/403 (3%)

Query: 97  VPDFNVXXXXXXXXXXXXXFARDLTVVNMALAFNCTD----HPLILRLPLQAIFVLMNND 152
           +P F+              F    TV+N  L  +  +       ++ + LQ   +  N +
Sbjct: 114 LPKFDTIYSLYLPFMVSLLFDTSSTVINTILILSVLNSYRWRTQLVVIILQLCLIFFNFE 173

Query: 153 FGDKRSKNLKAIGINCLIEFLIERIGQLKSFDRVESNLFSICLTNVLYLLESSSLHFQVL 212
            GD R KN+ +I IN L+  +++ IGQLKS D ++SNLFSI LTN+LY+ E+ ++HF++L
Sbjct: 174 AGD-RLKNIISIVINSLLSLILKYIGQLKSLDNIDSNLFSILLTNILYVSEAGTVHFRIL 232

Query: 213 RHVLLGFLAAVAFNFPLLIITSRFNPYLRSAILSTSFFVVFPLTILYTFEVE-GQNPAIW 271
           + ++L     ++ N+ L  +   F P++    LS SF +  PL       +E G+NP +W
Sbjct: 233 KGIILALTTIISINYVLKKVM-HFKPFM----LSISFAIGLPLFANTFIHLEDGENPLLW 287

Query: 272 LFDYITSNDIRVRIIAGWLSCLVILVPNIMIFKSNFSLNTSRKIWHFLILALIAVPFRYD 331
           L  YI  + IR +I+  W S L++ +P+I+I K + SLNTSRK+WHF+I  LI   F+ D
Sbjct: 288 LVKYILESTIRQKILFAWSSILILSIPSILIEKDSLSLNTSRKLWHFIIFLLIIPSFQMD 347

Query: 332 PDFVKISLAGTIVLFLAVEYLRFLKLAPYGELLDSKLRSFADFRDERGPXXXXXXXXXXG 391
            +FVKI+L+GTI +FL++EY+RF  L P G  ++ +LR FAD RD  GP          G
Sbjct: 348 SNFVKIALSGTIPVFLSIEYIRFQNLPPLGSAIELQLRRFADDRDHSGPLIISYLYLLFG 407

Query: 392 VATPILINXXXXXXXXXXXXXXXASIVGYRWGRHQWPGTSKTLEGTFAFILSTSICSLCF 451
           ++TP+L+N               ASI+G R+GR +W GT KTLEGT AFI+++ I  L  
Sbjct: 408 ISTPLLMNNSPMGLIGLGIGDSLASIIGKRYGRIRWKGTQKTLEGTLAFIVTSFIVCLVL 467

Query: 452 KLFLGA--FQEITSAQVILACILSGILEGNSVLNDNILIPAYM 492
             F  A  F  +T+ Q++  C LSG+LEGNSVLNDNILIPA+M
Sbjct: 468 LRFDKAAIFNHLTTLQLLTLCTLSGVLEGNSVLNDNILIPAFM 510

>CAGL0M07700g <772282..773746 similar to sp|P20048 Saccharomyces
           cerevisiae YMR013c dolichol kinase, start by similarity
          Length = 487

 Score =  253 bits (647), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 140/338 (41%), Positives = 205/338 (60%), Gaps = 14/338 (4%)

Query: 165 GINCLI-EFLI----ERIGQLKSFDRVESNLFSICLTNVLYLLESSSLHFQ-VLRHVLLG 218
           G+ CL+  +L+    E IGQLK+ D+++ NLF I LT+ L +  +++ ++  VL+  +  
Sbjct: 144 GVKCLVANYLLVNWLEDIGQLKTLDQIDCNLFGILLTDCLMINNATAPNYLLVLKGAMTS 203

Query: 219 FLAAVAFNFPLLIITSRFNPYLRSAI-LSTSFFVVFPLTILYTFEVEGQ---NPAIWLFD 274
            +  +  N  L    +R  P L ++I L+ +F V+FP+ + +  +   +   +PA+WL D
Sbjct: 204 VMIIIVVNHFL----TRLIPSLSNSIVLAGNFLVLFPILVNHLIDFSNEKITSPALWLID 259

Query: 275 YITSNDIRVRIIAGWLSCLVILVPNIMIFKSNFSLNTSRKIWHFLILALIAVPFRYDPDF 334
           +I  ++IR  I+  W+  LV+ +P +++FKS  SLNTSRKIWHF+I  LI  PF  DP+F
Sbjct: 260 FILESEIRQYIMLSWVIVLVVFIPLVILFKSKISLNTSRKIWHFVIFLLIVEPFHLDPEF 319

Query: 335 VKISLAGTIVLFLAVEYLRFLKLAPYGELLDSKLRSFADFRDERGPXXXXXXXXXXGVAT 394
           VKISL G I  FL+VEYLR+LK+ PYGE LD  LRSFAD+RD+RGP          G+  
Sbjct: 320 VKISLCGIIPCFLSVEYLRYLKIEPYGEHLDFFLRSFADYRDQRGPLIVSYIYLITGITI 379

Query: 395 PILINXXXXXXXXXXXXXXXASIVGYRWGRHQWPGTSKTLEGTFAFILSTSICSLCFKLF 454
           P+L+                ASIVG + GR  W GT+KT+EGT AFI+ T+  S   + +
Sbjct: 380 PLLLFESPVGLVSLGVGDSLASIVGKKVGRMHWKGTNKTIEGTVAFIVGTTFISWILQRY 439

Query: 455 LGAFQEITSAQVILACILSGILEGNSVLNDNILIPAYM 492
              F  I   ++++ C   G+LEGNS LNDNILIP +M
Sbjct: 440 FNYFSTIDIFKILVICTTGGVLEGNSELNDNILIPLFM 477

>YJR066W (TOR1) [2960] chr10 (559330..566742) Protein kinase
           involved in regulation of cell growth and sensitivity to
           the immunosuppressant rapamycin, has a region of
           similarity to the catalytic domain of
           phosphatidylinositol kinases [7413 bp, 2470 aa]
          Length = 2470

 Score = 32.7 bits (73), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%)

Query: 275 YITSNDIRVRIIAGWLSCLVILVPNIMIFKSNFSLNTSRKIWHFLILALIAVPFR 329
           YI   D RVR +A   SC + +  NI    S  SLNT  ++   L+   IA P +
Sbjct: 592 YIEHTDPRVRKLAALTSCEIYVKDNICKQTSLHSLNTVSEVLSKLLAITIADPLQ 646

>Sklu_2105.3 YEL061C, Contig c2105 5732-8578 reverse complement
          Length = 948

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 45/103 (43%), Gaps = 11/103 (10%)

Query: 130 NCTDHPLILRLPLQAIFVLMNNDFGD---------KRSKNLKAIGINCLIEFLIERIGQL 180
           NC D+ L  +  ++ +       F           K S + + +GI+  I+ + E + Q+
Sbjct: 561 NCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGIDGNIDIIQEELSQV 620

Query: 181 KSFDRVESNLFSICLTNVLYLLESSSLHFQVLRHVLLGFLAAV 223
              + + S    +C + V  +LES+  HF+ +R  LL     V
Sbjct: 621 --LESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVV 661

>Sklu_2089.2 YEL009C, Contig c2089 2909-3769
          Length = 286

 Score = 30.0 bits (66), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 6/76 (7%)

Query: 225 FNFPLLIITSRFNPYLRSAILSTSFFVVFPLTILYTFEVEGQNPAIW--LFDYITSNDIR 282
           F+  L + T+R +  L SA++ T F      + ++ FE    +P  W  LFD    NDI 
Sbjct: 79  FDLQLAVDTARSSEQLNSAVVDTFFSSSTDSSPMFEFENLESDPKSWGSLFD----NDIP 134

Query: 283 VRIIAGWLSCLVILVP 298
           V +    L+   I VP
Sbjct: 135 VTVNDASLATSAIEVP 150

>KLLA0E04653g complement(418094..421276) similar to sp|P53273
           Saccharomyces cerevisiae YGR125w, start by similarity
          Length = 1060

 Score = 29.3 bits (64), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 9/53 (16%)

Query: 436 GTFAFILSTSICSLCFKLFLGAFQEITSAQVI---------LACILSGILEGN 479
           G   F +ST IC LCF L L +F     +++I            I++ I EGN
Sbjct: 302 GLSMFYVSTVICQLCFSLGLSSFPSAIGSEMIEITPFFHTMALSIMNSIPEGN 354

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.328    0.142    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,069,161
Number of extensions: 470842
Number of successful extensions: 1253
Number of sequences better than 10.0: 14
Number of HSP's gapped: 1262
Number of HSP's successfully gapped: 14
Length of query: 493
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 387
Effective length of database: 12,926,601
Effective search space: 5002594587
Effective search space used: 5002594587
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 64 (29.3 bits)