Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.81611229121163970.0
YMR012W (CLU1)1277121731880.0
Scas_709.561281125030390.0
CAGL0M07722g1267121029800.0
ABR050W1228121326530.0
KLLA0F25322g1269124024020.0
Scas_532.7851114687.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.8161
         (1211 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.8161                                                         2468   0.0  
YMR012W (CLU1) [3976] chr13 (291133..294966) Translation initiat...  1232   0.0  
Scas_709.56                                                          1175   0.0  
CAGL0M07722g complement(774048..777851) similar to sp|Q03690 Sac...  1152   0.0  
ABR050W [641] [Homologous to ScYMR012W (CLU1) - SH] complement(4...  1026   0.0  
KLLA0F25322g complement(2356566..2360375) similar to sp|Q03690 S...   929   0.0  
Scas_532.7                                                             31   7.8  

>Kwal_26.8161
          Length = 1229

 Score = 2468 bits (6397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1192/1211 (98%), Positives = 1192/1211 (98%)

Query: 1    MEAPTVDAILVSIKLPNQKQEVQLSLVKSSTVQIVGEVLQFSPSTRCLTNLEFYHRGKKL 60
            MEAPTVDAILVSIKLPNQKQEVQLSLVKSSTVQIVGEVLQFSPSTRCLTNLEFYHRGKKL
Sbjct: 1    MEAPTVDAILVSIKLPNQKQEVQLSLVKSSTVQIVGEVLQFSPSTRCLTNLEFYHRGKKL 60

Query: 61   SGEESLLDLASEDKVKLDVKFMAYTARDAMRHVSMVRDTIGFTSETLDGISDFAVSTGVQ 120
            SGEESLLDLASEDKVKLDVKFMAYTARDAMRHVSMVRDTIGFTSETLDGISDFAVSTGVQ
Sbjct: 61   SGEESLLDLASEDKVKLDVKFMAYTARDAMRHVSMVRDTIGFTSETLDGISDFAVSTGVQ 120

Query: 121  FCDMPLRPVEHAAPQEEDKTASTAFKISEDEKNDFQRTVKDTLNQGKTVNEVLKTRSGII 180
            FCDMPLRPVEHAAPQEEDKTASTAFKISEDEKNDFQRTVKDTLNQGKTVNEVLKTRSGII
Sbjct: 121  FCDMPLRPVEHAAPQEEDKTASTAFKISEDEKNDFQRTVKDTLNQGKTVNEVLKTRSGII 180

Query: 181  TPCLRALALSGYNPVPPFYRTKGHLLYLQATSLEGEVFHITATSQGFYVNKSTANKFDPS 240
            TPCLRALALSGYNPVPPFYRTKGHLLYLQATSLEGEVFHITATSQGFYVNKSTANKFDPS
Sbjct: 181  TPCLRALALSGYNPVPPFYRTKGHLLYLQATSLEGEVFHITATSQGFYVNKSTANKFDPS 240

Query: 241  PRDDAGATKVSLLDLLSTHSKKFKDHLKNLEQRVSSFDTVFHARPSTTFLGKPWLISTMP 300
            PRDDAGATKVSLLDLLSTHSKKFKDHLKNLEQRVSSFDTVFHARPSTTFLGKPWLISTMP
Sbjct: 241  PRDDAGATKVSLLDLLSTHSKKFKDHLKNLEQRVSSFDTVFHARPSTTFLGKPWLISTMP 300

Query: 301  TSSGDYARLQLSEVDFNTERNFNDEFQAIKDMTSSDYQSIVDTEKLTAKVYQEFTETAVR 360
            TSSGDYARLQLSEVDFNTERNFNDEFQAIKDMTSSDYQSIVDTEKLTAKVYQEFTETAVR
Sbjct: 301  TSSGDYARLQLSEVDFNTERNFNDEFQAIKDMTSSDYQSIVDTEKLTAKVYQEFTETAVR 360

Query: 361  DAMSIFYADLVAMNPEAPTQEQIFLKNNIFYSFVGDVNGNYSKIGGDAAAFAASNQDLQT 420
            DAMSIFYADLVAMNPEAPTQEQIFLKNNIFYSFVGDVNGNYSKIGGDAAAFAASNQDLQT
Sbjct: 361  DAMSIFYADLVAMNPEAPTQEQIFLKNNIFYSFVGDVNGNYSKIGGDAAAFAASNQDLQT 420

Query: 421  VKLLHRVSLPEIHYLLCTIIDFAGRRILAQTPVPGLLSAMGTITKEDPKTGESVTEDLVS 480
            VKLLHRVSLPEIHYLLCTIIDFAGRRILAQTPVPGLLSAMGTITKEDPKTGESVTEDLVS
Sbjct: 421  VKLLHRVSLPEIHYLLCTIIDFAGRRILAQTPVPGLLSAMGTITKEDPKTGESVTEDLVS 480

Query: 481  DVNIVYGQDEASGDVLYNQEFDDALESFSKVFHLRKHKAGSVEIKTSSHSKGIIGSDKRK 540
            DVNIVYGQDEASGDVLYNQEFDDALESFSKVFHLRKHKAGSVEIKTSSHSKGIIGSDKRK
Sbjct: 481  DVNIVYGQDEASGDVLYNQEFDDALESFSKVFHLRKHKAGSVEIKTSSHSKGIIGSDKRK 540

Query: 541  YILDLANSQPLDVEFATGNYDGVPESERYPHRQTLVRNELVDKWWANKLDESKLDFNKAF 600
            YILDLANSQPLDVEFATGNYDGVPESERYPHRQTLVRNELVDKWWANKLDESKLDFNKAF
Sbjct: 541  YILDLANSQPLDVEFATGNYDGVPESERYPHRQTLVRNELVDKWWANKLDESKLDFNKAF 600

Query: 601  EENKFAINPDAYVVEGVEDSLVMDISKYLNNDVLPSVVNEYAAGNLTVPYDGDHLTESLH 660
            EENKFAINPDAYVVEGVEDSLVMDISKYLNNDVLPSVVNEYAAGNLTVPYDGDHLTESLH
Sbjct: 601  EENKFAINPDAYVVEGVEDSLVMDISKYLNNDVLPSVVNEYAAGNLTVPYDGDHLTESLH 660

Query: 661  KNGINMRYLGKLISLAEKEYESQIEQHKTKLAGVMAGNEDHEKWEKEYLAKVEKQIKERQ 720
            KNGINMRYLGKLISLAEKEYESQIEQHKTKLAGVMAGNEDHEKWEKEYLAKVEKQIKERQ
Sbjct: 661  KNGINMRYLGKLISLAEKEYESQIEQHKTKLAGVMAGNEDHEKWEKEYLAKVEKQIKERQ 720

Query: 721  EKINKLVHEGKEIPEELKGDLKLDENDIRKPTKGEAVIVNKDQICCLIKVSQLEIVARSL 780
            EKINKLVHEGKEIPEELKGDLKLDENDIRKPTKGEAVIVNKDQICCLIKVSQLEIVARSL
Sbjct: 721  EKINKLVHEGKEIPEELKGDLKLDENDIRKPTKGEAVIVNKDQICCLIKVSQLEIVARSL 780

Query: 781  KHILRDYSKGLPVSLVPSVVAYFFNLLFGTSYNSSPEVEIVDEFFLSTNFSFKDLSRGDL 840
            KHILRDYSKGLPVSLVPSVVAYFFNLLFGTSYNSSPEVEIVDEFFLSTNFSFKDLSRGDL
Sbjct: 781  KHILRDYSKGLPVSLVPSVVAYFFNLLFGTSYNSSPEVEIVDEFFLSTNFSFKDLSRGDL 840

Query: 841  LKAIQGQAKRRFIYDLSEEALEDLCAKPFALIRAVSKRFGIQLLNKEYFFNSEEYETFKQ 900
            LKAIQGQAKRRFIYDLSEEALEDLCAKPFALIRAVSKRFGIQLLNKEYFFNSEEYETFKQ
Sbjct: 841  LKAIQGQAKRRFIYDLSEEALEDLCAKPFALIRAVSKRFGIQLLNKEYFFNSEEYETFKQ 900

Query: 901  SQDKKTRSKLSKPLSTFSANDITVIPTIKDGDYRSLTGDNFWNQGAAILNEKEADGLVLL 960
            SQDKKTRSKLSKPLSTFSANDITVIPTIKDGDYRSLTGDNFWNQGAAILNEKEADGLVLL
Sbjct: 901  SQDKKTRSKLSKPLSTFSANDITVIPTIKDGDYRSLTGDNFWNQGAAILNEKEADGLVLL 960

Query: 961  SQALKIKEEVNGTVHQSVAESYMAMSTIYHTLKRIPEAITFCRRACGIYERTCGVDSFEV 1020
            SQALKIKEEVNGTVHQSVAESYMAMSTIYHTLKRIPEAITFCRRACGIYERTCGVDSFEV
Sbjct: 961  SQALKIKEEVNGTVHQSVAESYMAMSTIYHTLKRIPEAITFCRRACGIYERTCGVDSFEV 1020

Query: 1021 LRCLTNLAVLELSNKSPSNAAVVLQRILCTMNALCVTIHPATINSYTMLQQASLACKDAR 1080
            LRCLTNLAVLELSNKSPSNAAVVLQRILCTMNALCVTIHPATINSYTMLQQASLACKDAR
Sbjct: 1021 LRCLTNLAVLELSNKSPSNAAVVLQRILCTMNALCVTIHPATINSYTMLQQASLACKDAR 1080

Query: 1081 LAIEVLKKLSSTILEIEDGQHSLAYGYNQSRIGDLYVTMKDYTSSLKAISEAKNVFTREL 1140
            LAIEVLKKLSSTILEIEDGQHSLAYGYNQSRIGDLYVTMKDYTSSLKAISEAKNVFTREL
Sbjct: 1081 LAIEVLKKLSSTILEIEDGQHSLAYGYNQSRIGDLYVTMKDYTSSLKAISEAKNVFTREL 1140

Query: 1141 GVNDETTAQCRQWVQALEGLXXXXXXXXXXXXXXXXXXXAGTTRMRKQKNSKNDEKPRPD 1200
            GVNDETTAQCRQWVQALEGL                   AGTTRMRKQKNSKNDEKPRPD
Sbjct: 1141 GVNDETTAQCRQWVQALEGLLQSQKQQQTLNQQQTAANSAGTTRMRKQKNSKNDEKPRPD 1200

Query: 1201 LANKSVDELLS 1211
            LANKSVDELLS
Sbjct: 1201 LANKSVDELLS 1211

>YMR012W (CLU1) [3976] chr13 (291133..294966) Translation initiation
            factor eIF3, p135 subunit [3834 bp, 1277 aa]
          Length = 1277

 Score = 1232 bits (3188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 600/1217 (49%), Positives = 845/1217 (69%), Gaps = 23/1217 (1%)

Query: 17   NQKQEVQLSLVKSSTVQIVGEVLQFSPSTRCLTN--LEFYHRGKKLSGEESLLDLASE-D 73
            ++  ++   + K S +Q V +VL   PS++ LTN  L+      +LS E S+ ++  E  
Sbjct: 38   SKNNDISFEIGKESKIQTVLDVLAMIPSSKYLTNVGLKTIEGDSQLSDEMSIKEIVGEKS 97

Query: 74   KVKLDVKFMAYTARDAMRHVSMVRDTIGFTSETLDGISDFAVSTGVQFCDMPLRPVEHAA 133
            ++KL +    Y+AR+A++HV  VRD IGF  ET DG+S+FA+STG  F  +PL P++  +
Sbjct: 98   ELKLQLILKPYSAREALKHVITVRDFIGFAQETSDGLSEFAISTGSSFSSLPLGPIKERS 157

Query: 134  PQEEDKTAS------TAFK-ISEDEKNDFQRTVKDTLNQGK--TVNEVLKTRSGIITPCL 184
             QEE    S        FK ++++EK  F   V +  +  K  ++N++L + S IITPC+
Sbjct: 158  KQEEKDEKSDPEEKKNTFKDVTDEEKLKFNEMVHEVFSSFKNSSINKLLTSESNIITPCV 217

Query: 185  RALALSGYNPVPPFYRTKGHLLYLQATSLEGEVFHITATSQGFYVNKSTANKFDPSPRDD 244
            R+L+ + YNPVPPFYR+KGHL YLQ  +LEGE F+ITA   GFYVNKS + KFDPSP+++
Sbjct: 218  RSLSFAPYNPVPPFYRSKGHLFYLQIVTLEGESFYITAIPSGFYVNKSNSTKFDPSPKEN 277

Query: 245  ------AGATKVSLLDLLSTHSKKFKDHLKNLEQRVSSFDTVFHARPSTTFLGKPWLIST 298
                  +     SL DL+++ SKKF  H++  E+++S+ D+  + RPS TFL KPW +S+
Sbjct: 278  TDENAHSSLIYYSLFDLIASRSKKFISHVQAFEKKLSALDSTSYVRPSNTFLHKPWFVSS 337

Query: 299  MPTSSGDYARLQLSEVDFNTERNFNDEFQAIKDMTSSDYQSIVDTEKLTAKVYQEFTETA 358
            +P ++ DY RLQ + +D   ERNFNDEFQAIKD+T+S  Q  ++ E+L +KV  EF+ TA
Sbjct: 338  LPPNNPDYLRLQTAALDTTPERNFNDEFQAIKDLTTSTLQDRIEMERLFSKVVHEFSVTA 397

Query: 359  VRDAMSIFYADLVAMNPEAPTQEQIFLKNNIFYSFVGDVNGNYSKIGGDAAAFAASNQDL 418
               AMSIFY+D VAMNPE+PT++QIFLK+NIFYS+V DV+GNY   GGD AA AASNQDL
Sbjct: 398  ASGAMSIFYSDFVAMNPESPTRDQIFLKDNIFYSYVSDVSGNYEGKGGDEAAIAASNQDL 457

Query: 419  QTVKLLHRVSLPEIHYLLCTIIDFAGRRILAQTPVPGLLSAMGTITKEDPKTGESVTEDL 478
            +T+ +L+R+ + E+ YLL T+++FAGRRILAQTPVPGLL+ MG    +D  TGE VTED 
Sbjct: 458  KTINILNRLHMHEVRYLLTTVVEFAGRRILAQTPVPGLLATMGNKIVKDANTGEEVTEDF 517

Query: 479  VSDVNIVYGQDEASGDVLYNQEFDDALES-FSKVFHLRKHKAGSVEIKTSSHSKGIIGSD 537
            V+D+N+ YG DE  G ++Y+ +FD  LE  F K FHL+KHK    E+  SS SKGI+G D
Sbjct: 518  VNDINVKYGLDEGLGKIVYDADFDSVLEKKFVKAFHLKKHKVNGTELAFSSQSKGIVGFD 577

Query: 538  KRKYILDLANSQPLDVEFATGNYDGVPES-ERYPHRQTLVRNELVDKWWANKLDESKLDF 596
            KR+YILDLAN+ PLD+ FA  N+D + E+  RYPHRQTL+R ELV+KWW NK+++  ++F
Sbjct: 578  KRRYILDLANTYPLDINFARQNFDNIEETGNRYPHRQTLLRPELVEKWWNNKVEKEGVEF 637

Query: 597  NKAFEENKFAINPDAYVVEGVEDSLVMDISKYLNNDVLPSVVNEYAAGNLTVPYDGDHLT 656
             KA+EEN F+ NPDAY VEG+ED+ V ++S YL  +V+PSV+ +Y +GNL+ PY+G+HL 
Sbjct: 638  EKAYEENLFSYNPDAYQVEGIEDANVDEMSNYLQKEVIPSVIQDYLSGNLSTPYNGEHLA 697

Query: 657  ESLHKNGINMRYLGKLISLAEKEYESQIEQHKTKLAGVMAGNEDHEKWEKEYLAKVEKQI 716
            ++LHKNGINMRYLGK+I L++KE +SQI  ++  L  V   N+++E WEK YL K+E  I
Sbjct: 698  DTLHKNGINMRYLGKIIELSQKELDSQIVHYEQNLKAVEQDNKEYEDWEKSYLQKIENMI 757

Query: 717  KERQEKINKLVHEGKEIPEELKGDLKLDENDIRKPTKGEAVIVNKDQICCLIKVSQLEIV 776
            KERQ KINKLV EGKE+P+EL  DLKL++ +I+KPT G+ V+V  D++  LIK+S+LEIV
Sbjct: 758  KERQAKINKLVQEGKEVPKELTEDLKLNDEEIKKPTDGKPVVVAYDELVPLIKISELEIV 817

Query: 777  ARSLKHILRDYSKGLPVSLVPSVVAYFFNLLFGTSYNSSPEVEIVDEFFLSTNFSFKDLS 836
            +RSLKH+L+D SK +PV LVPS+VAY FN+L G +YN+ P+ E VDEF+     SF  L+
Sbjct: 818  SRSLKHVLKDLSKDVPVFLVPSLVAYVFNMLVGINYNADPKPEPVDEFYPVNKCSFAKLT 877

Query: 837  RGDLLKAIQGQAKRRFIYDLSEEALEDLCAKPFALIRAVSKRFGIQLLNKEYFFNSEEYE 896
            R +LL+A+  QA  RF + L    +E     PF LIR+VS +FGIQLLNKEYFF  E+ E
Sbjct: 878  RSELLEAVSKQAFLRFRHQLPSNWIEAYMENPFTLIRSVSYKFGIQLLNKEYFFTREQLE 937

Query: 897  TFKQSQDKKTRSKLSKPLSTFSANDITVIPTIKDGDYRSLTGDNFWNQGAAILNEKEADG 956
            ++KQS DKK R+K  +P +TFS +D+T+IP +K  +Y S   + FW QGA+++NE +   
Sbjct: 938  SYKQSLDKKIRNKFVEPPTTFSLSDLTIIPRVKFSEYTSSVSEEFWAQGASMINEDKQSA 997

Query: 957  LVLLSQALKIKEEVNGTVHQSVAESYMAMSTIYHTLKRIPEAITFCRRACGIYERTCGVD 1016
            L LL+Q++ + E+VN  +H +VAE Y+++S IY+ L   PEAI FCR+AC IYER  G+D
Sbjct: 998  LTLLAQSITVLEDVNNILHPAVAEKYLSLSAIYNKLALYPEAIAFCRKACTIYERVSGID 1057

Query: 1017 SFEVLRCLTNLAVLELSNKSPSNAAVVLQRI--LCTMNALCVTIHPATINSYTMLQQASL 1074
            SFE++R LTNLA+LE SN+SP NA VV  R+  +  +  L    HPA  + +  L+Q +L
Sbjct: 1058 SFEMMRALTNLAILEFSNESPYNATVVYNRLAEILKVYELPKIHHPAPTSIFNHLEQLAL 1117

Query: 1075 ACKDARLAIEVLKKLSSTILEIEDGQHSLAYGYNQSRIGDLYVTMKDYTSSLKAISEAKN 1134
              +D +LAIEVL +LSS ++E+E G+ SLAYGY +SR+G+L+  +KD+  +L+ I+  + 
Sbjct: 1118 GVQDTKLAIEVLGQLSSYVVELE-GKDSLAYGYTESRLGNLFAALKDFHRALEHITVTQG 1176

Query: 1135 VFTRELGVNDETTAQCRQWVQALEGLXXXXXXXXXXXXXXXXXXXAGTTRMRKQKNSKND 1194
            +FT++LG+N   +AQ RQWV  L  L                   + +   +K  + +  
Sbjct: 1177 IFTKQLGMNHTHSAQSRQWVNGLSSLIMDLKQKKQLAQDQMSTTGSNSAGHKKTNHRQKK 1236

Query: 1195 EKPRPDLANKSVDELLS 1211
            +  +P+LANKSVDELL+
Sbjct: 1237 DDVKPELANKSVDELLT 1253

>Scas_709.56
          Length = 1281

 Score = 1175 bits (3039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 588/1250 (47%), Positives = 839/1250 (67%), Gaps = 52/1250 (4%)

Query: 5    TVDAILVSIKLP--------------NQKQEVQLSLVKSSTVQIVGEVLQFSPSTRCLTN 50
            T + I +SIKLP              N+K E+     K + V+ +  VL F+  T+ LTN
Sbjct: 15   TNEHIKISIKLPTLAHSHHHHAKKSNNKKNELLFQFNKDAKVETIINVLAFTEQTKYLTN 74

Query: 51   LEFYHRGKKLSGEESLLDLAS---EDKVKLDVKFMAYTARDAMRHVSMVRDTIGFTSETL 107
            ++     K L+ E+++ D+ +    D V L ++   YTARD+++H+  VRD IGF SET 
Sbjct: 75   IQLRWNDKILNEEDTIFDVINGKVSDMVHLSIEVKPYTARDSLKHLLTVRDFIGFASETS 134

Query: 108  DGISDFAVSTGVQFCDMPLRPVEHAAPQEEDKTASTA---------FKISEDEKNDFQRT 158
            DG+S+FAVSTG +F ++PL  +     +EE++    A         FK+S++EK++F + 
Sbjct: 135  DGLSEFAVSTGSKFTELPLGEIRVPTAEEEEQKDEAAEDKEVKKNVFKVSDEEKDNFAKV 194

Query: 159  VKDTLNQGK--TVNEVLKTRSGIITPCLRALALSGYNPVPPFYRTKGHLLYLQATSLEGE 216
            V +     K  T+N+VL   S ++TPC+R+L LS YNPVP FY+++GHL YLQ  +LEGE
Sbjct: 195  VHEIFESSKKTTINQVLTADSNVVTPCVRSLTLSAYNPVPVFYKSQGHLFYLQVVTLEGE 254

Query: 217  VFHITATSQGFYVNKSTANKFDPSPR---DDAGATKV--SLLDLLSTHSKKFKDHLKNLE 271
             FH+TAT  GFY+NKST+ KFDPS R   +    +K+  SL DLL++HSKKF  H++  E
Sbjct: 255  TFHVTATQSGFYINKSTSTKFDPSERLSEEHNNESKIFYSLYDLLASHSKKFVSHVETFE 314

Query: 272  QRVSSFDTVFHARPSTTFLGKPWLISTMPTSSGDYARLQLSEVDFNTERNFNDEFQAIKD 331
            ++++  ++V + +P +TFL KPWL+ T PT+  D+ RLQL   + + E NFND+FQAI+D
Sbjct: 315  KKLAGMESVSYVKPVSTFLHKPWLV-TPPTNPPDFFRLQLDSQNVSVETNFNDQFQAIRD 373

Query: 332  MTSSDYQSIVDTEKLTAKVYQEFTETAVRDAMSIFYADLVAMNPEAPTQEQIFLKNNIFY 391
            + ++     ++ E+L  K+  EF+  A++ AMSIF  +L  +NPE+PT EQIFL  +IFY
Sbjct: 374  LPTNSLMERIEFERLQTKIIHEFSVEAIKGAMSIFNDNLPPLNPESPTNEQIFLSGHIFY 433

Query: 392  SFVGDVNGNYSKIGGDAAAFAASNQDLQTVKLLHRVSLPEIHYLLCTIIDFAGRRILAQT 451
            SFV  +  N   I  DAA  A SN DL+T+ LL+RV+L ++ Y+L TI+DFAGRR+LAQT
Sbjct: 434  SFVTSIKDN--GINEDAAR-AISNHDLKTINLLNRVNLNDVRYVLTTIVDFAGRRLLAQT 490

Query: 452  PVPGLLSAMGTITKEDPKTGESVTEDLVSDVNIVYGQDEASGDVLYNQEFDDAL-ESFSK 510
            PVPGLL +MGT  ++DP+TGE   +DL +DV + YG DE  G +L++ +FD AL + F+K
Sbjct: 491  PVPGLLDSMGTQVEKDPETGEETLKDLNNDVMVKYGLDEEEGKILFDADFDAALGKEFAK 550

Query: 511  VFHLRKHKAGS------VEIKTSSHSKGIIGSDKRKYILDLANSQPLDVEFATGNYDGVP 564
            +FHL+KH+  +      V+I  SS S+GI+G DKRKYILDLAN+ PLD+ F   NYD V 
Sbjct: 551  IFHLKKHQVSNGKDGENVDIWFSSKSRGIVGFDKRKYILDLANTYPLDINFVKENYDNVA 610

Query: 565  ESERYPHRQTLVRNELVDKWWANKLDESK-LDFNKAFEENKFAINPDAYVVEGVEDSLVM 623
            +++RYPHRQTL+R ELV+KWW  +++++K L  + A++ N F+ NPDA+VV+GVED  V 
Sbjct: 611  DTKRYPHRQTLMRPELVEKWWNAQVEKNKDLTMDAAYDGNMFSYNPDAFVVDGVEDPTVE 670

Query: 624  DISKYLNNDVLPSVVNEYAAGNLTVPYDGDHLTESLHKNGINMRYLGKLISLAEKEYESQ 683
            +IS YL  +VLP VV +Y   N+ +PY+G+HL ++LHKNGIN+RYLGK I L + E   Q
Sbjct: 671  EISTYLTKEVLPGVVADYIQNNVNIPYNGEHLVDTLHKNGINLRYLGKFIELVQTELSKQ 730

Query: 684  IEQHKTKLAGVMAGNEDHEKWEKEYLAKVEKQIKERQEKINKLVHEGKEIPEELKGDLKL 743
            + QH  KL  V  GN ++E WEKEYL K+EK I ERQ KINKL+ EGKE+P+EL  DLKL
Sbjct: 731  VAQHTEKLKTVAEGNIEYENWEKEYLVKIEKLIAERQAKINKLIQEGKEVPKELTEDLKL 790

Query: 744  DENDIRKPTKGEAVIVNKDQICCLIKVSQLEIVARSLKHILRDYSKGLPVSLVPSVVAYF 803
            ++++IRKPT  + ++V KD++  LI +++LEI+ RSLKH+LR YSK LPV +VPS++A+ 
Sbjct: 791  NDDEIRKPTDEQPIVVAKDELTTLINIAELEIITRSLKHVLRSYSKDLPVLMVPSLIAFV 850

Query: 804  FNLLFGTSYNSSPEVEIVDEFFLSTNFSFKDLSRGDLLKAIQGQAKRRFIYDLSEEALED 863
             NLLFG  YN SP  E +D F    +FSF  L+R  LL+AI  ++  RF Y+L  + +  
Sbjct: 851  LNLLFGEKYNDSPVAEEIDNFHPIKSFSFHKLTRTTLLEAISKESYLRFRYELPTDWISK 910

Query: 864  LCAKPFALIRAVSKRFGIQLLNKEYFFNSEEYETFKQSQDKKTRSKLSKPLSTFSANDIT 923
                PF  IR++S + GIQL+NK+YFF +E +ETFKQSQDKK R+KL  PL+TFS  D+T
Sbjct: 911  YSESPFIAIRSLSYKIGIQLVNKQYFFTTESFETFKQSQDKKIRNKLVAPLNTFSVKDLT 970

Query: 924  VIPTIKDGDYRSLTGDNFWNQGAAILNEKEADGLVLLSQALKIKEEVNGTVHQSVAESYM 983
            +IP +K  ++ SL G +FW QG   + E   D L L +QA+ + EEV+  +H SVAE Y+
Sbjct: 971  IIPRVKTSEFSSLVGQDFWTQGTLTIQEAPKDALTLFAQAITVMEEVSSILHPSVAEKYL 1030

Query: 984  AMSTIYHTLKRIPEAITFCRRACGIYERTCGVDSFEVLRCLTNLAVLELSNKSPSNAAVV 1043
            ++ST+Y+ L    EA+ FCR+AC IYER CGVDSFE+LR LTNLA+LE SNKSP NAAVV
Sbjct: 1031 SVSTVYNQLGLTSEAVAFCRKACKIYERVCGVDSFEMLRALTNLAMLETSNKSPYNAAVV 1090

Query: 1044 LQRILCTMNALCVTI--HPATINSYTMLQQASLACKDARLAIEVLKKLSSTILEIEDGQH 1101
             +R++ T+ +  ++   HP+  + Y+ ++Q SL  ++ +L++ VLK L   I+  E G+ 
Sbjct: 1091 YKRLIETLQSFNLSTLHHPSMTSIYSNIEQLSLGVENIKLSMAVLKHLCDLIVSFE-GKE 1149

Query: 1102 SLAYGYNQSRIGDLYVTMKDYTSSLKAISEAKNVFTRELGVNDETTAQCRQWVQALEGLX 1161
            SLAY + +SR+G+LYVT+KD+ S+L+ I+  + +F++ELG N  TTAQ RQW+    GL 
Sbjct: 1150 SLAYAFTESRLGNLYVTVKDFRSALQHIAVTEPIFSKELGTNHVTTAQSRQWIN---GLT 1206

Query: 1162 XXXXXXXXXXXXXXXXXXAGTTRMRKQKNSKNDEKPRPDLANKSVDELLS 1211
                              A +    K+  +K DE P  +LA+KSVDELL+
Sbjct: 1207 NVVNDMQKQLNQTQAAVNAKSNAPAKKHKNKKDE-PNAELADKSVDELLN 1255

>CAGL0M07722g complement(774048..777851) similar to sp|Q03690
            Saccharomyces cerevisiae YMR012w translation initiation
            factor eIF3, hypothetical start
          Length = 1267

 Score = 1152 bits (2980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 573/1210 (47%), Positives = 808/1210 (66%), Gaps = 21/1210 (1%)

Query: 22   VQLSLVKSSTVQIVGEVLQFSPSTRCLTNLEFYHRGKKL---SGEESLLDLASE-DKVKL 77
            + L   K S +Q V + L  +P+T+  TN    +    L   S E++L +L S+ D+ K+
Sbjct: 35   ITLQFRKDSKLQNVLDFLSIAPATKYFTNYNLKNSTGDLLLSSEEKTLRELCSDKDEYKV 94

Query: 78   DVKFMAYTARDAMRHVSMVRDTIGFTSETLDGISDFAVSTGVQFCDMPLRPVEHAAPQEE 137
             ++   Y    A++HV   RD  GF SET DG+S+ AVSTG +F  +PL+ ++  +P+ E
Sbjct: 95   ALELKPYNQYQALKHVLTSRDFFGFASETEDGLSNVAVSTGSKFYKLPLKEIKEKSPENE 154

Query: 138  DKTAS----TAFKISEDEKNDFQRTVKDTLN-----QGKTVNEVLKTRSGIITPCLRALA 188
            DK       T+  ++++EK +F   V          +   + +++ T + ++TPCLR++ 
Sbjct: 155  DKDTENKKPTSMNVTDEEKVEFNHMVHGLFETLKKEKKVLLKDLMNTDTSVVTPCLRSIN 214

Query: 189  LSGYNPVPPFYRTKGHLLYLQATSLEGEVFHITATSQGFYVNKSTANKFDPSPRDDAG-- 246
             S YNPVP FYRTKGHL YLQ  +LEGE   +TA   GFY+NKST +KFDPSP+++ G  
Sbjct: 215  FSPYNPVPAFYRTKGHLFYLQIVTLEGESLQVTAIPSGFYINKSTTSKFDPSPKENDGHV 274

Query: 247  -ATKVSLLDLLSTHSKKFKDHLKNLEQRVSSFDTVFHARPSTTFLGKPWLISTMPTSSGD 305
                 +L DLL++ SK F  H+ +LE++    ++V + RP+ T L KPWLI  +PT+  D
Sbjct: 275  DTVHYTLYDLLASSSKNFVTHISSLEKKFDDLESVTYVRPACTTLNKPWLIPAIPTNGPD 334

Query: 306  YARLQLSEVDFNTERNFNDEFQAIKDMTSSDYQSIVDTEKLTAKVYQEFTETAVRDAMSI 365
            Y R Q+   +F  ERNFNDEFQ+IK++ ++  Q+ +++E++ AK+  EFT  A + AM I
Sbjct: 335  YLRTQIDSFNFEPERNFNDEFQSIKEIPTNTLQARIESERIFAKLTHEFTINATKGAMDI 394

Query: 366  FYADLVAMNPEAPTQEQIFLKNNIFYSFVGDVNGNYSKIGGDAAAFAASNQDLQTVKLLH 425
             Y +  AMNP++P +EQIFLKNNIFYSFVGD+N  Y+  GGD AA A++NQDL+T+ +L 
Sbjct: 395  LYGNGTAMNPDSPLEEQIFLKNNIFYSFVGDLNQTYADKGGDEAAIASANQDLRTLNMLT 454

Query: 426  RVSLPEIHYLLCTIIDFAGRRILAQTPVPGLLSAMGTITKEDPKTGESVTEDLVSDVNIV 485
            R++LP IH+LL TI+DF G+RILAQTPVPGLLS MG     + +T E    +L SD+ + 
Sbjct: 455  RLNLPNIHHLLTTIVDFGGKRILAQTPVPGLLSPMGVKITTNEETKEETVSELSSDICVK 514

Query: 486  YGQDEASGDVLYNQEFDDAL-ESFSKVFHLRKHKAGSVEIKTSSHSKGIIGSDKRKYILD 544
            YG DE    V++N+EFD+ L + F+K FHL+KH     E+  SS SKGI+GSDKR YILD
Sbjct: 515  YGLDENEKKVVFNEEFDEILNDQFAKSFHLKKHTIQGTELVFSSQSKGIVGSDKRHYILD 574

Query: 545  LANSQPLDVEFATGNYDGVPE-SERYPHRQTLVRNELVDKWWANKLDESKLDFNKAFEEN 603
            LAN+ PLDVEFA  N+D V E S++YPHRQTL+R ELV+KWWA K++  K++  KA+EEN
Sbjct: 575  LANTYPLDVEFAKENFDDVKEASKKYPHRQTLIRPELVEKWWATKIENDKVELVKAYEEN 634

Query: 604  KFAINPDAYVVEGVEDSLVMDISKYLNNDVLPSVVNEYAAGNLTVPYDGDHLTESLHKNG 663
             ++ NPDAY V GVED  V++ISKYLN +++P+VV +Y  GN+  PY+G+HL ++ HKNG
Sbjct: 635  LYSYNPDAYQVPGVEDETVVEISKYLNEEIIPNVVQDYLNGNIISPYNGEHLADTFHKNG 694

Query: 664  INMRYLGKLISLAEKEYESQIEQHKTKLAGVMAGNEDHEKWEKEYLAKVEKQIKERQEKI 723
            +NMRYLGK  +L ++E   Q E H+ KLA V+  N+++E+WEK YL K+E  IKERQ KI
Sbjct: 695  VNMRYLGKFANLVKEELRKQEEAHEAKLAQVIVDNKEYEEWEKSYLQKIETMIKERQAKI 754

Query: 724  NKLVHEGKEIPEELKGDLKLDENDIRKPTKGEAVIVNKDQICCLIKVSQLEIVARSLKHI 783
            NKLV EGKE+P+EL  DLKLD+N+I+KP+  + V+V+ D++  LIK ++LEI++RSLKHI
Sbjct: 755  NKLVQEGKEVPKELTEDLKLDDNEIKKPSTEKPVVVSYDELVPLIKTAELEIISRSLKHI 814

Query: 784  LRDYSKGLPVSLVPSVVAYFFNLLFGTSYNSSPEVEIVDEFFLSTNFSFKDLSRGDLLKA 843
            LR YS+ LP  ++P+++++ FNLLFGT+YN +P VE VD  +    + FK+L+   LLK 
Sbjct: 815  LRKYSRSLPPIVIPALISFVFNLLFGTTYNPAPAVESVDPLYPVDQYEFKNLTHDTLLKE 874

Query: 844  IQGQAKRRFIYDLSEEALEDLCAKPFALIRAVSKRFGIQLLNKEYFFNSEEYETFKQSQD 903
            I+ +A  R+ Y+L  +   +    PF LIR++  +FG+QLLNK+YFF++E+ E +KQS D
Sbjct: 875  IEQEAVVRYRYELEGDWFAEHELYPFTLIRSICNKFGVQLLNKDYFFSTEQLEEYKQSLD 934

Query: 904  KKTRSKLSKPLSTFSANDITVIPTIKDGDYRSLTGDNFWNQGAAILNEKEADGLVLLSQA 963
            KK+R+K   PL+TFS +D+TVIP IK  DY S   +  W+QGA+I+NE + DGL LL+Q+
Sbjct: 935  KKSRAKYVAPLTTFSVSDLTVIPKIKAIDYSSPISEELWSQGASIINENQKDGLTLLAQS 994

Query: 964  LKIKEEVNGTVHQSVAESYMAMSTIYHTLKRIPEAITFCRRACGIYERTCGVDSFEVLRC 1023
            +  KEEVN  +H SVAE Y+ +STIY+ L    EAI FCR++C IYER CGVDSFE+LR 
Sbjct: 995  IGFKEEVNSILHSSVAEKYLTLSTIYNKLGLNAEAIAFCRKSCAIYERVCGVDSFELLRA 1054

Query: 1024 LTNLAVLELSNKSPSNAAVVLQRILCTMN--ALCVTIHPATINSYTMLQQASLACKDARL 1081
            LTNLA LE +N+SP N A++ QRI+ T++   L    HP   N +  L+Q SL  +DA+L
Sbjct: 1055 LTNLATLEFANESPYNVALIYQRIIQTVSGYGLDKIHHPIFTNIFNYLEQLSLGVQDAKL 1114

Query: 1082 AIEVLKKLSSTILEIEDGQHSLAYGYNQSRIGDLYVTMKDYTSSLKAISEAKNVFTRELG 1141
            A+EVLK L   ++ I DG  SL Y Y +S++G+L      ++ +L  I  A+ +FT+ELG
Sbjct: 1115 AVEVLKSLGDFLVSI-DGTESLPYAYIKSKLGNLLAADNRFSDALNQIKVAERIFTKELG 1173

Query: 1142 VNDETTAQCRQWVQALEGLXXXXXXXXXXXXXXXXXXXAGTTRMRKQKNSKNDEKPRPDL 1201
             N  +TAQ RQWV  L  L                         + +      E   PDL
Sbjct: 1174 TNHGSTAQARQWVDGLTNLIKDVNQKKQLQQDQTAASGLKQQPQKSKSGHNKKETTNPDL 1233

Query: 1202 ANKSVDELLS 1211
            A+KSVDELLS
Sbjct: 1234 ADKSVDELLS 1243

>ABR050W [641] [Homologous to ScYMR012W (CLU1) - SH]
            complement(483635..487321) [3687 bp, 1228 aa]
          Length = 1228

 Score = 1026 bits (2653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/1213 (43%), Positives = 767/1213 (63%), Gaps = 16/1213 (1%)

Query: 6    VDAILVSIKLP-NQKQEVQLSLVKSSTVQIVGEVLQFSPSTRCLTNLEFYHRGKKLSGEE 64
            +D + VSI++P  + + +  +  + + VQ +   L F+ +++  TN E  H G ++  ++
Sbjct: 5    LDTVEVSIRVPFGKSKRLSTTASRRARVQSIMYFLAFNAASKYYTNYELLHNGVEVDEQQ 64

Query: 65   SLLDLA-SEDKVKLDVKFMAYTARDAMRHVSMVRDTIGFTSETLDGISDFAVSTGVQFCD 123
             + +LA +E  V L ++   Y   + +RH    R+ IGF  ++ D I+  A+S   +F +
Sbjct: 65   LISELAGNEQTVHLQLRLKPYNTGEVIRHFVTFREYIGFVGDSDDDITSLALSNVAKFRE 124

Query: 124  MPLRPVEHAAPQEE--DKTASTAFKISEDEKNDFQRTVKDTLNQGKTVNEVLKTRSGIIT 181
            +PL  +  A+ + E  D      F++S+ EK  F + +   L    +  +VLK  S +  
Sbjct: 125  LPLTDIAAASGKTEVADDRQKEEFQVSDAEKAVFTKELDSILELRPSAQDVLKGGSALSK 184

Query: 182  PCLRALALSGYNPVPPFYRTKGHLLYLQATSLEGEVFHITATSQGFYVNKSTANKFDPSP 241
            PCLR+L +SGYNPVP F+RTKGHLLYLQA +LEGE  HITAT  GFYVNKS+A KFDP+ 
Sbjct: 185  PCLRSLIISGYNPVPAFFRTKGHLLYLQAVTLEGETLHITATVSGFYVNKSSAIKFDPTL 244

Query: 242  RDDAGATKVSLLDLLSTHSKKFKDHLKNLEQRVSSFDTVFHARPSTTFLGKPWLISTMPT 301
            + DA A  ++L +LL+ HSKKF  HL  LE  + + ++V + +P + FL K W  S++P+
Sbjct: 245  KTDA-AVCLTLYELLTKHSKKFASHLSQLEAALKAHESVNYVKPISVFLHKTWFPSSLPS 303

Query: 302  SSGDYARLQLSEVDFNTERNFNDEFQAIKDMTSSDYQSIVDTEKLTAKVYQEFTETAVRD 361
            +S D+   QL  ++F TERNFNDEFQA+K+ +S D  + ++ EKL  +V  +F   A + 
Sbjct: 304  NSIDFTEYQLEALNFQTERNFNDEFQAVKETSSEDIVARLEKEKLLNRVIHDFNVAASKG 363

Query: 362  AMSIFYADLVAMNPEAPTQEQIFLKNNIFYSFVGDVNGNYSKIGGDAAAFAASNQDLQTV 421
            +M IFY ++VAMNP+AP QE IFLKNNIFYSFV D++G+Y   GGDAAA AASNQDL  +
Sbjct: 364  SMEIFYGNMVAMNPDAPRQEHIFLKNNIFYSFVSDLDGHYQDKGGDAAAHAASNQDLHII 423

Query: 422  KLLHRVSLPEIHYLLCTIIDFAGRRILAQTPVPGLLSAMGTITKEDPKTGESVTEDLVSD 481
            K L + ++  + +LL  ++          +PVPG+L   G    ++ K GE       +D
Sbjct: 424  KTLLQSNMRSVRHLLPAVLSSVVLESWHHSPVPGILDTAGMKFIKNEK-GEEEAIQAKND 482

Query: 482  VNIVYGQDEASGDVLYNQEFDDALESFSKVFHLRKHKAGSVEIKTSSHSKGIIGSDKRKY 541
            + + YG DEAS  V+ + EF  +L+ F+KVFHL+KH+   VE+K +S SKG++G DKR Y
Sbjct: 483  ITVCYGFDEASNKVIADAEFGSSLDDFAKVFHLKKHEVDGVELKVASTSKGVVGFDKRNY 542

Query: 542  ILDLANSQPLDVEFATGNYDGVP-ESERYPHRQTLVRNELVDKWWANKLDESKLDFNKAF 600
            ILDLA++ PLDV FA  N+D V  E  RYPHRQTL+R ELV+KWW +K+D +  +   A+
Sbjct: 543  ILDLADNNPLDVGFALENFDAVTDEKARYPHRQTLLRRELVEKWWFSKVDGTGSEMEAAY 602

Query: 601  EENKFAINPDAYVVEGVEDSLVMDISKYLNNDVLPSVVNEYAAGNLTVPYDGDHLTESLH 660
            EE KF+ NPDAY +EG+ED  V+++S YL  +V+P++V E A G++T P++G+HL + +H
Sbjct: 603  EEGKFSYNPDAYKIEGIEDETVVELSDYLRKEVVPTLVKEVAEGSITAPFNGEHLVDIMH 662

Query: 661  KNGINMRYLGKLISLAEKEYESQIEQHKTKLAGVMAGNEDHEKWEKEYLAKVEKQIKERQ 720
            KNGIN+RYLG++I LAE+E E+Q    +  L  V A N++  +WE  YL  +E  IKERQ
Sbjct: 663  KNGINIRYLGRVIELAEQELEAQRALREAHLQQVEADNKEFTEWEANYLKHIESLIKERQ 722

Query: 721  EKINKLVHEGKEIPEELKGDLKLDENDIRKPTKGEAVIVNKDQICCLIKVSQLEIVARSL 780
              I KL+ EGKE+P ELK +LKLD+ +IRKP + E V VN DQ+  L+ ++Q+EI++RS+
Sbjct: 723  VTIQKLLAEGKEVPAELKEELKLDDKEIRKPHEKEGVAVNNDQLSVLLTLAQIEIISRSI 782

Query: 781  KHILRDYSKGLPVSLVPSVVAYFFNLLFGTSYNSSPEVEIVDEFFLSTNFSFKDLSRGDL 840
            KH+ R +   LP  ++P+ +A+  NLLFG  YN +P  E   +     +F+F  L+R  L
Sbjct: 783  KHVFRKHCHELPAVIIPTFIAFALNLLFGYCYNKAPIAEFPTDGS-DIDFAFTKLTREQL 841

Query: 841  LKAIQGQAKRRFIYDLSEEALEDLCAKPFALIRAVSKRFGIQLLNKEYFFNSEEYETFKQ 900
            L  I  QA  RF Y L +         PFAL+R +  +FGIQLLNKEYFF  E+Y+ ++Q
Sbjct: 842  LSEISEQAVLRFRYTLPDGWESRYEHTPFALLRPICNKFGIQLLNKEYFFTREQYQNWRQ 901

Query: 901  SQDKKTRSKLSKPLSTFSANDITVIPTIKDGDYRSLTGDNFWNQGAAILN--EKEADGLV 958
            +QD + RSKL +P+STFS ND++V   I      +   D+ W QGA ++N  +K+A  L 
Sbjct: 902  AQDNQIRSKLVEPVSTFSINDLSVRTIINVATLTTGVSDDCWAQGAYMINDEDKQATALG 961

Query: 959  LLSQALKIKEEVNGTVHQSVAESYMAMSTIYHTLKRIPEAITFCRRACGIYERTCGVDSF 1018
            L SQA+  +EE +G VH +VAESY+A+STI+  L++  EA+  CR+AC IYER CG DSF
Sbjct: 962  LFSQAIAFREETSGYVHPTVAESYLALSTIHSKLEKKSEAVALCRKACAIYERVCGFDSF 1021

Query: 1019 EVLRCLTNLAVLELSNKSPSNAAVVLQRILCTMNALCVTIHPATINSYTMLQQASLACKD 1078
            E++R L NLA+LE++N SP NAA+ L+ I+  ++ +    HPATINSY+ML     + ++
Sbjct: 1022 EMIRSLNNLAMLEMANDSPYNAALCLKTIMSILSVVIPVNHPATINSYSMLHSMCSSLQN 1081

Query: 1079 ARLAIEVLKKLSSTILEIEDGQHSLAYGYNQSRIGDLYVTMKDYTSSLKAISEAKNVFTR 1138
            +   I+VL KL   I+EI DG  SL Y  N+SR+ +LY ++ +Y  SL  I     +F++
Sbjct: 1082 SSAMIKVLNKLGDIIVEI-DGHKSLPYAVNESRLANLYASVGEYKRSLACIESCYELFSK 1140

Query: 1139 ELGVNDETTAQCRQWVQALEGLXXXXXXXXXXXXXXXXXXXAGTTRMRKQKNSKNDEKPR 1198
            ELGVN +TT +C  W+  +E L                       +   QK  ++ E   
Sbjct: 1141 ELGVNHKTTVECNSWITGVENLIESTSQSKALAASKAAAAAKQGEKKPAQKQQQSAE--- 1197

Query: 1199 PDLANKSVDELLS 1211
              L +KS+DEL++
Sbjct: 1198 --LRDKSIDELMN 1208

>KLLA0F25322g complement(2356566..2360375) similar to sp|Q03690
            Saccharomyces cerevisiae YMR012w CLU1 translation
            initiation factor eIF3 (p135 subunit) singleton,
            hypothetical start
          Length = 1269

 Score =  929 bits (2402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/1240 (40%), Positives = 752/1240 (60%), Gaps = 65/1240 (5%)

Query: 21   EVQLSLVKSSTVQIVGEVLQFSPSTRCLTNLEFYHRGKKLSGEESLLDLASE-DKVKLDV 79
            +++  L K S V  +   L F  ST+  T+ +     + +  E+ L DLA     +    
Sbjct: 23   DIKYQLGKESNVSHLRTFLSFEESTKFYTSYDLIENSRVVDDEDVLGDLAGNGSSLTFQF 82

Query: 80   KFMAYTARDAMRHVSMVRDTIGFTSETLDGISDFAVSTGVQFCDMPLRPVEHAAPQEEDK 139
            K  AY    A++H+  +R+T+GF+SE  DGIS+FA+S+G QF DM L P         +K
Sbjct: 83   KPKAYNLVTAVQHIVGLRETLGFSSELEDGISEFAISSGSQFQDMSLEP-------NSEK 135

Query: 140  TASTAFKISEDEKNDFQRTVKDTLNQGKTVNEV--LKTRSGIITPCLRALALSGYNPVPP 197
            +  +   IS+ EK  F +T  + L    T   +  LKT + ++TP L++L  S YNPVP 
Sbjct: 136  SNGSETTISDQEKVKFLQTCNELLESTNTDFNIASLKTGNLLVTPVLKSLHFSAYNPVPA 195

Query: 198  FYRTKGHLLYLQATSLEGEVFHITATSQGFYVNKSTANKFDPSPRDDAGATKVSLLDLLS 257
            FY+ KGHLLYLQA++LE E FHIT +  GFYVNKS++ KFDPSP+D+    K +L+DLL+
Sbjct: 196  FYKNKGHLLYLQASTLENETFHITTSISGFYVNKSSSVKFDPSPKDEF-EPKFNLIDLLT 254

Query: 258  THSKKFKDHLKNLEQRVSSFDTVFHARPSTTFLGKPWLISTMPTSSGDYARLQLSEVDFN 317
              SKKF  H+ +L  ++SS D+  + +P++ FL KPWL+S +P+++GD+ R QL   + +
Sbjct: 255  QVSKKFHQHVTSLRNKLSSTDSAQYVKPASCFLSKPWLVSQLPSNNGDFMRTQLEHFNND 314

Query: 318  TERNFNDEFQAIKDMTSSDYQSIVDTEKLTAKVYQEFTETAVRDAMSIFYADLVAMNPEA 377
             ERNF DEFQAIKD+  +     +  EK+TA +  EF   AV+ AM+IF  +L  ++P  
Sbjct: 315  DERNFCDEFQAIKDLEINSSYDRLKNEKITAGLIHEFNSEAVKGAMAIFNNELTPIDPGT 374

Query: 378  PTQEQIFLKNNIFYSFVGDVNGNYSKIGGDAAAFAASNQDLQTVKLLHRVSLPEIHYLLC 437
              +  ++   ++ +SFV DV+G YS IGG+ AA+A +NQDLQ +  L+R+ L  I + L 
Sbjct: 375  TGENAVYFHKSLIFSFVADVSGTYSSIGGNEAAYAVANQDLQIINSLNRLGLKGIRHCLT 434

Query: 438  TIIDFAGRRILAQTPVPGLLSAMGTITKEDPKTGESVTEDLVSDVNIVYGQDEASGDVLY 497
             IID+AG R+L Q+PVPGLL+ +G     D +  E V E + + +++ YG D+    + +
Sbjct: 435  AIIDYAGHRLLVQSPVPGLLTPVGVNIIVDEEDKE-VAEPMETLISVNYGYDDFVATLKF 493

Query: 498  NQEFDDALESFSKVFHLRKHKAGSVEIKTSSHSKGIIGSDKRKYILDLANSQPLDVEFAT 557
            +++F + +  FSK F+L++HK   V+++ SS SKGI G D+R YILDLAN+ P+D+EF  
Sbjct: 494  DEKFHEKVCEFSKNFYLKEHKVEEVDLRISSKSKGIFGVDQRAYILDLANTNPVDIEFVK 553

Query: 558  GNYDGVPESERYPHRQTLVRNELVDKWWANKLDESKLDFNKAFEENKFAINPDAYVVEGV 617
             +YD V E+ +YPHRQ L+R ELV++W A K+  S     +A E+  F  NPDAYV++GV
Sbjct: 554  AHYDDVKEN-KYPHRQVLLRRELVERWRAEKIAASGKTLQEASEDVSFIYNPDAYVIDGV 612

Query: 618  EDSLVMDISKYLNNDVLPSVVNEYAAGNLTVPYDGDHLTESLHKNGINMRYLGKLISLAE 677
            ED  V D+SK+LN+ VL   + +   GN  +PYDG HLT+  H NG+NMRYLGK I   +
Sbjct: 613  EDENVADMSKFLNDTVLTLFLEDILKGNSNIPYDGQHLTDLFHTNGVNMRYLGKAIEFVK 672

Query: 678  KEYESQIEQHKTKLAGVMAGNEDHEKWEKEYLAKVEKQIKERQEKINKLVHEGKEIPEEL 737
             +YE Q ++    L+ +   N++++ WE  YL KVEK IKERQE+INK V +GKE+P +L
Sbjct: 673  AKYEDQKQERAKYLSKIEQENKEYQDWETGYLVKVEKLIKERQEEINKYVQQGKEVPSKL 732

Query: 738  KGDLKLDENDIRKPTKGEAVIVNKDQICCLIKVSQLEIVARSLKHILRDYSKGLPV-SLV 796
            K  ++LD+ D+++P + E   V  DQ   LI V +LE++ARS+KHI R  SK L   +LV
Sbjct: 733  KEQIQLDKADLKEPVRNEGCTVEVDQFEGLIAVCELEMIARSIKHIFRQQSKKLSSPTLV 792

Query: 797  PSVVAYFFNLLFGTSYNSSPEVEIVDEFFLSTNFSFKDLSRGDLLKAIQGQAKRRFIYDL 856
            P +VA+F NLLFG SYN S  VE +D  F      F   +R  L++ ++ QAK RF YDL
Sbjct: 793  PHLVAFFLNLLFGKSYNESVTVENLDALFDINELEFAQYTREQLIEEVRVQAKLRFRYDL 852

Query: 857  SEEALEDLCAKPF---ALIRAVSKRFGIQLLNKEYFFNSEEYETFKQSQDKKTRSKLSKP 913
            + E   D+  K F   ALIRA++++FGIQL+NKEYFF  E+YE +KQ+QDKK RSK+  P
Sbjct: 853  TSEWF-DINEKRFSKYALIRAIAQKFGIQLINKEYFFTKEQYEKWKQAQDKKLRSKIVDP 911

Query: 914  LSTFSANDITVIPTIKDGDYRSLTGDNFWNQGAAILN----------------------- 950
              TFS ND ++ P IK  +++SL  +  W QGA+++N                       
Sbjct: 912  KQTFSINDFSLRPVIKGAEFQSLIAEELWIQGASLVNAVSVEEEEAEKKKEESKKAAADG 971

Query: 951  --------------------EKEADGLVLLSQALKIKEEVNGTVHQSVAESYMAMSTIYH 990
                                +K  + L LL Q++  +E++ G VH S+  SY+ +S +Y 
Sbjct: 972  EDAGSSGATSKEEEQAKERAKKMNEALTLLGQSIAFREDIFGLVHPSLVSSYLLLSNMYS 1031

Query: 991  TLKRIPEAITFCRRACGIYERTCGVDSFEVLRCLTNLAVLELSNKSPSNAAVVLQRILCT 1050
             L +  +A+TFC +A  + ER  GVDSFE +R L+NLA LE    S  N+A+VL+++   
Sbjct: 1032 RLGQYSQAVTFCNKAALLSERCYGVDSFETVRILSNLAYLEYGQGSIYNSALVLKKVHEL 1091

Query: 1051 MNALCVTIHPATINSYTMLQQASLACKDARLAIEVLKKLSSTILEIEDGQHSLAYGYNQS 1110
            +  L   +H   +N + +L Q + + +D ++ I++L KLS  +L+I   + +L YG N+S
Sbjct: 1092 LKLLAPFVHSGRVNVFNLLFQIAASTEDKKVQIKILNKLSELLLKITGSEETLPYGQNES 1151

Query: 1111 RIGDLYVTMKDYTSSLKAISEAKNVFTRELGVNDETTAQCRQWVQALEGLXXXXXXXXXX 1170
            RI +LY ++ D + +L  I +AK++F++ELG+ND+TT   +QW + ++G+          
Sbjct: 1152 RIANLYTSLDDMSHALSHIEKAKSIFSKELGLNDQTTLTSKQWSETIKGIITKQQQEKKL 1211

Query: 1171 XXXXXXXXXAGTTRMRKQKNSKNDEKPRPDLANKSVDELL 1210
                     A  ++ + +K+S +     P L NKSVDELL
Sbjct: 1212 ASAQQATKPANISQKKGKKSSSS----SPALTNKSVDELL 1247

>Scas_532.7
          Length = 851

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 51/114 (44%), Gaps = 14/114 (12%)

Query: 413 ASNQDLQTVKLLHRVSLPEIHYLLCTIIDFAGRRILAQTPVPGLLSAMGT---ITKEDPK 469
           ++N  L T ++L  +S P+I Y   T       +I+ + P P  L    T   I    P+
Sbjct: 392 STNTALDTPEIL--LSAPDITYTTPT-----NNKIMKRNPTPLTLDRALTNSLIQSPSPQ 444

Query: 470 TGESVTEDLVSDVNIVYGQDEASGDVLYNQEFDDA-LESFSKVFHLRKHKAGSV 522
             +S   D  S ++I+      SG+VL+ +  DD  ++S   +   R  K  S+
Sbjct: 445 KNDS---DTASPIDIIRPTKYDSGEVLFPKSLDDQEVDSIVSIERTRSTKRSSI 495

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.132    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 39,067,911
Number of extensions: 1736783
Number of successful extensions: 7308
Number of sequences better than 10.0: 68
Number of HSP's gapped: 7526
Number of HSP's successfully gapped: 72
Length of query: 1211
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1098
Effective length of database: 12,684,275
Effective search space: 13927333950
Effective search space used: 13927333950
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)