Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.815237336815590.0
ABR048W3573685643e-69
YHL020C (OPI1)4042494663e-54
CAGL0K03267g4872144619e-53
Scas_709.573942174434e-51
KLLA0F25388g4051313002e-30
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.8152
         (368 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.8152                                                          605   0.0  
ABR048W [639] [Homologous to ScYHL020C (OPI1) - SH] complement(4...   221   3e-69
YHL020C (OPI1) [2266] chr8 complement(66238..67452) Negative reg...   184   3e-54
CAGL0K03267g 299090..300553 similar to tr|AAB65073 Saccharomyces...   182   9e-53
Scas_709.57                                                           175   4e-51
KLLA0F25388g complement(2362150..2363367) some similarities with...   120   2e-30

>Kwal_26.8152
          Length = 373

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/368 (83%), Positives = 308/368 (83%)

Query: 1   MGNEQHSTDFKEDILPQDIALAVEALRDLRNSHGQGQHDTLLDKVRSNALINNAVRVYEQ 60
           MGNEQHSTDFKEDILPQDIALAVEALRDLRNSHGQGQHDTLLDKVRSNALINNAVRVYEQ
Sbjct: 1   MGNEQHSTDFKEDILPQDIALAVEALRDLRNSHGQGQHDTLLDKVRSNALINNAVRVYEQ 60

Query: 61  SKSQYPKFRKGAEMMERKAFIPMVKRLEKTSHKWKSRGKRCHXXXXXXXXXQQKAXXXXX 120
           SKSQYPKFRKGAEMMERKAFIPMVKRLEKTSHKWKSRGKRCH         QQKA     
Sbjct: 61  SKSQYPKFRKGAEMMERKAFIPMVKRLEKTSHKWKSRGKRCHDDEDEDEMDQQKAEGSDE 120

Query: 121 XXXXXXXXXXXXXHRESVLLLDDRLCRKRTSKRQKISNAIAKSKVNLKGYQLDMSIESKK 180
                        HRESVLLLDDRLCRKRTSKRQKISNAIAKSKVNLKGYQLDMSIESKK
Sbjct: 121 EDNDGDDEEEDEDHRESVLLLDDRLCRKRTSKRQKISNAIAKSKVNLKGYQLDMSIESKK 180

Query: 181 RLVTCLHLLKLANNQLSNRVGFLQDLVLKEQKLRKGRIRDRQXXXXXXXXXXXXXXNIDE 240
           RLVTCLHLLKLANNQLSNRVGFLQDLVLKEQKLRKGRIRDRQ              NIDE
Sbjct: 181 RLVTCLHLLKLANNQLSNRVGFLQDLVLKEQKLRKGRIRDRQAESDDEEEYYDASDNIDE 240

Query: 241 LSNVVKMEIVGTVKKVYSLISKFTGSSLPEPARTQVRESLLKLPMNWTSTMNSENLARYT 300
           LSNVVKMEIVGTVKKVYSLISKFTGSSLPEPARTQVRESLLKLPMNWTSTMNSENLARYT
Sbjct: 241 LSNVVKMEIVGTVKKVYSLISKFTGSSLPEPARTQVRESLLKLPMNWTSTMNSENLARYT 300

Query: 301 SSKGVSPNGKVLILAKESLGMVHNVMNVVDNTLGXXXXXXXXXXXXXXXXXXXYLHGRYR 360
           SSKGVSPNGKVLILAKESLGMVHNVMNVVDNTLG                   YLHGRYR
Sbjct: 301 SSKGVSPNGKVLILAKESLGMVHNVMNVVDNTLGKAEEWVKQKQEVKELLKKQYLHGRYR 360

Query: 361 EKVKTQII 368
           EKVKTQII
Sbjct: 361 EKVKTQII 368

>ABR048W [639] [Homologous to ScYHL020C (OPI1) - SH]
           complement(481129..482202) [1074 bp, 357 aa]
          Length = 357

 Score =  221 bits (564), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 154/368 (41%), Positives = 199/368 (54%), Gaps = 63/368 (17%)

Query: 21  LAVEALRDLRN----------SHG--QGQH-------DTLLDKVRSNALINNAVRVYEQS 61
           +A+EAL  L N          SHG  QGQ        +TLL ++R N +  NAV +YEQ+
Sbjct: 15  IAIEALSRLCNGTNGETRLEKSHGAEQGQAQQHQDDGETLLCRMRQNPIFTNAVSLYEQT 74

Query: 62  KSQYPKFRKGAEMMERKAFIPMVKRLEKTSHKWKSR-GKRCHXXXXXXXXXQQKAXXXXX 120
           KS +P FR+ AE++ER A   MV+R   TS  W  R G   H                  
Sbjct: 75  KSHHPNFRRRAELVERSAST-MVRR---TSELWAPRDGASKHRLEESC------------ 118

Query: 121 XXXXXXXXXXXXXHRESVLLLDDRL-CRKRTSKRQKISNAIAKSKVNLKGYQLDMSIESK 179
                          E+   LDD +    R SKRQKI       K NLK Y+L MSIESK
Sbjct: 119 ---------------ETGTPLDDEVGPSPRVSKRQKI-------KENLKEYRLTMSIESK 156

Query: 180 KRLVTCLHLLKLANNQLSNRVGFLQDLVLKEQKLRKGRIRDRQXXXXXXXXXXXXXXNID 239
           K+L+TCLHLLKLAN QLS+ VG LQDLV KE++    R  + +               + 
Sbjct: 157 KQLITCLHLLKLANRQLSSTVGSLQDLVQKEREDSGPREPEEEDGEQYFDASETI---VS 213

Query: 240 ELSNVVKMEIVGTVKKVYSLISKFTGSSLPEPARTQVRESLLKLPMNWTSTMNSENLARY 299
           E S  +KME+VGTVKKVYSLIS+F GSSLPEPAR+QVRE+LLK+P NW+ T+NS +    
Sbjct: 214 ERSKEIKMEVVGTVKKVYSLISRFAGSSLPEPARSQVRETLLKMPTNWSLTVNSASRETP 273

Query: 300 TSSKGVSPNGKVLILAKESLGMVHNVMNVVDNTLGXXXXXXXXXXXXXXXXXXXYLHGRY 359
           T+++ +S N K+LILA+ESL MV N++ V D TLG                   Y+  + 
Sbjct: 274 TNAR-LSANSKMLILAEESLDMVSNIIQVFDMTLGRAEEWVKHKQELKELIKSQYMEAQL 332

Query: 360 REKVKTQI 367
           + KVK Q+
Sbjct: 333 KSKVKQQL 340

>YHL020C (OPI1) [2266] chr8 complement(66238..67452) Negative
           regulator of phospholipid biosynthesis pathway [1215 bp,
           404 aa]
          Length = 404

 Score =  184 bits (466), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 120/249 (48%), Positives = 138/249 (55%), Gaps = 64/249 (25%)

Query: 150 TSKRQKISNAIAKSKVNLKGYQLDMSIESKKRLVTCLHLLKLANNQLSNRVGFLQDLVLK 209
           T+KRQK+S AIAK K NLK Y+L+MSIESKKRLVTCLHLLKLAN QLS+++  LQDLV K
Sbjct: 107 TNKRQKLSRAIAKGKDNLKEYKLNMSIESKKRLVTCLHLLKLANKQLSDKISCLQDLVEK 166

Query: 210 EQ--KLRK--GRIRD-----------RQXXXXXXXXXXXXXXNIDELSNVVKMEIVGTVK 254
           EQ   L K  G  R             +              N  E S VVKME+VGTVK
Sbjct: 167 EQVHPLHKQDGNARTTTGAGEDETSSDEDDDDEEFFDASEQVNASEQSIVVKMEVVGTVK 226

Query: 255 KVYSLISKFTGSSLPEPARTQVRESLLKLPMNWTSTMNSENLARYTS------------- 301
           KVYSLISKFT +SLPEPAR+QVRESLL LP NW  +++S +L  + S             
Sbjct: 227 KVYSLISKFTANSLPEPARSQVRESLLNLPTNWFDSVHSTSLPHHASFHYANCEEQKVEQ 286

Query: 302 ------------------------------------SKGVSPNGKVLILAKESLGMVHNV 325
                                               S  V+ NGKVLILAKESL MV NV
Sbjct: 287 QQQQQQQQQQQQLLQQQLLQQQQQKRNKDGDDSASPSSSVTANGKVLILAKESLEMVRNV 346

Query: 326 MNVVDNTLG 334
           M VVD+TLG
Sbjct: 347 MGVVDSTLG 355

>CAGL0K03267g 299090..300553 similar to tr|AAB65073 Saccharomyces
           cerevisiae YHL020c Negative regulator of phospholipid
           biosynthesis, hypothetical start
          Length = 487

 Score =  182 bits (461), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 107/214 (50%), Positives = 137/214 (64%), Gaps = 26/214 (12%)

Query: 147 RKRTSKRQKISNAIAKSKVNLKGYQLDMSIESKKRLVTCLHLLKLANNQLSNRVGFLQDL 206
           R+  SKR+ +S A+AK + NL+ Y+L MSIESKKRL+TCLHLLKLAN QLS++V +LQD 
Sbjct: 196 RQYYSKRKALSEALAKGRYNLREYKLTMSIESKKRLITCLHLLKLANKQLSDKVAYLQDA 255

Query: 207 VLKEQKLRKGRIRDRQX----------XXXXXXXXXXXXXNIDELSNVVKMEIVGTVKKV 256
           V KEQ+L  G    ++                        ++D+ S  + +EIVGTVKKV
Sbjct: 256 VEKEQELANGEEVKKETRALNGEHSGPQNDDDLEFYDASESVDQNSGDLGLEIVGTVKKV 315

Query: 257 YSLISKFTGSSLPEPARTQVRESLLKLPMNWTSTM------NSENLARYTSSKG------ 304
           YSLISK+TGSSLPEPAR+QVRESLL LP NW +++      N   +   +SS        
Sbjct: 316 YSLISKYTGSSLPEPARSQVRESLLNLPSNWNTSVHNGFKNNGTGIMTASSSTDSLSSYS 375

Query: 305 ----VSPNGKVLILAKESLGMVHNVMNVVDNTLG 334
               VS NGK LILAKESL MV +V++VVD+TLG
Sbjct: 376 SILPVSSNGKYLILAKESLNMVQSVIDVVDSTLG 409

>Scas_709.57
          Length = 394

 Score =  175 bits (443), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 104/217 (47%), Positives = 132/217 (60%), Gaps = 33/217 (15%)

Query: 151 SKRQKISNAIAKSKVNLKGYQLDMSIESKKRLVTCLHLLKLANNQLSNRVGFLQ------ 204
           SKR+K+S A+ KSK N K Y+L+MSIESKKRL+TCLHLLKLAN QLS++V FLQ      
Sbjct: 145 SKRRKLSEALLKSKDNFKEYKLNMSIESKKRLITCLHLLKLANKQLSDKVTFLQELVEEE 204

Query: 205 ------DLVLKEQKLRKGRIRDRQXXXXXXXX------------XXXXXXNIDELSNVVK 246
                 D    E+K    R + +Q                          N DE   ++ 
Sbjct: 205 ETVKEEDSHAIEKKEHVVRNKKQQHTEHEDDEDEDEDEDEDEFFDANESVNYDEKCTIIN 264

Query: 247 MEIVGTVKKVYSLISKFTGSSLPEPARTQVRESLLKLPMNWTSTMNSENLARYTSSKGVS 306
           MEIVGT+KKVYSL+SK+ G+SLPEPARTQVRE+LL LP NWT ++N+   +  T+     
Sbjct: 265 MEIVGTIKKVYSLVSKYGGTSLPEPARTQVREALLNLPTNWTISVNNSFFSSSTAPAATE 324

Query: 307 P---------NGKVLILAKESLGMVHNVMNVVDNTLG 334
           P         NGKVLILAKESL +V N+M+VVD++LG
Sbjct: 325 PPKDEPLLTTNGKVLILAKESLNVVRNIMDVVDSSLG 361

>KLLA0F25388g complement(2362150..2363367) some similarities with
           sp|P21957 Saccharomyces cerevisiae YHL020c OPI1 negative
           regulator of phospholipid biosynthesis pathway
           singleton, hypothetical start
          Length = 405

 Score =  120 bits (300), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 87/131 (66%), Gaps = 6/131 (4%)

Query: 237 NIDELSNVVKMEIVGTVKKVYSLISKFTGSSLPEPARTQVRESLLKLPMNWTSTMNSENL 296
           +ID  +N +++E+VGT+KKVYS++S+FTG+SLPEPAR+QVRESLLKLP  W   +NSE  
Sbjct: 269 DIDAAANDIQLEVVGTLKKVYSVVSRFTGNSLPEPARSQVRESLLKLPTKW--MINSEK- 325

Query: 297 ARYTSSKGVSPNGKVLILAKESLGMVHNVMNVVDNTLGXXXXXXXXXXXXXXXXXXXYLH 356
               +SK +S N + L+LA+E+L MV NVMNVVD TLG                   + H
Sbjct: 326 ---PNSKRISSNKRALLLAQEALDMVGNVMNVVDGTLGKAEEWVKNKQELKQMLMEQFRH 382

Query: 357 GRYREKVKTQI 367
            + +++VK Q+
Sbjct: 383 EQLKQQVKHQL 393

 Score = 83.2 bits (204), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 103/207 (49%), Gaps = 41/207 (19%)

Query: 21  LAVEALRDLRNSH---------GQGQHDTLLDKVRSNALINNAVRVYEQSKSQYPKFRKG 71
           +AVEAL  LRN             G+ + LLDK++      +AV +YEQ+++ +PK  + 
Sbjct: 22  IAVEALDKLRNGDYSVTPSGSESSGKSERLLDKMK-----QSAVDLYEQTRTNHPKLIRR 76

Query: 72  AEMMERKAFIPMVKRLEKTSHKWKSRGKRCHXXXXXXXXXQQKAXXXXXXXXXXXXXXXX 131
           A+ +        VK++EKTS  W    KR            +                  
Sbjct: 77  ADRL--------VKKIEKTSGIWIGAAKR---------KIDEVDTQSNGDDDDSDDACVH 119

Query: 132 XXHRESVLLLDDRLC---RKRTSKRQKISNAIAKSKVNLKGYQLDMSIESKKRLVTCLHL 188
               E + +    +C   ++R SKR++I       K NLK YQL+MSIESKKRL+TCL L
Sbjct: 120 GLDIEHIKVQGKEICVTGKERGSKRRRI-------KENLKEYQLNMSIESKKRLMTCLGL 172

Query: 189 LKLANNQLSNRVGFLQDLVLKEQKLRK 215
           LKLAN QLS RV  LQD+V KEQ  R+
Sbjct: 173 LKLANKQLSQRVMSLQDVVKKEQLRRR 199

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.131    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,167,749
Number of extensions: 317820
Number of successful extensions: 1026
Number of sequences better than 10.0: 8
Number of HSP's gapped: 1039
Number of HSP's successfully gapped: 14
Length of query: 368
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 265
Effective length of database: 13,030,455
Effective search space: 3453070575
Effective search space used: 3453070575
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)