Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.815046245622310.0
KLLA0F25410g4874475692e-67
CAGL0K03245g4764264143e-45
Kwal_47.16725164643673.5
Sklu_1001.232293646.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.8150
         (456 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.8150                                                          863   0.0  
KLLA0F25410g 2363911..2365374 no similarity, hypothetical start       223   2e-67
CAGL0K03245g complement(297387..298817) weakly similar to KLLA0F...   164   3e-45
Kwal_47.16725                                                          30   3.5  
Sklu_1001.2 YOR287C, Contig c1001 242-1210 reverse complement          29   6.4  

>Kwal_26.8150
          Length = 462

 Score =  863 bits (2231), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/456 (93%), Positives = 427/456 (93%)

Query: 1   MGWQLTXXXXXXXXXXXXXXXXXLYANSGCKVPDKLPLLEYKDNRAIRCGVVIGSLRSQR 60
           MGWQLT                 LYANSGCKVPDKLPLLEYKDNRAIRCGVVIGSLRSQR
Sbjct: 1   MGWQLTWKSLGKRSSSSWSQLSQLYANSGCKVPDKLPLLEYKDNRAIRCGVVIGSLRSQR 60

Query: 61  DCAFLSALLADVYSSDQYWFEKFKGRFLSPKTRLIRYGPSLEVQDVGESKMVFTLPSPWL 120
           DCAFLSALLADVYSSDQYWFEKFKGRFLSPKTRLIRYGPSLEVQDVGESKMVFTLPSPWL
Sbjct: 61  DCAFLSALLADVYSSDQYWFEKFKGRFLSPKTRLIRYGPSLEVQDVGESKMVFTLPSPWL 120

Query: 121 QSHGVELLESDQVNQTGDDGCHVYLGVNALNLSTSPWPSFSINDSDNSSPLGTREVNSAL 180
           QSHGVELLESDQVNQTGDDGCHVYLGVNALNLSTSPWPSFSINDSDNSSPLGTREVNSAL
Sbjct: 121 QSHGVELLESDQVNQTGDDGCHVYLGVNALNLSTSPWPSFSINDSDNSSPLGTREVNSAL 180

Query: 181 ALAGVEKLINSKANASEYVRDMENSNFTNISKQLTQQICNREVVLQLLSGAVIKNIYETD 240
           ALAGVEKLINSKANASEYVRDMENSNFTNISKQLTQQICNREVVLQLLSGAVIKNIYETD
Sbjct: 181 ALAGVEKLINSKANASEYVRDMENSNFTNISKQLTQQICNREVVLQLLSGAVIKNIYETD 240

Query: 241 TSLAKRSELLTEKAKLERKIEEWAFDAHSFTQSSLKPQLDGFVKRQLSVFRLLTYXXXXX 300
           TSLAKRSELLTEKAKLERKIEEWAFDAHSFTQSSLKPQLDGFVKRQLSVFRLLTY     
Sbjct: 241 TSLAKRSELLTEKAKLERKIEEWAFDAHSFTQSSLKPQLDGFVKRQLSVFRLLTYSESRL 300

Query: 301 XXXXXXXCDRAIDSSISDRVQFIRGQLNIKLVPQKQAARDSCYLKVAQLHRTINKFIYQQ 360
                  CDRAIDSSISDRVQFIRGQLNIKLVPQKQAARDSCYLKVAQLHRTINKFIYQQ
Sbjct: 301 ELKLRELCDRAIDSSISDRVQFIRGQLNIKLVPQKQAARDSCYLKVAQLHRTINKFIYQQ 360

Query: 361 FFKLQLPLIVCSFVGTLSGQFSAYSMGSLAALGIVLGLSRVMHRWSEMLKQFEAEVLEGK 420
           FFKLQLPLIVCSFVGTLSGQFSAYSMGSLAALGIVLGLSRVMHRWSEMLKQFEAEVLEGK
Sbjct: 361 FFKLQLPLIVCSFVGTLSGQFSAYSMGSLAALGIVLGLSRVMHRWSEMLKQFEAEVLEGK 420

Query: 421 RLEIEAEKKALRQEIEIEYSAKSSLLEKKTGLLEVL 456
           RLEIEAEKKALRQEIEIEYSAKSSLLEKKTGLLEVL
Sbjct: 421 RLEIEAEKKALRQEIEIEYSAKSSLLEKKTGLLEVL 456

>KLLA0F25410g 2363911..2365374 no similarity, hypothetical start
          Length = 487

 Score =  223 bits (569), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 155/447 (34%), Positives = 227/447 (50%), Gaps = 37/447 (8%)

Query: 33  PDKLPLL---EYKDNRAIRCGVVIGSLRSQRDCAFLSALLADVYSSDQYWFEKFKGRFLS 89
           P KLPLL     KD R IRCG      R       L  LL DVYS+D+ W E++  R  S
Sbjct: 46  PAKLPLLTVPNVKDAR-IRCG-----FRGSEVGKLLDVLLMDVYSTDKSWMEQWLQRDRS 99

Query: 90  PKTRLIRYGPSLEVQDVG--ESKMVFTLPSPWLQSHGVELLE-SDQVNQT---GDDGCHV 143
            KT L+R+G    V  V   ++ + + LPSPWL     E+LE SD+  QT   G D CH+
Sbjct: 100 -KTSLVRHGDEFRVDSVSGLDNTVTYYLPSPWLAEAECEILEISDESKQTLNQGADQCHL 158

Query: 144 YLGVNALNLSTSPWPSFSINDSDNSSP-------------LGTREVNSALALAGVEKLIN 190
           Y  V         WPSF +     ++              L   E++   A     +   
Sbjct: 159 Y--VEKQTFPEPIWPSFMVVPRSGTASHFVDSTDSSSVSSLHGHEIDPVAAFDVSLQFAK 216

Query: 191 SKANASEYVRDMENSNFTNISKQLTQQICNREVVLQLLSGAVIKNIYETDTSLAKRSELL 250
            K+  S+Y+  ++++N  NISKQL  ++  +E +   L  AV++ I++ D S+ K  +L 
Sbjct: 217 DKSLVSKYLECLDSTNILNISKQLKIRLQGKEQIFCDLERAVLREIFKEDNSVEKYEKLK 276

Query: 251 TEKAKLERKIEEWAFDAHSFTQSSLKPQLDGFVKRQLSVFRLLTYXXXXXXXXXXXXCDR 310
             KA +   IEEW+ +AH   Q+S++P L  F  +QLS++++ TY            C+ 
Sbjct: 277 NSKASVNGTIEEWSREAHKELQTSIEPLLSDFASKQLSLWKVYTYSESKLSLKLHELCNI 336

Query: 311 AIDSSISDRVQFIRGQLNIKLVPQKQAA---RDSCYLKVAQLHRTINKFIYQQFFKLQLP 367
             D  +   +  I G L I   PQ + +    D    KV  LH+ INK +Y  F +LQ P
Sbjct: 337 TNDLQMVQNLSHIYGSLGI---PQDKLSIIDPDYARNKVPVLHKEINKAVYLNFLQLQFP 393

Query: 368 LIVCSFVGTLSGQFSAYSMGSLAALGIVLGLSRVMHRWSEMLKQFEAEVLEGKRLEIEAE 427
           LI  S  G ++   +AYSMG+L++LGIVLGL RV   W  MLKQF+ ++ E  R+ IE+ 
Sbjct: 394 LIAVSIGGFVTELCTAYSMGALSSLGIVLGLKRVKDTWYSMLKQFQLQIREECRIGIESN 453

Query: 428 KKALRQEIEIEYSAKSSLLEKKTGLLE 454
           K+ L    EI Y+ + + L+ K  LL+
Sbjct: 454 KQLLLHNWEISYAEREADLKGKVALLK 480

>CAGL0K03245g complement(297387..298817) weakly similar to
           KLLA0F25410g Kluyveromyces lactis, hypothetical start
          Length = 476

 Score =  164 bits (414), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 120/426 (28%), Positives = 208/426 (48%), Gaps = 45/426 (10%)

Query: 35  KLPLLEYKDNRAIRCGVVIGSLRSQRDCAFLSALLADVYSSDQYWFEKFKGRFLSPKTR- 93
           KL LL+  +N AIRCGV++ +    R  +F SA + D  +    W      R+++     
Sbjct: 33  KLRLLQ--ENTAIRCGVLMNT----RQGSFGSAFVTDKEALGSSWVPTLINRWVNEDKTP 86

Query: 94  -LIRYGPSLEVQDVGESKMVFTLPSPWLQSHGVELLESDQVNQTGD-------DGCHVYL 145
            L++YG   + +++      F +PS +L+    E+LE  + +Q+ D       DGCHVYL
Sbjct: 87  VLMKYGD--QFREINGEVRTFEIPSSFLKETNAEILEIPEQDQSKDKRLPHVHDGCHVYL 144

Query: 146 GVNALNLSTSP-WPSFSINDS-DNSSPLGTREVNSALALAGVEKLINSKANASEYVRDME 203
            +      + P WP+  I D       L T +++S +AL  + K  NS    SEY+    
Sbjct: 145 DIRGDPTVSQPTWPTIEIEDVLSKGKLLLTNQIDSQMALESLLKYNNS--TISEYLNKQN 202

Query: 204 NSNFTNISKQLTQQICNREVVLQLLSGAVIKNIYETDTSLAKRSELLTEKAKLERKIEEW 263
            SNF  I  +L  ++ +  ++   L  ++ + +  TD  ++    L+ ++     +I++W
Sbjct: 203 ASNFDRIRAKLVDKLKDGNLIRTELKSSIRRYLQSTDRDISNEKRLIGKRDLTNEEIDKW 262

Query: 264 AFDAHSFTQSSLKPQLDGFVKRQLSVFRLLTYXXXXXXXXXXXXC-------------DR 310
           A  +H   +  + P    F +  LS+++L TY            C              +
Sbjct: 263 AECSHKTLRDEIVPSFLSFARAHLSLWKLYTYSPAKLKLNFMEYCMIPLYKVHEIENSAK 322

Query: 311 AIDSSISDR--VQFIRGQLNIKLVPQKQAARDSCYLKVAQLHRTINKFIYQQFFKLQLPL 368
            +++++     ++ +  Q+   ++P  +        K+ ++   INK IY+QFF +QLP+
Sbjct: 323 VLEANMFREFDLETVSAQVMTPILPTTEIQ------KIGRIQTEINKAIYKQFFTIQLPM 376

Query: 369 IVCSFVGTLSGQFSAYSMGSLAALGIVLGLSRVMHRWSEMLKQFEAEV--LEGKRLEI-E 425
           ++C+ +G +S QFSAY MGSLAALGIVLG  R M +W  +L  +  +V  L   R+E+  
Sbjct: 377 VLCALLGVVSEQFSAYYMGSLAALGIVLGFWRCMKQWQYILNGYTRKVAFLLKDRIELRR 436

Query: 426 AEKKAL 431
           AE K L
Sbjct: 437 AELKKL 442

>Kwal_47.16725
          Length = 1646

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 222 EVVLQLLSGAVIKNIYETDTSLAKRSELLTEKAKLERKIEEWA 264
           EV++ ++ G +  NI        K +EL T+K KLERK+ +WA
Sbjct: 563 EVLVNMI-GNIYSNISSKKLQGQKVNELETQKNKLERKVNKWA 604

>Sklu_1001.2 YOR287C, Contig c1001 242-1210 reverse complement
          Length = 322

 Score = 29.3 bits (64), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 49/93 (52%), Gaps = 10/93 (10%)

Query: 174 REVNSALALAGVEKLINSKANASEYVRDMENSNFTNISKQLTQQICNREVVLQLLSGAVI 233
           RE++    +    K +N K +A E  +D   S FT++  +L Q I NR++  Q++ G   
Sbjct: 209 REIDELGTMLHDRKFLN-KISARE--KDELESKFTSMKSKL-QTIQNRDLERQIVKG--- 261

Query: 234 KNIYETDTSLAKRSELLTEKAKLERKIEEWAFD 266
              YE D +   +++   ++++  + I++W FD
Sbjct: 262 ---YEGDINKGNKTKYHLKESEKRKVIQKWKFD 291

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,602,905
Number of extensions: 507747
Number of successful extensions: 1811
Number of sequences better than 10.0: 16
Number of HSP's gapped: 1846
Number of HSP's successfully gapped: 17
Length of query: 456
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 351
Effective length of database: 12,961,219
Effective search space: 4549387869
Effective search space used: 4549387869
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)