Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.797644844222020.0
Sklu_1977.244444116610.0
CAGL0K02937g43843815670.0
KLLA0E18766g44644315570.0
AGL066W45044415480.0
Scas_489.3*43738615200.0
YKL027W44744414140.0
YHR003C42944010821e-145
CAGL0I01254g433127920.003
YHR111W (UBA4)440126920.003
Scas_658.7440122880.008
Sklu_2344.6439122850.018
AER248W44390770.19
Scas_692.4496117740.50
Sklu_2286.731337681.9
KLLA0E04697g71081682.6
Kwal_23.374131237672.9
ADL333C31945663.5
Kwal_55.2127860049664.1
Kwal_33.155671015136664.8
CAGL0M05643g176109644.8
CAGL0G09889g33654638.2
YMR098C61295648.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.7976
         (442 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.7976                                                          852   0.0  
Sklu_1977.2 YKL027W, Contig c1977 674-2008 reverse complement         644   0.0  
CAGL0K02937g complement(260273..261589) highly similar to sp|P36...   608   0.0  
KLLA0E18766g 1659258..1660598 similar to sp|P36101 Saccharomyces...   604   0.0  
AGL066W [4245] [Homologous to ScYKL027W - SH; ScYHR003C - SH] co...   600   0.0  
Scas_489.3*                                                           590   0.0  
YKL027W (YKL027W) [3228] chr11 (387205..388548) Protein with sim...   549   0.0  
YHR003C (YHR003C) [2288] chr8 complement(110022..111311) Member ...   421   e-145
CAGL0I01254g 102965..104266 highly similar to sp|P38820 Saccharo...    40   0.003
YHR111W (UBA4) [2399] chr8 (333074..334396) Ubiquitin-activating...    40   0.003
Scas_658.7                                                             39   0.008
Sklu_2344.6 YHR111W, Contig c2344 8194-9513                            37   0.018
AER248W [2750] [Homologous to ScYHR111W - SH] complement(1094793...    34   0.19 
Scas_692.4                                                             33   0.50 
Sklu_2286.7 YPR066W, Contig c2286 10225-11166                          31   1.9  
KLLA0E04697g 424886..427018 similar to sp|P24482 Saccharomyces c...    31   2.6  
Kwal_23.3741                                                           30   2.9  
ADL333C [1408] [Homologous to ScYPR066W (UBA3) - SH] (118151..11...    30   3.5  
Kwal_55.21278                                                          30   4.1  
Kwal_33.15567                                                          30   4.8  
CAGL0M05643g 603919..604449 similar to sp|Q07540 Saccharomyces c...    29   4.8  
CAGL0G09889g 944660..945670 similar to sp|Q06624 Saccharomyces c...    29   8.2  
YMR098C (YMR098C) [4056] chr13 complement(460770..462608) Protei...    29   8.3  

>Kwal_26.7976
          Length = 448

 Score =  852 bits (2202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/442 (94%), Positives = 418/442 (94%)

Query: 1   MSSENKWKTIVGTXXXXXXXXXXVDSLVQRYKDRNSFVTGRETNRSAAKAKSRNLRDYDD 60
           MSSENKWKTIVGT          VDSLVQRYKDRNSFVTGRETNRSAAKAKSRNLRDYDD
Sbjct: 1   MSSENKWKTIVGTAILAAAATKAVDSLVQRYKDRNSFVTGRETNRSAAKAKSRNLRDYDD 60

Query: 61  ELIREQLARNYAFLGEEGMKALKAQNXXXXXXXXXXXXXXTMLVRSGIYNIKVIDFDQVS 120
           ELIREQLARNYAFLGEEGMKALKAQN              TMLVRSGIYNIKVIDFDQVS
Sbjct: 61  ELIREQLARNYAFLGEEGMKALKAQNVVVVGAGGVGSWVVTMLVRSGIYNIKVIDFDQVS 120

Query: 121 LSSLNRHSCANLKDVGTSKVGCLKKHLQEIAPWCNIDAVHELWTKDNAQRLLFGENGDEK 180
           LSSLNRHSCANLKDVGTSKVGCLKKHLQEIAPWCNIDAVHELWTKDNAQRLLFGENGDEK
Sbjct: 121 LSSLNRHSCANLKDVGTSKVGCLKKHLQEIAPWCNIDAVHELWTKDNAQRLLFGENGDEK 180

Query: 181 PTFVIDCIDNIDTKVDLLEFVYVHQIPVISSMGAATKSDPTRINVGDLSTTEEDPLARTV 240
           PTFVIDCIDNIDTKVDLLEFVYVHQIPVISSMGAATKSDPTRINVGDLSTTEEDPLARTV
Sbjct: 181 PTFVIDCIDNIDTKVDLLEFVYVHQIPVISSMGAATKSDPTRINVGDLSTTEEDPLARTV 240

Query: 241 RRRLKQRGITKGITVVFSAEKPDPRKASLLPLPEDEFQKGKVDELSALKDFRVRILPVLG 300
           RRRLKQRGITKGITVVFSAEKPDPRKASLLPLPEDEFQKGKVDELSALKDFRVRILPVLG
Sbjct: 241 RRRLKQRGITKGITVVFSAEKPDPRKASLLPLPEDEFQKGKVDELSALKDFRVRILPVLG 300

Query: 301 TMPGVFGLTIASWLLTKISGYPMEPIVGKNRIKVYDGIYQSLAGQMTRIGRPDQRIPIAL 360
           TMPGVFGLTIASWLLTKISGYPMEPIVGKNRIKVYDGIYQSLAGQMTRIGRPDQRIPIAL
Sbjct: 301 TMPGVFGLTIASWLLTKISGYPMEPIVGKNRIKVYDGIYQSLAGQMTRIGRPDQRIPIAL 360

Query: 361 KEVGYICEEVFRGKSPVSGFSTRLTLSKWDPAKPVSLQNVVLLTKEEQKIHEDRVLNGGE 420
           KEVGYICEEVFRGKSPVSGFSTRLTLSKWDPAKPVSLQNVVLLTKEEQKIHEDRVLNGGE
Sbjct: 361 KEVGYICEEVFRGKSPVSGFSTRLTLSKWDPAKPVSLQNVVLLTKEEQKIHEDRVLNGGE 420

Query: 421 SLEDCYSQEVLDLVKRRFAEEA 442
           SLEDCYSQEVLDLVKRRFAEEA
Sbjct: 421 SLEDCYSQEVLDLVKRRFAEEA 442

>Sklu_1977.2 YKL027W, Contig c1977 674-2008 reverse complement
          Length = 444

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/441 (71%), Positives = 355/441 (80%), Gaps = 4/441 (0%)

Query: 1   MSSENKWKTIVGTXXXXXXXXXXVDSLVQRYKDRNSFVTGRETNRSAAKAKSRNLRDYDD 60
           MSS N WK  V +          +D  ++ YK+  + V   +T R   K  +     YDD
Sbjct: 1   MSSNNTWKVAVASALAAAAATKCIDLAIKNYKESGTIVP--QTKRHGKK--TTETEGYDD 56

Query: 61  ELIREQLARNYAFLGEEGMKALKAQNXXXXXXXXXXXXXXTMLVRSGIYNIKVIDFDQVS 120
           +L REQLARNYAFLGEEGM+ LK Q               TMLVRSG   IKVIDFDQVS
Sbjct: 57  DLFREQLARNYAFLGEEGMEKLKQQRIIVVGAGGVGSWVVTMLVRSGCQKIKVIDFDQVS 116

Query: 121 LSSLNRHSCANLKDVGTSKVGCLKKHLQEIAPWCNIDAVHELWTKDNAQRLLFGENGDEK 180
           LSSLNRHSCA LKDVG  KV CLK+H++ IAPWC +DAV+ELW+K+NA+RL+FGE+G   
Sbjct: 117 LSSLNRHSCATLKDVGVPKVECLKQHMKGIAPWCQVDAVNELWSKENAERLIFGEDGQYN 176

Query: 181 PTFVIDCIDNIDTKVDLLEFVYVHQIPVISSMGAATKSDPTRINVGDLSTTEEDPLARTV 240
           PTFVIDCIDNIDTKVDLLEFVY H IP ISSMGAATKSDPTRINVGDL+TTEEDPLARTV
Sbjct: 177 PTFVIDCIDNIDTKVDLLEFVYKHNIPRISSMGAATKSDPTRINVGDLTTTEEDPLARTV 236

Query: 241 RRRLKQRGITKGITVVFSAEKPDPRKASLLPLPEDEFQKGKVDELSALKDFRVRILPVLG 300
           RRRLK+RG+ KGI VVFSAEKPDPRKA LLPLPE+EFQKG+VDELSA++DFRVRILPVLG
Sbjct: 237 RRRLKKRGVIKGIPVVFSAEKPDPRKAKLLPLPEEEFQKGQVDELSAIRDFRVRILPVLG 296

Query: 301 TMPGVFGLTIASWLLTKISGYPMEPIVGKNRIKVYDGIYQSLAGQMTRIGRPDQRIPIAL 360
           TMPGVFGLTIA+W+LTK+SGYPMEPI GKNRIK+YDGIYQSLA QM+RIG PDQR+PIAL
Sbjct: 297 TMPGVFGLTIATWVLTKLSGYPMEPIEGKNRIKIYDGIYQSLASQMSRIGMPDQRVPIAL 356

Query: 361 KEVGYICEEVFRGKSPVSGFSTRLTLSKWDPAKPVSLQNVVLLTKEEQKIHEDRVLNGGE 420
            E+GYI EEVFRGKSPVSGFSTRLTLSKWDP+KPVSLQNVV+LTKEEQK HE R+LNG E
Sbjct: 357 SEIGYIVEEVFRGKSPVSGFSTRLTLSKWDPSKPVSLQNVVVLTKEEQKEHETRILNGTE 416

Query: 421 SLEDCYSQEVLDLVKRRFAEE 441
            LED YS E L  VK+RF EE
Sbjct: 417 RLEDVYSPEALATVKKRFVEE 437

>CAGL0K02937g complement(260273..261589) highly similar to sp|P36101
           Saccharomyces cerevisiae YKL027w or sp|P38756
           Saccharomyces cerevisiae YHR003c, start by similarity
          Length = 438

 Score =  608 bits (1567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/438 (67%), Positives = 343/438 (78%), Gaps = 9/438 (2%)

Query: 4   ENKWKTIVGTXXXXXXXXXXVDSLVQRYKDRNSFVTGRETNRSAAKAKSRNLRDYDDELI 63
           ++ WK +  T           +   ++Y ++   +T + + +   K      R+YDD L 
Sbjct: 3   KDHWKLVAVTAAVTITLTKIAEVAWKKYVEQKDAITQQVSVKKMLK------REYDDNLF 56

Query: 64  REQLARNYAFLGEEGMKALKAQNXXXXXXXXXXXXXXTMLVRSGIYNIKVIDFDQVSLSS 123
           REQLARNYAFLGE+GM+ LK Q               TML+RSG   I+VIDFDQVSLSS
Sbjct: 57  REQLARNYAFLGEDGMEKLKNQYIVVVGAGGVGSWVVTMLIRSGCKKIRVIDFDQVSLSS 116

Query: 124 LNRHSCANLKDVGTSKVGCLKKHLQEIAPWCNIDAVHELWTKDNAQRLLFGENGDEKPTF 183
           LNRHSCA L+DVG SKV CLK H+++IAPWC I+A++ LW K+N + LL G     KPT 
Sbjct: 117 LNRHSCATLEDVGASKVDCLKAHMEKIAPWCQIEAINSLWNKENGEELLLGGG---KPTM 173

Query: 184 VIDCIDNIDTKVDLLEFVYVHQIPVISSMGAATKSDPTRINVGDLSTTEEDPLARTVRRR 243
           V+DCIDNIDTKVDLLEF Y ++I VISSMGA+TKSDPTRINVGD++ TEEDPLAR VRRR
Sbjct: 174 VVDCIDNIDTKVDLLEFTYSNKIEVISSMGASTKSDPTRINVGDITITEEDPLARAVRRR 233

Query: 244 LKQRGITKGITVVFSAEKPDPRKASLLPLPEDEFQKGKVDELSALKDFRVRILPVLGTMP 303
           LK +GIT GI VVFSAEKPDPRKA LLPLP+DE+ KGKV ELSALKDFRVRILPVLGTMP
Sbjct: 234 LKIKGITTGINVVFSAEKPDPRKAKLLPLPDDEYSKGKVGELSALKDFRVRILPVLGTMP 293

Query: 304 GVFGLTIASWLLTKISGYPMEPIVGKNRIKVYDGIYQSLAGQMTRIGRPDQRIPIALKEV 363
           G+FGLTIA+W+LTK+SGYPM PI GKNRIKVYDGIYQSLAGQMTRIG PDQR+PIALKEV
Sbjct: 294 GIFGLTIATWILTKVSGYPMNPIEGKNRIKVYDGIYQSLAGQMTRIGMPDQRVPIALKEV 353

Query: 364 GYICEEVFRGKSPVSGFSTRLTLSKWDPAKPVSLQNVVLLTKEEQKIHEDRVLNGGESLE 423
           GYI EEVFRGKSPVSGFSTRLTLSKWDP KPVSLQNVV+LTKEEQK HE R+LNG E+L 
Sbjct: 354 GYIVEEVFRGKSPVSGFSTRLTLSKWDPKKPVSLQNVVVLTKEEQKEHEQRILNGKEALS 413

Query: 424 DCYSQEVLDLVKRRFAEE 441
           D YSQ+V+DLV +RF EE
Sbjct: 414 DVYSQDVIDLVNQRFEEE 431

>KLLA0E18766g 1659258..1660598 similar to sp|P36101 Saccharomyces
           cerevisiae YKL027w, start by similarity
          Length = 446

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/443 (67%), Positives = 346/443 (78%), Gaps = 6/443 (1%)

Query: 1   MSSENKWKTIVGTXXXXXXXXXXVDSLVQRYKDRNSF-VTGRETNRSAAKAKS-RNLRDY 58
           M ++N W+ I  T          +D  ++ +  R +   +G +  +    AK  R  R+Y
Sbjct: 1   MGNDN-WRVIASTAAITFAGVKFIDLAIKSWNKRTAASYSGSDNEKDVKLAKRLRETREY 59

Query: 59  DDELIREQLARNYAFLGEEGMKALKAQNXXXXXXXXXXXXXXTMLVRSGIYNIKVIDFDQ 118
           D+ L REQLARNYAFLGEEGM+ LK Q               TMLVRSG   IK+IDFDQ
Sbjct: 60  DNLLYREQLARNYAFLGEEGMEKLKEQYFIVVGAGGVGSWVVTMLVRSGACRIKIIDFDQ 119

Query: 119 VSLSSLNRHSCANLKDVGTSKVGCLKKHLQEIAPWCNIDAVHELWTKDNAQRLLFGENGD 178
           VSLSSLNRHSCA+L DVG SKV  L+ HLQ+IAPWCNI+  +ELW K+NA RL+FG   D
Sbjct: 120 VSLSSLNRHSCADLYDVGLSKVNVLRDHLQKIAPWCNIEVCNELWNKENADRLIFG---D 176

Query: 179 EKPTFVIDCIDNIDTKVDLLEFVYVHQIPVISSMGAATKSDPTRINVGDLSTTEEDPLAR 238
             PTFVIDCIDN+DTKVDLLE+ Y   IPVI+SMGAATKSDPTRINVGDL+ TEEDPLAR
Sbjct: 177 GTPTFVIDCIDNLDTKVDLLEYTYKKNIPVIASMGAATKSDPTRINVGDLTMTEEDPLAR 236

Query: 239 TVRRRLKQRGITKGITVVFSAEKPDPRKASLLPLPEDEFQKGKVDELSALKDFRVRILPV 298
           TVRRRLKQRGITKGI  VFSAEKPDP+KA LLPLPE+EFQKG VD+LSALKDFRVRILPV
Sbjct: 237 TVRRRLKQRGITKGIPAVFSAEKPDPKKAKLLPLPEEEFQKGNVDQLSALKDFRVRILPV 296

Query: 299 LGTMPGVFGLTIASWLLTKISGYPMEPIVGKNRIKVYDGIYQSLAGQMTRIGRPDQRIPI 358
           LGTMPGVFGLTIA+W+L KISGYPMEPI GKNRIK+YDGIYQSLAGQMTRIG+ DQRIPI
Sbjct: 297 LGTMPGVFGLTIATWVLCKISGYPMEPIEGKNRIKLYDGIYQSLAGQMTRIGQKDQRIPI 356

Query: 359 ALKEVGYICEEVFRGKSPVSGFSTRLTLSKWDPAKPVSLQNVVLLTKEEQKIHEDRVLNG 418
           AL ++GYI EEV+RGKSP+S +STRLTLSKWDP KPVS+QNV+LLTK+EQ+ HE R+LNG
Sbjct: 357 ALSDIGYIVEEVWRGKSPISNYSTRLTLSKWDPTKPVSIQNVILLTKDEQREHEARILNG 416

Query: 419 GESLEDCYSQEVLDLVKRRFAEE 441
            E+  D YS+E L ++ +RF EE
Sbjct: 417 TETFSDVYSEEALAMINKRFQEE 439

>AGL066W [4245] [Homologous to ScYKL027W - SH; ScYHR003C - SH]
           complement(584465..585817) [1353 bp, 450 aa]
          Length = 450

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/444 (67%), Positives = 349/444 (78%), Gaps = 4/444 (0%)

Query: 1   MSSENKWKTIVGTXXXXXXXXXXVDSLVQRY---KDRNSFVTGRETNRSAAKAKSRNLRD 57
           MS   K K ++GT          V+++ + Y   ++ +  ++G E +   AK + R  R 
Sbjct: 1   MSFNEKVKWVLGTAVATLVTIKSVEAVYRLYAAKQNTSRSISGEEKDVRLAK-RIRESRA 59

Query: 58  YDDELIREQLARNYAFLGEEGMKALKAQNXXXXXXXXXXXXXXTMLVRSGIYNIKVIDFD 117
           YD+EL REQLARNYAFLGE+GM  L+ Q               TMLVRSG   IKVIDFD
Sbjct: 60  YDEELYREQLARNYAFLGEDGMARLQEQYFIVVGAGGVGSWVVTMLVRSGCRKIKVIDFD 119

Query: 118 QVSLSSLNRHSCANLKDVGTSKVGCLKKHLQEIAPWCNIDAVHELWTKDNAQRLLFGENG 177
           QVSLSSLNRHSCA L DVG SKV  LK HL +IAPWC I+AV+ELW  D+A+RL+FG +G
Sbjct: 120 QVSLSSLNRHSCATLNDVGHSKVEVLKSHLLKIAPWCEIEAVNELWHIDSAERLIFGNDG 179

Query: 178 DEKPTFVIDCIDNIDTKVDLLEFVYVHQIPVISSMGAATKSDPTRINVGDLSTTEEDPLA 237
            +KPTFVIDCIDNI TKVDLLE+VY   IPVISSMGAATKSDPTRINVGDLSTTEED L+
Sbjct: 180 QDKPTFVIDCIDNISTKVDLLEYVYRKGIPVISSMGAATKSDPTRINVGDLSTTEEDSLS 239

Query: 238 RTVRRRLKQRGITKGITVVFSAEKPDPRKASLLPLPEDEFQKGKVDELSALKDFRVRILP 297
           R+VRRRLKQRGITKGI VVFSAEKPDP+KA LLPLPE+++  GKVDELSALKDFRVR+LP
Sbjct: 240 RSVRRRLKQRGITKGIPVVFSAEKPDPKKAKLLPLPEEQYLMGKVDELSALKDFRVRVLP 299

Query: 298 VLGTMPGVFGLTIASWLLTKISGYPMEPIVGKNRIKVYDGIYQSLAGQMTRIGRPDQRIP 357
           VLGTMPGVFGLTIA+W+L  I+GYPMEPI G+NRIK+YDGIY SLAGQM+RIG PDQR+P
Sbjct: 300 VLGTMPGVFGLTIATWVLCSIAGYPMEPIEGENRIKLYDGIYHSLAGQMSRIGMPDQRVP 359

Query: 358 IALKEVGYICEEVFRGKSPVSGFSTRLTLSKWDPAKPVSLQNVVLLTKEEQKIHEDRVLN 417
           +++ +V Y+ EEV+RGKSPVSG+STRLTLSKWDP++PVSLQNVVLLTKEEQ  HE R+LN
Sbjct: 360 VSVADVAYLVEEVYRGKSPVSGYSTRLTLSKWDPSQPVSLQNVVLLTKEEQTAHEARILN 419

Query: 418 GGESLEDCYSQEVLDLVKRRFAEE 441
           G E LED YS EV+ LV +R  EE
Sbjct: 420 GDERLEDVYSPEVIALVHQRLQEE 443

>Scas_489.3*
          Length = 437

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/386 (73%), Positives = 329/386 (85%), Gaps = 4/386 (1%)

Query: 56  RDYDDELIREQLARNYAFLGEEGMKALKAQNXXXXXXXXXXXXXXTMLVRSGIYNIKVID 115
           R+Y DEL REQLARNYAFLGEEGM+ LK Q               TMLVRSG   I+VID
Sbjct: 49  REYSDELFREQLARNYAFLGEEGMEKLKQQYIVVVGAGGVGSWVVTMLVRSGCTRIRVID 108

Query: 116 FDQVSLSSLNRHSCANLKDVGTSKVGCLKKHLQEIAPWCNIDAVHELWTKDNAQRLLFGE 175
           FDQVSLSSLNRHSCA LKDVGTSKVGCLK+H+ EIAPWC I+A++ELWTK++ +RL+FG 
Sbjct: 109 FDQVSLSSLNRHSCATLKDVGTSKVGCLKQHMAEIAPWCEIEAINELWTKESGERLIFGA 168

Query: 176 NGDEKPTFVIDCIDNIDTKVDLLEFVYVHQIPVISSMGAATKSDPTRINVGDLSTTEEDP 235
               +PTFV+DCIDN+DTKVDLLEFVY   I VISS G   K DPTRINVGD+S+TEEDP
Sbjct: 169 G---QPTFVVDCIDNLDTKVDLLEFVYNKNIDVISSHGGFYKGDPTRINVGDISSTEEDP 225

Query: 236 LARTVRRRLKQRGITKGITVVFSAEKPDPRKASLLPLPEDEFQKGKVDELSALKDFRVRI 295
           +AR+VRRRLK +GIT GI VVFSAEKPDPRKA LLPLP++E++KG+V ELSALKDFRVRI
Sbjct: 226 MARSVRRRLKIKGITTGIPVVFSAEKPDPRKAKLLPLPDEEYEKGQVGELSALKDFRVRI 285

Query: 296 LPVLGTMPGVFGLTIASWLLTKISGYPMEPIVGKNRIKVYDGIYQSLAGQMTRIGRPDQR 355
           LPVLGTMPG+FGLT+A+W+LTK++GYPM PI GKNRIKVYDGIYQSLAGQM+RIG+ +QR
Sbjct: 286 LPVLGTMPGIFGLTLATWILTKVAGYPMNPIEGKNRIKVYDGIYQSLAGQMSRIGK-EQR 344

Query: 356 IPIALKEVGYICEEVFRGKSPVSGFSTRLTLSKWDPAKPVSLQNVVLLTKEEQKIHEDRV 415
           +PIA+ ++GYI EEVFRGKSPVSG+STRLTLS+WDP KPVSLQNVV+LTK+EQK HE RV
Sbjct: 345 VPIAITDIGYIVEEVFRGKSPVSGYSTRLTLSQWDPEKPVSLQNVVILTKDEQKEHERRV 404

Query: 416 LNGGESLEDCYSQEVLDLVKRRFAEE 441
           LNGGE +E  YS++VLDL+K+RF EE
Sbjct: 405 LNGGEKIEGVYSKDVLDLIKKRFEEE 430

>YKL027W (YKL027W) [3228] chr11 (387205..388548) Protein with
           similarity to E. coli molybdopterin-converting factor
           [1344 bp, 447 aa]
          Length = 447

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/444 (60%), Positives = 326/444 (73%), Gaps = 5/444 (1%)

Query: 1   MSSENKWKTIVGTXXXXXXXXXXVDSLVQRYKDRNSFVTGRETNRSAAKAKSRN--LRDY 58
           M  ++ WK I  T           D     ++ +   +  ++      + KS       Y
Sbjct: 1   MVEKDTWKLITATALFTVAVTTITDYAWTSWQAQKQVIAQQKNKNKGGQTKSDTDKYHQY 60

Query: 59  DDELIREQLARNYAFLGEEGMKALKAQNXXXXXXXXXXXXXXTMLVRSGIYNIKVIDFDQ 118
           D++ IR+ L  N  FLGE+ ++ L  Q                 LVRSG   I+V+DFDQ
Sbjct: 61  DEQFIRQSLKNNVEFLGEDTIEKLSNQYVVVVGAGGVGSWVVNSLVRSGCRKIRVVDFDQ 120

Query: 119 VSLSSLNRHSCANLKDVGTSKVGCLKKHLQEIAPWCNIDAVHELWTKDNAQRLLFGENGD 178
           VSLSSLNRHSCA L DVGT KV CL++H++EIAPWC ID ++ELWT  N +RL  G NG 
Sbjct: 121 VSLSSLNRHSCAILNDVGTPKVECLRRHMREIAPWCEIDPINELWTLQNGERLTLG-NG- 178

Query: 179 EKPTFVIDCIDNIDTKVDLLEFVYVHQIPVISSMGAATKSDPTRINVGDLSTTEEDPLAR 238
             P F++DCIDNIDTKVDLLEF Y H I VISSMGA+ KSDPT++NVGDL+TTEEDPLAR
Sbjct: 179 -TPDFIVDCIDNIDTKVDLLEFAYNHGIKVISSMGASAKSDPTKLNVGDLATTEEDPLAR 237

Query: 239 TVRRRLKQRGITKGITVVFSAEKPDPRKASLLPLPEDEFQKGKVDELSALKDFRVRILPV 298
            VRR+LK+RGI  GI VVFSAEKPDP+KA LLPLP++E+++GKVDELSALKDFRVRILPV
Sbjct: 238 VVRRKLKKRGILSGIPVVFSAEKPDPKKAKLLPLPDEEYERGKVDELSALKDFRVRILPV 297

Query: 299 LGTMPGVFGLTIASWLLTKISGYPMEPIVGKNRIKVYDGIYQSLAGQMTRIGRPDQRIPI 358
           LGTMP +FGLTI +W+L+ IS  P+EP+ GKNRIKVYDGIYQSLAGQM+R+G P QRIP+
Sbjct: 298 LGTMPSLFGLTITTWILSNISDKPLEPVEGKNRIKVYDGIYQSLAGQMSRVGIPSQRIPL 357

Query: 359 ALKEVGYICEEVFRGKSPVSGFSTRLTLSKWDPAKPVSLQNVVLLTKEEQKIHEDRVLNG 418
           ALK+V Y+ EEVF+GKSP+SG STRLTL+KWDP+KP+SLQNVV+LTK EQK+HEDRVL G
Sbjct: 358 ALKDVSYLVEEVFKGKSPISGISTRLTLTKWDPSKPISLQNVVVLTKNEQKVHEDRVLKG 417

Query: 419 GESLEDCYSQEVLDLVKRRFAEEA 442
            ESL+D Y  +VL LV +RF EEA
Sbjct: 418 KESLQDVYDAKVLKLVSQRFREEA 441

>YHR003C (YHR003C) [2288] chr8 complement(110022..111311) Member of
           the UBA-THIF-type NAD-FAD binding fold family, has high
           similarity to uncharacterized C. albicans Orf6.4746p
           [1290 bp, 429 aa]
          Length = 429

 Score =  421 bits (1082), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 213/440 (48%), Positives = 290/440 (65%), Gaps = 17/440 (3%)

Query: 3   SENKWKTIVGTXXXXXXXXXXVDSLVQRYKDRNSFVTGRETNRSAAKAKSRNLRDYDDEL 62
           + N WK I  T            S+ + YK           N++ ++      R YDD L
Sbjct: 2   ANNTWKLIATTALISVFSTQLAKSVWKEYK----LSCAANKNKTVSRP-----RQYDDHL 52

Query: 63  IREQLARNYAFLGEEGMKALKAQNXXXXXXXXXXXXXXTMLVRSGIYNIKVIDFDQVSLS 122
            REQLARNYAFLGEEGM+ +K Q               TML+RSG   I +ID + +S+ 
Sbjct: 53  FREQLARNYAFLGEEGMRKIKEQYIVIVGAGEVGSWVCTMLIRSGCQKIMIIDPENISID 112

Query: 123 SLNRHSCANLKDVGTSKVGCLKKHLQEIAPWCNIDAVHELWTKDNAQRLLFGENGDEKPT 182
           SLN H CA L D+G  KV CLK+HL +IAPW  I A  + WTK+N+  L+F +   E PT
Sbjct: 113 SLNTHCCAVLSDIGKPKVQCLKEHLSKIAPWSEIKARAKAWTKENSHDLIFADG--ESPT 170

Query: 183 FVIDCIDNIDTKVDLLEFVYVHQIPVISSMGAATKSDPTRINVGDLSTTEEDPLARTVRR 242
           F++DC+DN+++KVDLLE+ + ++I VISSMG ATKSDPTR+++ D+S TE DP++R VRR
Sbjct: 171 FIVDCLDNLESKVDLLEYAHHNKIDVISSMGVATKSDPTRVSINDISMTEFDPISRCVRR 230

Query: 243 RLKQRGITKGITVVFSAEKPDPRKASLLPLPEDEFQKGKVDELSALKDFRVRILPVLGTM 302
           +L++RGI  GI+VVFS E  DPR+  +L   + E +      ++A++D  +R LP LGTM
Sbjct: 231 KLRKRGIATGISVVFSNEMLDPRRDDILSPIDCEHRA-----INAVRDEALRHLPELGTM 285

Query: 303 PGVFGLTIASWLLTKISGYPMEPIVGKNRIKVYDGIYQSLAGQMTRIGRPDQRIP-IALK 361
           PG+FGL+IA+W+LTK+SGYPM+    KNR+K YD I ++   QM R+    +R   + L+
Sbjct: 286 PGIFGLSIATWILTKVSGYPMKENEVKNRLKFYDSILETFQKQMARLNENKERSSLLGLE 345

Query: 362 EVGYICEEVFRGKSPVSGFSTRLTLSKWDPAKPVSLQNVVLLTKEEQKIHEDRVLNGGES 421
           EVGYI EE+FRGKSP+SG+ST+L L+KW+  K +SL NVVL+TKEEQ+IHE R+L  GE 
Sbjct: 346 EVGYIVEEMFRGKSPISGYSTKLALTKWEANKEISLTNVVLMTKEEQEIHEKRILLDGEK 405

Query: 422 LEDCYSQEVLDLVKRRFAEE 441
           L   YS+EVLD ++R F EE
Sbjct: 406 LTAVYSEEVLDFIERLFKEE 425

>CAGL0I01254g 102965..104266 highly similar to sp|P38820
           Saccharomyces cerevisiae YHR111w, start by similarity
          Length = 433

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 57/127 (44%), Gaps = 6/127 (4%)

Query: 103 LVRSGIYNIKVIDFDQVSLSSLNRHSCANLKDVGTSKVGCLKKHLQEIAPWCNIDAVHEL 162
           LV +G+  I ++D D V  S+L+R +  N   VG  K    K+ L+++ P  NI+     
Sbjct: 79  LVGAGVGTIGIVDNDIVDTSNLHRQTIHNTAKVGMLKCESAKQVLKDLNPHVNINTYPVR 138

Query: 163 WTKDNAQRLLFGENGDEKPTFVIDCIDNIDTKVDLLEFVYVHQIPVISSMGAATKSDPTR 222
              +NA  +    +       V+DC D   T+  + +        V+S+ G  T+   T 
Sbjct: 139 LGPENAFSIFADYD------IVMDCTDTPLTRYLISDVAVNLGKTVVSASGLGTEGQLTI 192

Query: 223 INVGDLS 229
           +N  ++ 
Sbjct: 193 LNFNNIG 199

>YHR111W (UBA4) [2399] chr8 (333074..334396) Ubiquitin-activating
           enzyme that activates ubiquitin related protein, Urm1p
           [1323 bp, 440 aa]
          Length = 440

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 57/126 (45%), Gaps = 6/126 (4%)

Query: 103 LVRSGIYNIKVIDFDQVSLSSLNRHSCANLKDVGTSKVGCLKKHLQEIAPWCNIDAVHEL 162
           L  +G+  I ++D D V  S+L+R    +   VG  K    ++++ ++ P  N+      
Sbjct: 86  LAGAGVGQIGIVDNDVVETSNLHRQVLHDSSRVGMLKCESARQYITKLNPHINVVTYPVR 145

Query: 163 WTKDNAQRLLFGENGDEKPTFVIDCIDNIDTKVDLLEFVYVHQIPVISSMGAATKSDPTR 222
               NA  +  G N      +++DC D+  T+  + +      I V+S+ G  T+   T 
Sbjct: 146 LNSSNAFDIFKGYN------YILDCTDSPLTRYLVSDVAVNLGITVVSASGLGTEGQLTI 199

Query: 223 INVGDL 228
           +N  ++
Sbjct: 200 LNFNNI 205

>Scas_658.7
          Length = 440

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 52/122 (42%), Gaps = 6/122 (4%)

Query: 103 LVRSGIYNIKVIDFDQVSLSSLNRHSCANLKDVGTSKVGCLKKHLQEIAPWCNIDAVHEL 162
           L  +G+  I ++D D V  S+L+R    +   VG  K    K+ L ++ P   I      
Sbjct: 89  LTGAGVGTIGIVDNDVVDTSNLHRQVLHDSTKVGMLKCESAKQVLNKLNPHVEIVTYPVR 148

Query: 163 WTKDNAQRLLFGENGDEKPTFVIDCIDNIDTKVDLLEFVYVHQIPVISSMGAATKSDPTR 222
               NA  +       EK   V+DC D   T+  + +      IPV+S+ G  T+   T 
Sbjct: 149 LDYSNAFEIF------EKYDCVLDCTDTPLTRYLISDVAVNVGIPVVSASGVGTEGQLTI 202

Query: 223 IN 224
           +N
Sbjct: 203 LN 204

>Sklu_2344.6 YHR111W, Contig c2344 8194-9513
          Length = 439

 Score = 37.4 bits (85), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 56/122 (45%), Gaps = 6/122 (4%)

Query: 103 LVRSGIYNIKVIDFDQVSLSSLNRHSCANLKDVGTSKVGCLKKHLQEIAPWCNIDAVHEL 162
           L  +GI +I ++D D V  S+L+R    +   VG  K    K+ L ++ P   +      
Sbjct: 86  LAGAGIGHIGIVDNDTVDTSNLHRQVLHDSTKVGMLKCESAKEVLNKLNPHVKVTTYPVR 145

Query: 163 WTKDNAQRLLFGENGDEKPTFVIDCIDNIDTKVDLLEFVYVHQIPVISSMGAATKSDPTR 222
            + +NA  +   EN D    +V+DC D   T+  + +      I VIS+ G  T+   + 
Sbjct: 146 LSCENAFEIF--ENYD----YVLDCTDTPLTRYLISDVAVNLGITVISASGLRTEGQLSI 199

Query: 223 IN 224
           +N
Sbjct: 200 LN 201

>AER248W [2750] [Homologous to ScYHR111W - SH]
           complement(1094793..1096124) [1332 bp, 443 aa]
          Length = 443

 Score = 34.3 bits (77), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 10/90 (11%)

Query: 103 LVRSGIYNIKVIDFDQVSLSSLNRHSCANLKDVGTSKVGCLKKHLQEIAPWCNIDAVHEL 162
           L  +GI ++ ++D D V  S+L+R    +   VG  K    K+ L  + P+C+I      
Sbjct: 90  LAGAGIGHLGIVDNDVVEESNLHRQPLHDTSKVGLLKCDSAKEALSRLNPYCSI------ 143

Query: 163 WTKDNAQRLLFGENGDEKPTF--VIDCIDN 190
             K    RL +    +  P++  ++DC D+
Sbjct: 144 --KTYPVRLSYANAFEIFPSWDLILDCTDS 171

>Scas_692.4
          Length = 496

 Score = 33.1 bits (74), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 50/117 (42%), Gaps = 22/117 (18%)

Query: 101 TMLVRSGIYNIKVIDFDQVS----LSSLNRHSCANLKDVGTSKVGCLKKHLQEI------ 150
           ++LV + +      DFD+ S    L  +N H  +NLKDV +  +  LKK   E+      
Sbjct: 10  SILVTTSLAAQSAFDFDKWSHNDLLDYVNDH-MSNLKDVASESMDDLKKDASEVWEQNAH 68

Query: 151 -APWCNIDAVHELWTKDNAQRLLFGENGDEKPTFVIDCIDNIDTKVDLLEFVYVHQI 206
             PW       + W  D+ Q      +     + V D + N  +K DL  F+  H+I
Sbjct: 69  PKPWW------KFWASDDKQFPWVKSSS----SPVSDWLFNSWSKEDLYNFLKKHKI 115

>Sklu_2286.7 YPR066W, Contig c2286 10225-11166
          Length = 313

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%)

Query: 103 LVRSGIYNIKVIDFDQVSLSSLNRHSCANLKDVGTSK 139
           L  +GI  I V+D D + L++LNR    + KD+G  K
Sbjct: 25  LSMAGIPKIHVVDMDTIELTNLNRQFLFHEKDIGKPK 61

>KLLA0E04697g 424886..427018 similar to sp|P24482 Saccharomyces
           cerevisiae YPR175w DPB2 DNA-directed DNA polymerase
           epsilon, subunit B singleton, start by similarity
          Length = 710

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 3/81 (3%)

Query: 339 YQSLAGQMTRIGRPDQRIPIAL-KEVGYICEEVFRGKSP--VSGFSTRLTLSKWDPAKPV 395
           + S+ G  T    P + IP +  +++  IC +V  G +P  ++  S  + L++ D A   
Sbjct: 511 WTSMVGLGTTTMWPQKIIPSSFTQKMSRICRKVHWGSNPLRIAYLSQEIVLTRDDLANRF 570

Query: 396 SLQNVVLLTKEEQKIHEDRVL 416
              N+V  T EE+K  E+  L
Sbjct: 571 KRYNIVFPTVEEEKYLENAEL 591

>Kwal_23.3741
          Length = 312

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%)

Query: 103 LVRSGIYNIKVIDFDQVSLSSLNRHSCANLKDVGTSK 139
           L   GI +I V+D D + LS+LNR      + +G SK
Sbjct: 25  LAMQGIPDIHVVDMDTIELSNLNRQFLFRERHIGHSK 61

>ADL333C [1408] [Homologous to ScYPR066W (UBA3) - SH]
           (118151..119110) [960 bp, 319 aa]
          Length = 319

 Score = 30.0 bits (66), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 23/45 (51%)

Query: 107 GIYNIKVIDFDQVSLSSLNRHSCANLKDVGTSKVGCLKKHLQEIA 151
           GI  + VID D V L++LNR       D+G  K     +++  +A
Sbjct: 33  GIPELHVIDMDTVELTNLNRQFLFRETDIGHPKAAVAARYINGLA 77

>Kwal_55.21278
          Length = 600

 Score = 30.0 bits (66), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 25/49 (51%)

Query: 103 LVRSGIYNIKVIDFDQVSLSSLNRHSCANLKDVGTSKVGCLKKHLQEIA 151
           LV  G   I ++D D + LS+LNR      +D+  +K     + ++ I+
Sbjct: 38  LVLMGFGEIHIVDLDTIDLSNLNRQFLFRQRDIKQAKATTAMRAIEHIS 86

>Kwal_33.15567
          Length = 1015

 Score = 30.0 bits (66), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 29/136 (21%), Positives = 59/136 (43%), Gaps = 10/136 (7%)

Query: 111 IKVIDFDQVSLSSLNRHSCANLKDVGTSKVGCLKKHLQEIAPWCNIDAVHEL-WTKDNA- 168
           I + D D +  S+LNR      KDVG +K     + +  + P    D   ++ W  +   
Sbjct: 459 IYITDNDSIEKSNLNRQFLFRSKDVGRNKSEVASEAVSSMNP----DLTGKIQWMTEKVG 514

Query: 169 --QRLLFGENGDEKPTFVIDCIDNIDTKVDLLEFVYVHQIPVISSMGAATKSDPTRI--N 224
                LF ++      FV + +DN+D +  +      ++ P++ S    TK +   +  N
Sbjct: 515 PESEDLFNDDFWTGLNFVTNALDNVDARTYVDRRCVFYKKPLLESGTLGTKGNTQVVIPN 574

Query: 225 VGDLSTTEEDPLARTV 240
           + +  ++  DP  +++
Sbjct: 575 LTESYSSSRDPPEKSI 590

>CAGL0M05643g 603919..604449 similar to sp|Q07540 Saccharomyces
           cerevisiae YDL120w YFH1 regulates mitochondrial iron
           accumulation, hypothetical start
          Length = 176

 Score = 29.3 bits (64), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 45/109 (41%), Gaps = 12/109 (11%)

Query: 264 PRKASLLPLPE-----DEFQKGKVDELSALKDFRVRILPVLGTMPGVFGLTIASWLLTKI 318
           P++   LPL +     + F +G  D L  L +   + +P +    GV  LT+A      I
Sbjct: 56  PKEVLELPLQQYHQHSESFLEGLFDNLEELSENYPQHIPEVEYSHGVMSLTVAGVGTYVI 115

Query: 319 SGYP-------MEPIVGKNRIKVYDGIYQSLAGQMTRIGRPDQRIPIAL 360
           +  P         P  G NR  +Y G + SL    T +   D+ +  AL
Sbjct: 116 NKQPPNKQIWLSSPNSGPNRFDLYKGEWISLRNNETLLSVLDKELHDAL 164

>CAGL0G09889g 944660..945670 similar to sp|Q06624 Saccharomyces
           cerevisiae YPR180w AOS1, hypothetical start
          Length = 336

 Score = 28.9 bits (63), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 27/54 (50%)

Query: 103 LVRSGIYNIKVIDFDQVSLSSLNRHSCANLKDVGTSKVGCLKKHLQEIAPWCNI 156
           +V SGI ++ V+D   V+ + L         DVG  +V  +   LQ++ P  N+
Sbjct: 48  IVLSGIGHLTVLDSHIVNETDLGSQFFLTANDVGKKRVEAVSDRLQDMNPRVNL 101

>YMR098C (YMR098C) [4056] chr13 complement(460770..462608) Protein
           of unknown function [1839 bp, 612 aa]
          Length = 612

 Score = 29.3 bits (64), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 45/95 (47%), Gaps = 6/95 (6%)

Query: 326 IVGKNRIKVYDGIYQSLAGQMTRIGRPDQRIPIALKEVGYICEE----VFRGKSPVSGFS 381
            + K   K  + I QS +G  T   R  + +   LK++  + +E    V + KS     S
Sbjct: 306 FLQKEDFKGANKIIQSSSGTETHNIRTLEHVKNTLKDL--VGQERKVDVVQWKSLFDEHS 363

Query: 382 TRLTLSKWDPAKPVSLQNVVLLTKEEQKIHEDRVL 416
           T LT+++     P+ L+  +LL K + + + DRV 
Sbjct: 364 TFLTINQSAAYWPLRLEYAILLNKADPQFYSDRVF 398

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.135    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,269,196
Number of extensions: 548201
Number of successful extensions: 1420
Number of sequences better than 10.0: 35
Number of HSP's gapped: 1419
Number of HSP's successfully gapped: 35
Length of query: 442
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 337
Effective length of database: 12,961,219
Effective search space: 4367930803
Effective search space used: 4367930803
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)