Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.768251851125420.0
Sklu_1477.257652112071e-161
Scas_336.148648211701e-156
KLLA0C14278g5415349731e-126
Scas_721.1325844929751e-126
CAGL0K11550g5385039701e-126
YKL116C (PRR1)5185349151e-118
ABL055C5363398881e-113
KLLA0C01650g11121802808e-26
AFR696C11421802781e-25
Scas_493.211171432735e-25
CAGL0K05709g11031652691e-24
YDR507C (GIN4)11421812664e-24
YKL101W (HSL1)15181442612e-23
KLLA0A03806g6021692564e-23
Scas_660.286232662565e-23
CAGL0K08514g14891442575e-23
CAGL0M08910g6121692531e-22
Kwal_26.87098291782541e-22
YCL024W (KCC4)10371662503e-22
YDR477W (SNF1)6331692494e-22
AEL230W6081692468e-22
ABL034W14251442488e-22
Kwal_47.182335981692451e-21
Scas_616.1014611442452e-21
Scas_640.14*7281712432e-21
CAGL0J03872g6611782423e-21
Kwal_26.778812671442407e-21
KLLA0F13552g12671442408e-21
YPL141C8651812371e-20
CAGL0M02299g8931432372e-20
CAGL0M02519g7562402343e-20
ACR133C8511502325e-20
YOR233W (KIN4)8001712317e-20
ACR119W9311792318e-20
Scas_700.348641712301e-19
Kwal_56.237178581422237e-19
YLR096W (KIN2)11472132238e-19
Kwal_26.87518481442221e-18
AGR058W10711422221e-18
KLLA0F11319g8431422201e-18
Scas_700.288961422192e-18
CAGL0M11396g11921422174e-18
KLLA0D07348g9091682165e-18
Sklu_2361.38841422157e-18
KLLA0B07205g4552702128e-18
Scas_690.133542622081e-17
Scas_693.1710491422141e-17
Scas_564.712101422141e-17
CAGL0B01925g9441482131e-17
KLLA0F11143g8131882131e-17
YDR122W (KIN1)10641422112e-17
CAGL0G09020g3611412053e-17
KLLA0F19536g11041422094e-17
YKL166C (TPK3)3983272045e-17
KLLA0D03190g3722622045e-17
YJL164C (TPK1)3973222045e-17
KLLA0E01584g4151462045e-17
CAGL0L07326g5061872048e-17
CAGL0M08404g4622482021e-16
ACR142W8371732032e-16
KLLA0F07623g12291542032e-16
YPL203W (TPK2)3801411983e-16
Sklu_2086.42431501923e-16
AFL090W3461411973e-16
Kwal_56.240593531411964e-16
Scas_651.183712481956e-16
ACR191C11491431996e-16
Scas_613.55171861977e-16
YPL150W9011431997e-16
YPL153C (RAD53)8211761988e-16
Kwal_33.138463752491948e-16
Scas_689.25*4091421941e-15
Scas_715.3411501431971e-15
CAGL0J11638g7461451952e-15
YDL101C (DUN1)5131871942e-15
CAGL0F00913g12061321943e-15
Kwal_26.715412131311934e-15
Scas_548.613821321926e-15
Sklu_2211.511751431916e-15
Kwal_27.1058111541431917e-15
YBL105C (PKC1)11511431908e-15
CAGL0H06259g13361481909e-15
Kwal_27.100047351731899e-15
CAGL0F00649g5142381871e-14
AEL115C3862701861e-14
ACR281C12591321891e-14
Scas_700.546981681871e-14
Kwal_26.87967961711881e-14
YAL017W (PSK1)13561321881e-14
AFL188C4721461861e-14
Scas_580.610151421872e-14
KLLA0E06413g11611431872e-14
CAGL0M02233g7671791872e-14
Kwal_23.35904991481852e-14
YDR523C (SPS1)4901741852e-14
KLLA0B02332g3611421823e-14
KLLA0F23507g4873661833e-14
Scas_627.73491431804e-14
KLLA0B12716g7161421835e-14
Kwal_47.167617441461827e-14
Kwal_56.240913811421788e-14
YKL126W (YPK1)6801421818e-14
YPL209C (IPL1)3671421788e-14
CAGL0K07458g7041421801e-13
YFR014C (CMK1)4461711791e-13
Kwal_47.183076211751791e-13
AAL029W5341591781e-13
KLLA0F12188g5461591782e-13
CAGL0L11550g10721421792e-13
Scas_201.1*2741621722e-13
KLLA0B03586g7341461782e-13
KLLA0F23155g4272091762e-13
Scas_707.349052771782e-13
YCR008W (SAT4)6031421772e-13
KLLA0C17160g8311821773e-13
ACL006W7081441773e-13
Scas_703.57491461773e-13
CAGL0K01661g4821451763e-13
Scas_593.14d4952701763e-13
ADL389W7111461773e-13
Scas_628.96211461763e-13
ABL028W7221421763e-13
Scas_644.157261431763e-13
Sklu_2430.57331421764e-13
Scas_618.156202271754e-13
CAGL0M09361g11441391764e-13
YOL045W (PSK2)11012011764e-13
ADR300C8901521746e-13
Scas_653.256661541746e-13
Scas_721.1246841421746e-13
YHR205W (SCH9)8241411746e-13
Kwal_55.201898121501746e-13
YLR248W (RCK2)6102261738e-13
YMR104C (YPK2)6771421738e-13
YHR082C (KSP1)10291511739e-13
Scas_643.2010821321739e-13
YHR102W (KIC1)10801421739e-13
Sklu_2429.54321651701e-12
Kwal_27.97638681481721e-12
CAGL0F09075g7461461721e-12
Sklu_2118.24261671701e-12
YMR001C (CDC5)7051431711e-12
CAGL0K10604g4461681701e-12
AAR009W4531651701e-12
CAGL0K03399g7031421702e-12
KLLA0C04191g7971731712e-12
CAGL0J04972g3391101672e-12
YDR466W (PKH3)8982361702e-12
Kwal_33.132221481141572e-12
YGL180W (ATG1)8971821702e-12
CAGL0E05720g3581801672e-12
Kwal_55.215458651881702e-12
CAGL0L07810g5961421692e-12
Kwal_0.964271651672e-12
KLLA0B13607g9892181693e-12
AFL101C3671421663e-12
KLLA0F24618g5561731683e-12
ACL054W9721821693e-12
YDL025C6201451673e-12
ACL104C9471421674e-12
Kwal_14.12734152051654e-12
AER223C9021471675e-12
Kwal_47.172528721821675e-12
Kwal_26.76356911421665e-12
CAGL0M13541g6221621665e-12
Sklu_2342.55631591665e-12
KLLA0E21780g10162091675e-12
CAGL0L06006g9422511666e-12
Scas_673.20*7581411666e-12
CAGL0I07513g10761541667e-12
Kwal_0.3074901421647e-12
Scas_668.228931411657e-12
KLLA0C06138g7081441657e-12
YOL100W (PKH2)10811531658e-12
CAGL0F04741g4421591639e-12
Kwal_56.224766971451649e-12
Kwal_23.52908191551649e-12
ABR014W9711411641e-11
YHL007C (STE20)9391411641e-11
ADR313W5781401631e-11
Kwal_27.115427911651631e-11
Kwal_0.1555872261621e-11
CAGL0F03311g10451511632e-11
AEL083W5361511612e-11
CAGL0C05005g10761441632e-11
CAGL0B03509g5972281622e-11
YOL016C (CMK2)4471651612e-11
CAGL0K02673g9151411622e-11
AEL205W7931501622e-11
YCR073C (SSK22)13312791622e-11
Kwal_26.78619551411622e-11
Kwal_23.42765211601602e-11
YJL106W (IME2)6451051612e-11
Scas_618.84271421592e-11
Scas_716.734161831592e-11
YOL113W (SKM1)6551571602e-11
Scas_685.245151621593e-11
KLLA0C03938g5931671603e-11
AER195C5041421593e-11
Kwal_26.75524611371593e-11
AER264C14832681603e-11
KLLA0F01408g2921251553e-11
Scas_717.696741421593e-11
KLLA0E11979g6141421594e-11
YNL298W (CLA4)8421551594e-11
Kwal_23.632515421791604e-11
Scas_711.157271101594e-11
AEL179W2891121544e-11
KLLA0C04213g3941681564e-11
YDL214C (PRR2)6991481585e-11
CAGL0M03729g8611551595e-11
KLLA0E17127g8521511585e-11
YGL158W (RCK1)5121481575e-11
Sklu_2099.24201221575e-11
Kwal_33.131125051731575e-11
CAGL0G04455g7511051585e-11
KLLA0A07403g8791491586e-11
CAGL0H01639g5211551576e-11
Scas_573.105692291567e-11
CAGL0M10153g8671411577e-11
Kwal_27.97734061861557e-11
Scas_584.1110741501578e-11
YKL139W (CTK1)5281151568e-11
AFR377C7261731568e-11
Scas_700.354391281559e-11
Kwal_56.227885152811559e-11
Scas_598.67901551561e-10
KLLA0F02838g7551091561e-10
Kwal_56.226939841511561e-10
YBR028C5253001551e-10
CAGL0K06479g9912241561e-10
Kwal_33.136817151401551e-10
AEL284C4791761532e-10
Kwal_33.141925771451532e-10
Kwal_23.34712601571482e-10
YAR018C (KIN3)4351891512e-10
Scas_675.25271481513e-10
YNL020C (ARK1)6381591513e-10
Sklu_1722.28091371513e-10
KLLA0D08415g7741441513e-10
Scas_720.9416833121524e-10
KLLA0B07579g7221401514e-10
Scas_718.906471451514e-10
CAGL0K04301g3551501484e-10
ACR117W5241261495e-10
AER222C4232121485e-10
Scas_671.167231591505e-10
Kwal_26.72766461391495e-10
YDR490C (PKH1)7662271505e-10
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.7682
         (511 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.7682                                                          983   0.0  
Sklu_1477.2 YKL116C, Contig c1477 684-2414 reverse complement         469   e-161
Scas_336.1                                                            455   e-156
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...   379   e-126
Scas_721.132                                                          380   e-126
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...   378   e-126
YKL116C (PRR1) [3148] chr11 complement(220990..222546) Serine/th...   357   e-118
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...   346   e-113
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...   112   8e-26
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...   111   1e-25
Scas_493.2                                                            109   5e-25
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...   108   1e-24
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...   107   4e-24
YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine pr...   105   2e-23
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....   103   4e-23
Scas_660.28                                                           103   5e-23
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...   103   5e-23
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...   102   1e-22
Kwal_26.8709                                                          102   1e-22
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...   100   3e-22
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...   100   4e-22
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...    99   8e-22
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...   100   8e-22
Kwal_47.18233                                                          99   1e-21
Scas_616.10                                                            99   2e-21
Scas_640.14*                                                           98   2e-21
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...    98   3e-21
Kwal_26.7788                                                           97   7e-21
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...    97   8e-21
YPL141C (YPL141C) [5305] chr16 complement(283463..286060) Serine...    96   1e-20
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...    96   2e-20
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...    95   3e-20
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...    94   5e-20
YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine pr...    94   7e-20
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...    94   8e-20
Scas_700.34                                                            93   1e-19
Kwal_56.23717                                                          91   7e-19
YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine pr...    91   8e-19
Kwal_26.8751                                                           90   1e-18
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...    90   1e-18
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    89   1e-18
Scas_700.28                                                            89   2e-18
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...    88   4e-18
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...    88   5e-18
Sklu_2361.3 YPL150W, Contig c2361 3677-6331                            87   7e-18
KLLA0B07205g complement(624606..625973) some similarities with s...    86   8e-18
Scas_690.13                                                            85   1e-17
Scas_693.17                                                            87   1e-17
Scas_564.7                                                             87   1e-17
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...    87   1e-17
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...    87   1e-17
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...    86   2e-17
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...    84   3e-17
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...    85   4e-17
YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic...    83   5e-17
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...    83   5e-17
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...    83   5e-17
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...    83   5e-17
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...    83   8e-17
CAGL0M08404g complement(836791..838179) some similarities with s...    82   1e-16
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...    83   2e-16
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    83   2e-16
YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit o...    81   3e-16
Sklu_2086.4 , Contig c2086 6437-7168 reverse complement                79   3e-16
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...    80   3e-16
Kwal_56.24059                                                          80   4e-16
Scas_651.18                                                            80   6e-16
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...    81   6e-16
Scas_613.5                                                             80   7e-16
YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine...    81   7e-16
YPL153C (RAD53) [5294] chr16 complement(261726..264191) Serine/t...    81   8e-16
Kwal_33.13846                                                          79   8e-16
Scas_689.25*                                                           79   1e-15
Scas_715.34                                                            80   1e-15
CAGL0J11638g complement(1128620..1130860) highly similar to sp|P...    80   2e-15
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...    79   2e-15
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    79   3e-15
Kwal_26.7154                                                           79   4e-15
Scas_548.6                                                             79   6e-15
Sklu_2211.5 YBL105C, Contig c2211 10237-13764                          78   6e-15
Kwal_27.10581                                                          78   7e-15
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...    78   8e-15
CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces c...    78   9e-15
Kwal_27.10004                                                          77   9e-15
CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces cer...    77   1e-14
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...    76   1e-14
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    77   1e-14
Scas_700.54                                                            77   1e-14
Kwal_26.8796                                                           77   1e-14
YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine prote...    77   1e-14
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...    76   1e-14
Scas_580.6                                                             77   2e-14
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....    77   2e-14
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...    77   2e-14
Kwal_23.3590                                                           76   2e-14
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...    76   2e-14
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...    75   3e-14
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    75   3e-14
Scas_627.7                                                             74   4e-14
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...    75   5e-14
Kwal_47.16761                                                          75   7e-14
Kwal_56.24091                                                          73   8e-14
YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine pr...    74   8e-14
YPL209C (IPL1) [5240] chr16 complement(156489..157592) Serine/th...    73   8e-14
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...    74   1e-13
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...    74   1e-13
Kwal_47.18307                                                          74   1e-13
AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W (R...    73   1e-13
KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces...    73   2e-13
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    74   2e-13
Scas_201.1*                                                            71   2e-13
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...    73   2e-13
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...    72   2e-13
Scas_707.34                                                            73   2e-13
YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine prot...    73   2e-13
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...    73   3e-13
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...    73   3e-13
Scas_703.5                                                             73   3e-13
CAGL0K01661g complement(146952..148400) some similarities with t...    72   3e-13
Scas_593.14d                                                           72   3e-13
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...    73   3e-13
Scas_628.9                                                             72   3e-13
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...    72   3e-13
Scas_644.15                                                            72   3e-13
Sklu_2430.5 YKL126W, Contig c2430 8144-10345                           72   4e-13
Scas_618.15                                                            72   4e-13
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...    72   4e-13
YOL045W (PSK2) [4773] chr15 (243495..246800) Serine/threonine pr...    72   4e-13
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    72   6e-13
Scas_653.25                                                            72   6e-13
Scas_721.124                                                           72   6e-13
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...    72   6e-13
Kwal_55.20189                                                          72   6e-13
YLR248W (RCK2) [3644] chr12 (634254..636086) Calcium/calmodulin-...    71   8e-13
YMR104C (YPK2) [4061] chr13 complement(473419..475452) Serine/th...    71   8e-13
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    71   9e-13
Scas_643.20                                                            71   9e-13
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    71   9e-13
Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement        70   1e-12
Kwal_27.9763                                                           71   1e-12
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...    71   1e-12
Sklu_2118.2 YAR018C, Contig c2118 1397-2677                            70   1e-12
YMR001C (CDC5) [3966] chr13 complement(269019..271136) Serine/th...    70   1e-12
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...    70   1e-12
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...    70   1e-12
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...    70   2e-12
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...    70   2e-12
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    69   2e-12
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...    70   2e-12
Kwal_33.13222                                                          65   2e-12
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...    70   2e-12
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...    69   2e-12
Kwal_55.21545                                                          70   2e-12
CAGL0L07810g complement(857656..859446) similar to sp|P25333 Sac...    70   2e-12
Kwal_0.96                                                              69   2e-12
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    70   3e-12
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...    69   3e-12
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...    69   3e-12
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...    70   3e-12
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    69   3e-12
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...    69   4e-12
Kwal_14.1273                                                           68   4e-12
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....    69   5e-12
Kwal_47.17252                                                          69   5e-12
Kwal_26.7635                                                           69   5e-12
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    69   5e-12
Sklu_2342.5 YMR291W, Contig c2342 6908-8599 reverse complement         69   5e-12
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...    69   5e-12
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...    69   6e-12
Scas_673.20*                                                           69   6e-12
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...    69   7e-12
Kwal_0.307                                                             68   7e-12
Scas_668.22                                                            68   7e-12
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...    68   7e-12
YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine pr...    68   8e-12
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...    67   9e-12
Kwal_56.22476                                                          68   9e-12
Kwal_23.5290                                                           68   9e-12
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    68   1e-11
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    68   1e-11
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    67   1e-11
Kwal_27.11542                                                          67   1e-11
Kwal_0.155                                                             67   1e-11
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    67   2e-11
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....    67   2e-11
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...    67   2e-11
CAGL0B03509g complement(349638..351431) similar to sp|P38623 Sac...    67   2e-11
YOL016C (CMK2) [4800] chr15 complement(294777..296120) Calcium/c...    67   2e-11
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...    67   2e-11
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    67   2e-11
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    67   2e-11
Kwal_26.7861                                                           67   2e-11
Kwal_23.4276                                                           66   2e-11
YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine pr...    67   2e-11
Scas_618.8                                                             66   2e-11
Scas_716.73                                                            66   2e-11
YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine pr...    66   2e-11
Scas_685.24                                                            66   3e-11
KLLA0C03938g complement(358851..360632) some similarities with s...    66   3e-11
AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH] (1005431..1...    66   3e-11
Kwal_26.7552                                                           66   3e-11
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...    66   3e-11
KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183 Sacch...    64   3e-11
Scas_717.69                                                            66   3e-11
KLLA0E11979g complement(1060048..1061892) some similarities with...    66   4e-11
YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine prot...    66   4e-11
Kwal_23.6325                                                           66   4e-11
Scas_711.15                                                            66   4e-11
AEL179W [2327] [Homologous to NOHBY] complement(302948..303817) ...    64   4e-11
KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces c...    65   4e-11
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    65   5e-11
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    66   5e-11
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    65   5e-11
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...    65   5e-11
Sklu_2099.2 , Contig c2099 975-2237 reverse complement                 65   5e-11
Kwal_33.13112                                                          65   5e-11
CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces c...    65   5e-11
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    65   6e-11
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...    65   6e-11
Scas_573.10                                                            65   7e-11
CAGL0M10153g complement(1010688..1013291) some similarities with...    65   7e-11
Kwal_27.9773                                                           64   7e-11
Scas_584.11                                                            65   8e-11
YKL139W (CTK1) [3128] chr11 (182963..184549) C-terminal domain (...    65   8e-11
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...    65   8e-11
Scas_700.35                                                            64   9e-11
Kwal_56.22788                                                          64   9e-11
Scas_598.6                                                             65   1e-10
KLLA0F02838g 264329..266596 some similarities with sp|P32581 Sac...    65   1e-10
Kwal_56.22693                                                          65   1e-10
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...    64   1e-10
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...    65   1e-10
Kwal_33.13681                                                          64   1e-10
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    64   2e-10
Kwal_33.14192                                                          64   2e-10
Kwal_23.3471                                                           62   2e-10
YAR018C (KIN3) [73] chr1 complement(170393..171700) Serine/threo...    63   2e-10
Scas_675.2                                                             63   3e-10
YNL020C (ARK1) [4567] chr14 complement(595621..597537) Serine/th...    63   3e-10
Sklu_1722.2 YJL187C, Contig c1722 1158-3587 reverse complement         63   3e-10
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    63   3e-10
Scas_720.94                                                            63   4e-10
KLLA0B07579g 659591..661759 weakly similar to sp|P32944 Saccharo...    63   4e-10
Scas_718.90                                                            63   4e-10
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    62   4e-10
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    62   5e-10
AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH] (1043479..1...    62   5e-10
Scas_671.16                                                            62   5e-10
Kwal_26.7276                                                           62   5e-10
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...    62   5e-10
KLLA0E08371g complement(756205..758538) similar to sp|P40494 Sac...    62   5e-10
CAGL0H01837g complement(176352..178736) tr|Q9C1R8 Candida glabra...    62   6e-10
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...    62   7e-10
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    62   7e-10
Scas_713.7                                                             62   7e-10
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...    62   7e-10
Scas_655.2                                                             62   8e-10
Scas_677.18                                                            62   9e-10
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...    61   9e-10
YNL183C (NPR1) [4417] chr14 complement(293137..295509) Serine/th...    62   9e-10
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...    61   1e-09
Scas_613.13*                                                           60   1e-09
Kwal_26.8703                                                           61   1e-09
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    61   1e-09
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...    61   1e-09
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    61   1e-09
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...    61   1e-09
Sklu_2436.14 YDR466W, Contig c2436 31299-33653                         61   1e-09
CAGL0G02607g complement(240244..242310) similar to sp|P40494 Sac...    61   1e-09
Kwal_33.13831                                                          61   2e-09
Scas_502.2                                                             61   2e-09
Scas_721.110                                                           60   2e-09
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    61   2e-09
Scas_640.16                                                            60   2e-09
YOR267C (HRK1) [5054] chr15 complement(822585..824864) Serine/th...    60   2e-09
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    60   2e-09
YKL198C (PTK1) [3074] chr11 complement(68274..70223) Protein con...    60   2e-09
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...    60   2e-09
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    59   4e-09
YJR059W (PTK2) [2953] chr10 (545701..548157) Serine/threonine pr...    60   4e-09
YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinas...    60   4e-09
KLLA0A09713g 851952..853625 similar to sp|Q03533 Saccharomyces c...    59   4e-09
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...    59   4e-09
Scas_707.36                                                            59   5e-09
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    58   5e-09
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    59   5e-09
CAGL0I04422g 394159..395427 some similarities with sp|P22209 Sac...    59   6e-09
Kwal_33.14434                                                          59   6e-09
YMR291W (YMR291W) [4245] chr13 (852629..854389) Serine/threonine...    59   6e-09
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    59   7e-09
AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH] complement(...    59   7e-09
YPL140C (MKK2) [5306] chr16 complement(287513..289033) MAP kinas...    58   7e-09
Scas_692.24                                                            59   8e-09
Scas_651.19                                                            59   8e-09
AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH] (348350..35...    59   8e-09
Scas_477.5                                                             58   9e-09
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    58   1e-08
Kwal_14.2497                                                           57   1e-08
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...    58   1e-08
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...    57   1e-08
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    58   1e-08
YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine...    58   1e-08
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...    58   1e-08
Scas_544.6                                                             57   1e-08
Scas_684.28                                                            57   1e-08
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...    57   1e-08
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...    57   2e-08
YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine pr...    57   2e-08
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    56   2e-08
Scas_673.34*                                                           57   2e-08
YJL187C (SWE1) [2737] chr10 complement(76802..79261) Serine/tyro...    57   2e-08
Kwal_56.24584                                                          57   2e-08
Kwal_55.20326                                                          57   2e-08
Scas_695.33                                                            57   2e-08
Kwal_26.8941                                                           57   2e-08
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    57   2e-08
YKL048C (ELM1) [3211] chr11 complement(346859..348781) Serine/th...    57   3e-08
Kwal_23.6458                                                           57   3e-08
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...    57   3e-08
Scas_629.16                                                            57   3e-08
Sklu_2277.8 YOR267C, Contig c2277 9591-11441 reverse complement        56   3e-08
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...    55   3e-08
Scas_711.25                                                            57   3e-08
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    56   4e-08
KLLA0A06820g complement(615686..618004) some similarities with s...    56   4e-08
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...    56   5e-08
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    56   5e-08
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    56   6e-08
CAGL0H09152g complement(895722..898055) similar to sp|P47116 Sac...    55   7e-08
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    55   7e-08
Scas_634.5                                                             55   8e-08
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    55   8e-08
Kwal_26.7355                                                           55   8e-08
YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase ...    55   8e-08
YKL168C (KKQ8) [3102] chr11 complement(131293..133497) Serine/th...    55   9e-08
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    55   9e-08
KLLA0D13266g complement(1137750..1141208) similar to sp|P32361 S...    55   9e-08
Scas_601.6                                                             55   1e-07
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    55   1e-07
CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces...    54   1e-07
AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C (...    55   1e-07
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    55   1e-07
YJL165C (HAL5) [2756] chr10 complement(106887..109454) Serine/th...    54   2e-07
KLLA0D11814g complement(1007240..1009021) similar to sp|P39073 S...    54   2e-07
Kwal_47.17263                                                          54   2e-07
CAGL0K00693g complement(74637..77267) similar to sp|P32944 Sacch...    54   2e-07
AFR372W [3564] [Homologous to ScYJR059W (PTK2 ) - SH] complement...    54   3e-07
Kwal_27.11830                                                          54   3e-07
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    54   3e-07
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...    54   3e-07
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...    53   3e-07
KLLA0B06501g complement(576636..579089) some similarities with s...    53   4e-07
Scas_720.103                                                           53   4e-07
KLLA0D09328g complement(788565..791705) some similarities with s...    53   5e-07
Scas_660.20                                                            53   6e-07
ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C (T...    52   6e-07
YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine pro...    52   7e-07
YPL042C (SSN3) [5397] chr16 complement(473035..474702) Cyclin-de...    52   1e-06
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    52   1e-06
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    51   1e-06
YOR351C (MEK1) [5128] chr15 complement(995013..996506) Serine/th...    51   1e-06
ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C (...    51   1e-06
AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH] (763309..76...    51   2e-06
Kwal_55.20221                                                          51   2e-06
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...    51   2e-06
Scas_648.17                                                            50   2e-06
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    51   2e-06
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    50   2e-06
Kwal_56.23841                                                          50   2e-06
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    50   2e-06
AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH] (234347..23...    51   2e-06
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...    51   2e-06
Kwal_23.5668                                                           51   2e-06
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    50   2e-06
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    50   2e-06
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...    51   3e-06
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...    50   3e-06
ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH] (503670..50...    50   3e-06
YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK), ...    50   3e-06
Sklu_2385.2 YLR113W, Contig c2385 3805-5109 reverse complement         50   3e-06
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...    50   3e-06
CAGL0M08360g complement(833220..835520) some similarities with s...    50   3e-06
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    50   3e-06
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    50   3e-06
Scas_707.3                                                             50   4e-06
Kwal_27.11803                                                          49   4e-06
Kwal_14.1159                                                           50   4e-06
YJL141C (YAK1) [2777] chr10 complement(147885..150308) Serine/th...    50   5e-06
CAGL0I06248g 600351..602792 similar to sp|P38970 Saccharomyces c...    50   5e-06
Scas_678.24                                                            50   6e-06
Scas_713.38                                                            49   6e-06
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    49   6e-06
Scas_689.24                                                            49   7e-06
Kwal_55.21709                                                          49   7e-06
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...    49   8e-06
KLLA0F08877g 825217..826182 gi|27526975|emb|CAD36965.1 Kluyverom...    48   8e-06
ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH] (797020..79...    49   9e-06
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    49   9e-06
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    48   1e-05
Scas_633.29                                                            49   1e-05
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    49   1e-05
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    48   1e-05
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    48   1e-05
Scas_651.3                                                             48   1e-05
Scas_568.13                                                            48   1e-05
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...    48   1e-05
Kwal_33.13984                                                          48   1e-05
Kwal_26.8347                                                           48   1e-05
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    48   1e-05
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    48   2e-05
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    47   2e-05
Scas_661.27                                                            48   2e-05
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    47   2e-05
Kwal_27.12559                                                          47   2e-05
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...    47   2e-05
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    48   2e-05
Kwal_33.14167                                                          47   2e-05
KLLA0F01507g 144356..145774 some similarities with sp|P47042 Sac...    47   3e-05
CAGL0H10208g complement(996853..999936) similar to sp|P38080 Sac...    47   3e-05
Scas_568.9*                                                            46   3e-05
ABR088C [679] [Homologous to ScYKL048C (ELM1) - SH] (546324..547...    47   3e-05
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    46   4e-05
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...    46   4e-05
Kwal_47.18098                                                          46   4e-05
ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH] (1263082..1...    47   4e-05
Scas_683.12                                                            46   4e-05
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    46   5e-05
YPL031C (PHO85) [5407] chr16 complement(492014..492914,493017..4...    45   5e-05
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...    45   6e-05
Scas_582.1                                                             46   6e-05
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...    46   6e-05
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...    46   6e-05
Kwal_14.2554                                                           46   6e-05
Scas_698.37                                                            45   6e-05
YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinas...    46   7e-05
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    45   8e-05
Scas_710.28                                                            45   8e-05
CAGL0K12496g 1218391..1219473 similar to sp|P43568 Saccharomyces...    45   8e-05
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...    45   8e-05
Kwal_27.11919                                                          44   9e-05
Scas_635.1                                                             45   9e-05
YOR061W (CKA2) [4869] chr15 (441535..442554) Casein kinase II (P...    45   9e-05
CAGL0K11990g complement(1155395..1158370) some similarities with...    45   9e-05
CAGL0I05192g complement(493635..494756) highly similar to sp|P15...    45   9e-05
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    45   1e-04
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    45   1e-04
YFL029C (CAK1) [1654] chr6 complement(78053..79159) Cdk-activati...    45   1e-04
Scas_721.46                                                            45   1e-04
Scas_610.7                                                             45   1e-04
Scas_584.8                                                             45   1e-04
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    45   1e-04
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...    44   1e-04
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    45   1e-04
Sklu_2186.4 YHR030C, Contig c2186 5713-7278 reverse complement         45   1e-04
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    45   1e-04
CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces c...    45   1e-04
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    45   1e-04
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...    44   1e-04
Scas_619.5*                                                            45   1e-04
ADR293C [2034] [Homologous to ScYHR079C (IRE1) - SH] (1207023..1...    45   1e-04
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    44   2e-04
Kwal_55.22001                                                          44   2e-04
KLLA0E15378g 1362851..1365025 some similarities with sp|P08018 S...    45   2e-04
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...    44   2e-04
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...    44   2e-04
Sklu_1436.3 YIL035C, Contig c1436 2418-3536 reverse complement         44   2e-04
Sklu_1436.2 , Contig c1436 2420-3329 reverse complement                44   2e-04
Scas_713.21                                                            44   2e-04
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    44   2e-04
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    44   2e-04
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    44   2e-04
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    44   3e-04
Scas_649.30                                                            44   3e-04
Sklu_1752.2 YBR059C, Contig c1752 577-3153 reverse complement          44   3e-04
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...    44   3e-04
Scas_680.20                                                            44   3e-04
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    44   3e-04
YBR059C (AKL1) [250] chr2 complement(356821..360147) Serine/thre...    44   3e-04
Kwal_55.21900                                                          44   3e-04
Sklu_2104.1 YBR160W, Contig c2104 694-1593                             43   3e-04
Scas_707.7                                                             44   3e-04
Kwal_27.10945                                                          44   3e-04
Kwal_27.11777                                                          44   3e-04
Scas_716.33                                                            43   4e-04
KLLA0C16577g complement(1451181..1452695) some similarities with...    43   4e-04
Kwal_14.1249                                                           43   4e-04
CAGL0M13167g complement(1291524..1293356) similar to sp|P32801 S...    43   5e-04
Scas_602.11                                                            43   5e-04
YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kin...    43   5e-04
YPR054W (SMK1) [5484] chr16 (666275..667441) Sporulation-specifi...    43   6e-04
Sklu_2354.4 YNL307C, Contig c2354 4429-5520 reverse complement         42   6e-04
YNL307C (MCK1) [4306] chr14 complement(56446..57573) Member of t...    42   6e-04
Kwal_47.17868                                                          42   7e-04
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...    42   8e-04
YDR247W (VHS1) [1081] chr4 (956005..957390) Serine/threonine pro...    42   8e-04
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...    42   8e-04
Scas_688.14                                                            42   8e-04
Scas_704.50                                                            42   9e-04
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...    42   9e-04
Sklu_2389.4 YJL057C, Contig c2389 7783-9576                            42   0.001

>Kwal_26.7682
          Length = 518

 Score =  983 bits (2542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/511 (93%), Positives = 477/511 (93%)

Query: 1   MGNPEASMYRNSTVHAPKLRQNEFPALEESDSIAVSQQFATTPPKLSTSQFVDGGMNMLP 60
           MGNPEASMYRNSTVHAPKLRQNEFPALEESDSIAVSQQFATTPPKLSTSQFVDGGMNMLP
Sbjct: 1   MGNPEASMYRNSTVHAPKLRQNEFPALEESDSIAVSQQFATTPPKLSTSQFVDGGMNMLP 60

Query: 61  TPLVYTPCSPGVAARSPLEAKFSMTPSSSAIRSKKGYGGLQPPSAESFNRSHVLEDKQRM 120
           TPLVYTPCSPGVAARSPLEAKFSMTPSSSAIRSKKGYGGLQPPSAESFNRSHVLEDKQRM
Sbjct: 61  TPLVYTPCSPGVAARSPLEAKFSMTPSSSAIRSKKGYGGLQPPSAESFNRSHVLEDKQRM 120

Query: 121 LSEYXXXXXXXXXXXXXXSQRISSLSGVDQKLDVVYEPPTSAAHHVGSQHIIEPEAQETL 180
           LSEY              SQRISSLSGVDQKLDVVYEPPTSAAHHVGSQHIIEPEAQETL
Sbjct: 121 LSEYAPHSALAPATASTLSQRISSLSGVDQKLDVVYEPPTSAAHHVGSQHIIEPEAQETL 180

Query: 181 TGFALHDTSHALQWRKVRQIGVGNFSDVYLYESVNQTATHLQKVAVKHVKYPEALVQSSS 240
           TGFALHDTSHALQWRKVRQIGVGNFSDVYLYESVNQTATHLQKVAVKHVKYPEALVQSSS
Sbjct: 181 TGFALHDTSHALQWRKVRQIGVGNFSDVYLYESVNQTATHLQKVAVKHVKYPEALVQSSS 240

Query: 241 PKXXXXXXXXXXXXXXXXXXXXALSGIWHPCIIHLHAINDLTFLNSPRPLSSRDLTRGLP 300
           PK                    ALSGIWHPCIIHLHAINDLTFLNSPRPLSSRDLTRGLP
Sbjct: 241 PKSPRFRELLSRLESSLTREIEALSGIWHPCIIHLHAINDLTFLNSPRPLSSRDLTRGLP 300

Query: 301 PCDMIMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIK 360
           PCDMIMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIK
Sbjct: 301 PCDMIMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIK 360

Query: 361 FPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYD 420
           FPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYD
Sbjct: 361 FPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYD 420

Query: 421 GRLSDSWAMGVILYALLEDRLPFDPLPTAAPGKRQRRSSTAHRISRFEWRWIKMAESEYP 480
           GRLSDSWAMGVILYALLEDRLPFDPLPTAAPGKRQRRSSTAHRISRFEWRWIKMAESEYP
Sbjct: 421 GRLSDSWAMGVILYALLEDRLPFDPLPTAAPGKRQRRSSTAHRISRFEWRWIKMAESEYP 480

Query: 481 AKEIVENCLTRKNIRCNIEKIYENPYVNEVA 511
           AKEIVENCLTRKNIRCNIEKIYENPYVNEVA
Sbjct: 481 AKEIVENCLTRKNIRCNIEKIYENPYVNEVA 511

>Sklu_1477.2 YKL116C, Contig c1477 684-2414 reverse complement
          Length = 576

 Score =  469 bits (1207), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 250/521 (47%), Positives = 331/521 (63%), Gaps = 25/521 (4%)

Query: 3   NPEASMYRNSTVHAPKLRQNEFPALEESDSIAVSQQFATTPPKLSTSQFVDGGMNMLPTP 62
           N +  +   +   APKLRQ EF ALE +      +    TPP L+   FVD  +N+LPTP
Sbjct: 62  NSDIPLLGKNVFQAPKLRQEEFGALENNSL----KNELRTPPMLTIPSFVDTDVNLLPTP 117

Query: 63  LVYTPCSPGVAARSPLEAKFSMTPSSSAIRSKKGYGGLQPPSAESFNRSHVLE------- 115
           + Y P SP V  RSP++      P    +  KK    L+   ++    S  L+       
Sbjct: 118 MTYGPHSP-VCLRSPVDQHPLFIPKKRIVPDKKVDNALK---SDLLATSTTLDVNQAGTN 173

Query: 116 DKQRMLSEYXXXXXXXXXXXXXXS--QRISSLSGVDQKLDVVYEPPTSAAHHVGSQHIIE 173
            K R++SEY              S  QR++SL GVD+ L++  E   S   +    H + 
Sbjct: 174 TKTRIISEYVPHSSRNTVVAHAASRAQRVASLPGVDENLEIKLE---SQEANKSKGHSVT 230

Query: 174 PEAQETLTGFALHDTSHALQWRKVRQIGVGNFSDVYLYESVNQTATHLQKVAVKHVKYPE 233
            +   T+TG+ +      ++ +K++ IG GNFSDVYLYE++ ++ +H  +VAVKH++YP 
Sbjct: 231 FDQDLTITGYDIDHPGETVKLKKIKLIGSGNFSDVYLYEALGESRSHFAQVAVKHIRYPS 290

Query: 234 ALVQSSSPKXXXXXXXXXXXXXXXXXXXXALSGIWHPCIIHLHAINDLTFLNSPRPLSSR 293
            LV + +P                      L  I HPCII L+AINDL F  + RPLSSR
Sbjct: 291 ELVNAPNPDSPSYKDTLSRLESSLTRELDVLKSISHPCIIKLYAINDLKFFETKRPLSSR 350

Query: 294 DL-TRG-LPPCDMIMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRD 351
               +G LPPCDM+MSYC+GGDLF++AS+N LP+WL++RIFAELT+G+KYLHENLI+HRD
Sbjct: 351 KHGDKGFLPPCDMVMSYCSGGDLFDMASKNNLPQWLIQRIFAELTMGMKYLHENLIIHRD 410

Query: 352 LKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSP 411
           LKLENVL+K PL+ ILAM +   L   Q+++EL DFGLC++I+PDEMCTTRCGSEDYVSP
Sbjct: 411 LKLENVLLKLPLEQILAMKDV-PLFKRQNLIELGDFGLCKKIQPDEMCTTRCGSEDYVSP 469

Query: 412 EILMGVPYDGRLSDSWAMGVILYALLEDRLPFDPLPTAAPGKRQRRSSTAHRISRFEWRW 471
           EILMG+PYDGRLSD+WA+GVILYALLEDRLPFDPLP+ A   R+R  STAHRI+R+EWRW
Sbjct: 470 EILMGLPYDGRLSDAWALGVILYALLEDRLPFDPLPSHASHTRKRPRSTAHRIARYEWRW 529

Query: 472 IKMAES--EYPAKEIVENCLTRKNIRCNIEKIYENPYVNEV 510
           +K+     +  AKEIVE+CL RK  R +I KI ++ YV  V
Sbjct: 530 VKLLNDTEQEAAKEIVEHCLVRKIERWDIFKISQSTYVKTV 570

>Scas_336.1
          Length = 486

 Score =  455 bits (1170), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 238/482 (49%), Positives = 314/482 (65%), Gaps = 21/482 (4%)

Query: 42  TPPKLSTSQFVDGGMNMLPTPLVYTPCSPGVAARSPLEAKFSMTPSSSAIRSKKGYGGLQ 101
           TPP L+   FVD  +N+LPTP+ Y P SP V  RSP++      P    +  KK    L+
Sbjct: 7   TPPMLTIPSFVDTDVNLLPTPMTYGPHSP-VCLRSPVDQHPLFIPKKRIVPDKKVDNALK 65

Query: 102 PPSAESFNRSHVLE-------DKQRMLSEYXXXXXXXXXXXXXXS--QRISSLSGVDQKL 152
              ++    S  L+        K R++SEY              S  QR++SL GVD+ L
Sbjct: 66  ---SDLLATSTTLDVNQAGTNTKTRIISEYVPHSSRNTVVAHAASRAQRVASLPGVDENL 122

Query: 153 DVVYEPPTSAAHHVGSQHIIEPEAQETLTGFALHDTSHALQWRKVRQIGVGNFSDVYLYE 212
           ++  E   S   +    H +  +   T+TG+ +      ++ +K++ IG GNFSDVYLYE
Sbjct: 123 EIKLE---SQEANKSKGHSVTFDQDLTITGYDIDHPGETVKLKKIKLIGSGNFSDVYLYE 179

Query: 213 SVNQTATHLQKVAVKHVKYPEALVQSSSPKXXXXXXXXXXXXXXXXXXXXALSGIWHPCI 272
           ++ ++ +H  +VAVKH++YP  LV + +P                      L  I HPCI
Sbjct: 180 ALGESRSHFAQVAVKHIRYPSELVNAPNPDSPSYKDTLSRLESSLTRELDVLKSISHPCI 239

Query: 273 IHLHAINDLTFLNSPRPLSSRDL-TRG-LPPCDMIMSYCAGGDLFELASQNTLPEWLLRR 330
           I L+AINDL F  + RPLSSR    +G LPPCDM+MSYC+GGDLF++AS+N LP+WL++R
Sbjct: 240 IKLYAINDLKFFETKRPLSSRKHGDKGFLPPCDMVMSYCSGGDLFDMASKNNLPQWLIQR 299

Query: 331 IFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLC 390
           IFAELT+G+KYLHENLI+HRDLKLENVL+K PL+ ILAM +   L   Q+++EL DFGLC
Sbjct: 300 IFAELTMGMKYLHENLIIHRDLKLENVLLKLPLEQILAMKDV-PLFKRQNLIELGDFGLC 358

Query: 391 RRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPFDPLPTAA 450
           ++I+PDEMCTTRCGSEDYVSPEILMG+PYDGRLSD+WA+GVILYALLEDRLPFDPLP+ A
Sbjct: 359 KKIQPDEMCTTRCGSEDYVSPEILMGLPYDGRLSDAWALGVILYALLEDRLPFDPLPSHA 418

Query: 451 PGKRQRRSSTAHRISRFEWRWIKMAES--EYPAKEIVENCLTRKNIRCNIEKIYENPYVN 508
              R+R  STAHRI+R+EWRW+K+     +  AKEIVE+CL RK  R +I KI ++ YV 
Sbjct: 419 SHTRKRPRSTAHRIARYEWRWVKLLNDTEQEAAKEIVEHCLVRKIERWDIFKISQSTYVK 478

Query: 509 EV 510
            V
Sbjct: 479 TV 480

>KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces
           cerevisiae YKL116c, hypothetical start
          Length = 541

 Score =  379 bits (973), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 219/534 (41%), Positives = 295/534 (55%), Gaps = 55/534 (10%)

Query: 14  VHAPKLRQNEFPALEESDSIAVSQQFATTPPKLSTS---QFVDGGMNMLPTPLVYTPCSP 70
              PKL Q EF   +   S  V  Q     P++++S   + +D GM  LPTP      SP
Sbjct: 15  TETPKLAQREFAGGDAESS--VKNQL----PEINSSLNREAIDVGM--LPTPTANVFTSP 66

Query: 71  GVAARSPLEAKFSMTPSSSAIRSKKGYGGLQPPSAES------------------FNRSH 112
               +SP      +       +      G+  P+  S                   NR  
Sbjct: 67  VRVNKSPGGFDAGLQVEKRRNKDSASNSGVPSPTISSVDTHEEVLDEELSKLGTYMNRDV 126

Query: 113 VLEDKQRMLSEYXXXXXXXXXXXXXXSQRISSLSGVDQKLDVVYEPPTSAAHHVGSQHII 172
             + K RMLSEY               QR  SL+      + V E P+     + ++ I 
Sbjct: 127 THKIKGRMLSEYIPNNSMGDGSGGVAVQRSISLN------NRVVEKPSLKKETIINEVIT 180

Query: 173 --------EPEAQETLT-GFALHDTSH-ALQWRKVRQIGVGNFSDVYLYESVNQTAT--- 219
                   E +A  T+  G+  +  +H + QW K+++IG GNFS VYLYE ++       
Sbjct: 181 SVPSDKENEQKADGTIIRGYMANTPNHISFQWSKIKEIGSGNFSTVYLYECIDDNLNINL 240

Query: 220 --HLQKVAVKHVKYPEALVQSSSPKXXXXXXXXXXXXXXXXXXXXALSGIWHPCIIHLHA 277
              L+ VAVK +KYP  L+ SSSP                      L  + HPCI+ L A
Sbjct: 241 NPELKYVAVKSIKYPRELLMSSSPSSPKYKELLSRVVSSLKRELTTLISVHHPCIVKLFA 300

Query: 278 INDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFELASQNTLPEWLLRRIFAELTL 337
           IND TF+    PL  R     LP CDMIMSYC GGDLF+LAS+  +P WLL RI  EL++
Sbjct: 301 INDTTFITDEHPLYGRRKLSALPRCDMIMSYCTGGDLFDLASKTKIPNWLLTRIITELSV 360

Query: 338 GVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDE 397
            +KYLH+N I+HRD+KLENVL+K+ LDD++ + E       ++ VELADFGLC++I PDE
Sbjct: 361 AIKYLHDNFIIHRDIKLENVLLKYTLDDMMLLKEDESQFFSKNFVELADFGLCKKITPDE 420

Query: 398 MCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPFDPLPTAAPGKRQRR 457
           MCTTRCGSEDYVSPEIL+G+PYDGR+SD+WA GVI YALLEDRLPFDPL    PG+  RR
Sbjct: 421 MCTTRCGSEDYVSPEILLGLPYDGRISDAWAFGVITYALLEDRLPFDPL----PGQSSRR 476

Query: 458 S-STAHRISRFEWRWIKMAESEYPAKEIVENCLTRKNIRCNIEKIYENPYVNEV 510
           + S AHRI+R +W+W+K A++++PAKEIV+N L RK+ R N++++   PY+  +
Sbjct: 477 TRSIAHRIARCDWKWLKNADTDHPAKEIVQNTLVRKSERWNMDQLCNTPYIRNI 530

>Scas_721.132
          Length = 584

 Score =  380 bits (975), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 212/492 (43%), Positives = 297/492 (60%), Gaps = 30/492 (6%)

Query: 26  ALEESDSIAVSQQFATTPPKLSTSQFVDGGMNMLPTPLVYTPCSPGVAARSPLEAKFSMT 85
           A EE++  +  QQ  TTP  L+   F    +  LPTP+ YTP SP   + SP++ +    
Sbjct: 104 AGEENEDDSQQQQEETTPLSLTIPTF--DNVQTLPTPMTYTPLSPAGLSLSPIKDQ-KQP 160

Query: 86  PSSSAIRSKKGYGGLQPPSAESFNRSHVLEDKQRMLSEYXXXXXXXXXXXXXXSQRISSL 145
                I+ K+ +G    P       S +LE +QR++SE                QR+ SL
Sbjct: 161 DQPLQIKKKRAHGS---PRIGGGLDSVLLESQQRVISELIPAPSFQ-------QQRVVSL 210

Query: 146 SGVDQKLDVVYEP---PTSAAHHVGSQHIIEPEAQETLTGFALH--DTSHALQWRKVRQI 200
             V+++    +EP   P   AH   +    +  A+ TL G+ L   D +H L+W+KV++I
Sbjct: 211 PTVNEEPIPSFEPDIIPKEFAH--TNIDTFDNHAESTLVGYPLQHLDKAHVLRWKKVKKI 268

Query: 201 GVGNFSDVYLYESVNQTATHLQKVAVKHVKYPEALVQSSSPKXXXXXXXXXXXXXXXXXX 260
           G GNFSDV LYES++QT   + ++AVK +KYP  +   +                     
Sbjct: 269 GEGNFSDVLLYESLDQTDPKMMQIAVKRIKYPVEVTDITFRGTPQYNDTLSRLESSLTRE 328

Query: 261 XXALSGIWHPCIIHLHAINDLTFLNSPRPLSSRDL---TRGLPPCDMIMSYCAGGDLFEL 317
              L  + +PCI+ L+ IN+  F+ S  PL  RDL      LPPCDMIMSYC+GGDL   
Sbjct: 329 LGVLKLLDYPCIVKLYGINNPIFVQSKTPL--RDLLAKNPALPPCDMIMSYCSGGDLLAA 386

Query: 318 ASQ--NTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQREL 375
            S+    L  WL++R+F EL + V YLH+N I+HRDLKLEN+L+K+PL+ I+A+ +   +
Sbjct: 387 ISRCLGELDIWLIQRLFTELVMAVNYLHDNNIIHRDLKLENILLKYPLEHIIALKDS-PV 445

Query: 376 LLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYA 435
               +++ELADFGLC++I+P E+CT RCGSEDYVSPEILMGVPYDG L+D+WA+GVILY+
Sbjct: 446 FTSLNMIELADFGLCKQIQPGELCTARCGSEDYVSPEILMGVPYDGHLTDTWALGVILYS 505

Query: 436 LLEDRLPFDPLPTAAPGKRQRRSSTAHRISRFEWRWIKMAESEYPAKEIVENCLTRKNIR 495
           +LEDRLPFDP P A    RQR  +T+HRI+RF+W W ++A +E  AKEIV N LTRKN R
Sbjct: 506 ILEDRLPFDPPPNAT--SRQRNRATSHRIARFDWHWFRLANTELDAKEIVANTLTRKNQR 563

Query: 496 CNIEKIYENPYV 507
            +I++I E+ +V
Sbjct: 564 WDIKQIMESIFV 575

>CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces
           cerevisiae YKL116c, hypothetical start
          Length = 538

 Score =  378 bits (970), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 216/503 (42%), Positives = 292/503 (58%), Gaps = 37/503 (7%)

Query: 16  APKLRQNEFPALEESDSIAVSQQFATTPPKLSTSQFVDGGMNMLPTPLVYTPCSPGVAAR 75
            P +  N     +E++ + V      TP  +S   F +  +  LPTP+VY+P SP V  +
Sbjct: 61  VPDITMNTEVGADETEDVKV-----VTPLSVSIPTFEN--VATLPTPMVYSPMSPAVLNK 113

Query: 76  SPLEAKFSMTPSSSAIRSKKGYGGLQPPSAESFNRSHVLEDKQ-RMLSEYXXXXXXXXXX 134
           SP   K     +   I   K     +P      N   ++  K  R++SE           
Sbjct: 114 SPQAIK----STEMKINIPKRRAQYKP------NLDGLIGSKPIRIISEVVPTPDTA--- 160

Query: 135 XXXXSQRISSLSGVDQKLDVVYEPPTSAAHHVGSQHIIEPEAQE---TLTGFALHDTSHA 191
                QR+ SL  V +  +   E      HH G+    +  +QE    L G+ + + + A
Sbjct: 161 ----QQRVISLPTVSE--ETTTENDKFPIHHDGTALADDSNSQEDDIVLMGYRIGEYTKA 214

Query: 192 LQWRKVRQIGVGNFSDVYLYESVNQTATHLQKVAVKHVKYPEALVQSSSPKXXXXXXXXX 251
           LQWRKV+ IGVGNFSDV LYES++Q    L +VAVK ++YP+ L +    +         
Sbjct: 215 LQWRKVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQEL-KDIRNRSANFDELLG 273

Query: 252 XXXXXXXXXXXALSGIWHPCIIHLHAINDLTFLNSPRPLSSR-DLTRGLPPCDMIMSYCA 310
                       L+ + HPCI+ L  +ND  F+ S RPL     L + L PC++IMSYC 
Sbjct: 274 RLDNSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCV 333

Query: 311 GGDLFELASQ--NTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILA 368
           GGDL    SQ    L  WL++R+F E+ LGVKYLHE+ I+HRDLKLEN+L+K PL +I +
Sbjct: 334 GGDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIRS 393

Query: 369 MHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWA 428
           + + +++  +   VE+ADFGLC++IEPDE+CT RCGSEDYVSPEILMGVPYDG LSD+WA
Sbjct: 394 LKD-KDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDTWA 452

Query: 429 MGVILYALLEDRLPFDPLPTAAPGKRQRRSSTAHRISRFEWRWIKMAESEYPAKEIVENC 488
           MGVILY+LLEDRLPFDPLP A+   RQ+   TAHRI+RFEW+W KM E +  AKEIV N 
Sbjct: 453 MGVILYSLLEDRLPFDPLPGAS--IRQKNRPTAHRIARFEWKWHKMIEDDSSAKEIVNNT 510

Query: 489 LTRKNIRCNIEKIYENPYVNEVA 511
           LTRKN R N   I+ + ++ E+ 
Sbjct: 511 LTRKNQRWNCNDIFNSAFIQEIV 533

>YKL116C (PRR1) [3148] chr11 complement(220990..222546)
           Serine/threonine protein kinase potentially involved in
           pheromone response, has similarity to S. pombe Nim1p
           [1557 bp, 518 aa]
          Length = 518

 Score =  357 bits (915), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 219/534 (41%), Positives = 294/534 (55%), Gaps = 54/534 (10%)

Query: 6   ASMYRNSTVHAPKLRQNEFP---------AL-----EESDSIAVSQQFA----TTPPKLS 47
           +S+Y  S    P+L+Q  FP         AL     EE   +A ++       +TP  +S
Sbjct: 5   SSIY--SQPKTPRLKQEGFPDSIGDQHEKALIDENGEEDKKMASTEGTTGDSRSTPLTVS 62

Query: 48  TSQFVDGGMNMLPTPLVYTPCSPGVAARSPLEAKFSMTPSSSAIRSKKGYGGLQPPSAES 107
              F    +  LPTP+ YTP SPG  + SP++       SS  I  ++ +  L       
Sbjct: 63  IPTF--ENVQALPTPMTYTPLSPGNLSMSPIDQ------SSLNIPKRRSHARLLD----- 109

Query: 108 FNRSHVLEDKQRMLSEYXXXXXXXXXXXXXXSQRISSLSGVDQKL----DVVYEPPTSAA 163
            +   V +  QR++SE                QR+ SL  V ++      V  +  T   
Sbjct: 110 -DMLSVTQPNQRVVSELIAPANLS-------PQRVVSLPTVTEEALVNDSVDSDNYTKEP 161

Query: 164 HHVGSQHIIEPEAQETLTGFALHDTSHALQWRKVRQIGVGNFSDVYLYESVNQTATHLQK 223
           +   S    E    +   GF L      L W+KVR IG GNFS V LYE ++Q+   L++
Sbjct: 162 YFPESSSSTEKCDDDIFQGFLLDHWDRPLLWKKVRPIGSGNFSTVLLYELMDQSNPKLKQ 221

Query: 224 VAVKHVKYPEALVQSSSPKXXXX-XXXXXXXXXXXXXXXXALSGIWHPCIIHLHAINDLT 282
           VAVK +KYPE L                             L  + HPCI+ L  IN+  
Sbjct: 222 VAVKRLKYPEELSNVEQINTSLRYKETLSRLENSLTRELQVLKSLNHPCIVKLLGINNPI 281

Query: 283 FLNSPRPLSSRDLT--RGLPPCDMIMSYCAGGDLFE--LASQNTLPEWLLRRIFAELTLG 338
           F+ S +PL    +   R LPPCDMIMSYC  GDL    +A    L  WL++RIF E+ L 
Sbjct: 282 FVTSKKPLCDLIIKTPRALPPCDMIMSYCPAGDLLAAVMARNGRLEAWLIQRIFTEVVLA 341

Query: 339 VKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEM 398
           VKYLHEN I+HRDLKLEN+L+K+  DDI +  +   +   Q+ +ELADFGLC++IE +EM
Sbjct: 342 VKYLHENSIIHRDLKLENILLKYSFDDINSFRDS-PIYCKQNFIELADFGLCKKIENNEM 400

Query: 399 CTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPFDPLPTAAPGKRQRRS 458
           CT RCGSEDYVSPEILMGVPYDG LSD+WA+GVILY+L EDRLPFDP P A+   RQR  
Sbjct: 401 CTARCGSEDYVSPEILMGVPYDGHLSDTWALGVILYSLFEDRLPFDPPPNAS--ARQRSR 458

Query: 459 STAHRISRFEWRWIKMAESEYP-AKEIVENCLTRKNIRCNIEKIYENPYVNEVA 511
           +T+HRI+RF+WRW ++++ +    K+IVEN LTRKN R +I +IYE+P+V  +A
Sbjct: 459 ATSHRIARFDWRWYRLSDYKTNVGKQIVENTLTRKNQRWSINEIYESPFVKTIA 512

>ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH]
           (295497..297107) [1611 bp, 536 aa]
          Length = 536

 Score =  346 bits (888), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 170/339 (50%), Positives = 224/339 (66%), Gaps = 9/339 (2%)

Query: 176 AQETLTGFALHDTSHALQWRKVRQIGVGNFSDVYLYESVNQTATH--LQKVAVKHVKYPE 233
           A++ LTGF L + +  L WR V+ +G GNFSDVYLYE+ + ++T    Q+VAVK  +YP 
Sbjct: 195 AEDKLTGFILPNLNSQLSWRLVKLVGSGNFSDVYLYENTSASSTEEKFQQVAVKVTRYPA 254

Query: 234 ALVQSSSPKXXXXXXXXXXXXXXXXXXXXALSGIWHPCIIHLHAINDLTFLNSPRPLSSR 293
            L    +                       L  + +PCI+ L+ IND +FL S RPL   
Sbjct: 255 ELQNPQARTATKYKEMLSRLESSLTRELAVLRSLDYPCIVKLYGINDCSFLESRRPLIDH 314

Query: 294 DLTRGLPPCDMIMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLK 353
                LP C MIMSYC GGD+ ++A +  LP+WLL+R+F EL   V YLHENL++HRDLK
Sbjct: 315 INEPSLPSCKMIMSYCFGGDVLDVAKRGLLPDWLLQRVFTELAHAVLYLHENLVIHRDLK 374

Query: 354 LENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEI 413
           LENVL+K+PL+ +L+M E        + +ELADFGLC+RI  +E+CTTRCGSEDY+SPE+
Sbjct: 375 LENVLLKYPLEQLLSMRED----FSCNFIELADFGLCKRIRQNELCTTRCGSEDYISPEV 430

Query: 414 LMGVPYDGRLSDSWAMGVILYALLEDRLPFDPLPTAA-PGKRQRRSSTAHRISRFEWRWI 472
           LMG+PYDGRL D+WA+GVILYALLEDRLPFDPLP     G R R  STAHRI+R+EWRW+
Sbjct: 431 LMGLPYDGRLCDTWALGVILYALLEDRLPFDPLPLQGWRGNRPR--STAHRIARYEWRWL 488

Query: 473 KMAESEYPAKEIVENCLTRKNIRCNIEKIYENPYVNEVA 511
           ++  + + AK IVE CL  +  R +I+ I E  +V  +A
Sbjct: 489 RLINNNHHAKVIVEKCLVTRQHRWSIKDITEADFVRTLA 527

>KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces
           cerevisiae YDR507c GIN4 ser/thr protein kinase, start by
           similarity
          Length = 1112

 Score =  112 bits (280), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 68/180 (37%), Positives = 89/180 (49%), Gaps = 25/180 (13%)

Query: 266 GIWHPCIIHLHAINDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFEL-ASQNTLP 324
           GI    II       +  LN P  L   D+        M++ Y   G+LF L   +  LP
Sbjct: 72  GIEREIII-------MKLLNHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPLP 124

Query: 325 EWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVEL 384
           E    R F ++ +G+ Y H   IVHRDLK EN+L+    +                 V+L
Sbjct: 125 ENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFN-----------------VKL 167

Query: 385 ADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPFD 444
           ADFG+      D++  T CGS  Y +PEI+ G+PY G  SD W+ GVILYALL  RLPFD
Sbjct: 168 ADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFD 227

>AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W
           (KCC4) - SH] (1721689..1725117) [3429 bp, 1142 aa]
          Length = 1142

 Score =  111 bits (278), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 68/180 (37%), Positives = 89/180 (49%), Gaps = 25/180 (13%)

Query: 266 GIWHPCIIHLHAINDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFELASQNT-LP 324
           GI    II       +  LN P  L   D+        M++ Y   G+LF L  Q   LP
Sbjct: 74  GIEREIII-------MKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLP 126

Query: 325 EWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVEL 384
           E    R F ++ +G+ Y H   IVHRDLK EN+L+    +                 ++L
Sbjct: 127 ENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFN-----------------IKL 169

Query: 385 ADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPFD 444
           ADFG+      D++  T CGS  Y +PEI+ G+PY G  SD W+ GVILYALL  RLPFD
Sbjct: 170 ADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFD 229

>Scas_493.2
          Length = 1117

 Score =  109 bits (273), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 60/143 (41%), Positives = 78/143 (54%), Gaps = 20/143 (13%)

Query: 304 MIMSYCAGGDLFEL-ASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           MI+ Y   G+LF L   +  LPE    R F ++ +G+ Y H   IVHRDLK EN      
Sbjct: 111 MILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPEN------ 164

Query: 363 LDDILAMHEQRELLLDQHI-VELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDG 421
                       LLLD    +++ADFG+      D++  T CGS  Y +PEI+ G+PY G
Sbjct: 165 ------------LLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHG 212

Query: 422 RLSDSWAMGVILYALLEDRLPFD 444
             SD W+ GVIL+ALL  RLPFD
Sbjct: 213 FESDVWSCGVILFALLTGRLPFD 235

>CAGL0K05709g complement(555903..559214) similar to sp|Q12263
           Saccharomyces cerevisiae YDR507c GIN4, start by
           similarity
          Length = 1103

 Score =  108 bits (269), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 87/165 (52%), Gaps = 18/165 (10%)

Query: 281 LTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGV 339
           +  LN P  L   D+        +++ Y   G+LF  L  +  LPE    R F ++ +G+
Sbjct: 83  MKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGI 142

Query: 340 KYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMC 399
            Y H   +VHRDLK EN+L+   L+                 +++ADFG+      D++ 
Sbjct: 143 SYCHSLGVVHRDLKPENLLLDNKLN-----------------IKIADFGMAALESEDKLL 185

Query: 400 TTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPFD 444
            T CGS  Y +PEI+ G+PY+G  SD W+ GVIL+ALL  RLPFD
Sbjct: 186 ETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFD 230

>YDR507C (GIN4) [1321] chr4 complement(1462346..1465774)
           Serine/threonine-protein kinase required for septin
           organization at the bud neck, has similarity to Ycl024p
           [3429 bp, 1142 aa]
          Length = 1142

 Score =  107 bits (266), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 90/181 (49%), Gaps = 27/181 (14%)

Query: 266 GIWHPCIIHLHAINDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFEL-ASQNTLP 324
           GI    II       +  LN P  L   D+        +++ Y   G+LF L   +  LP
Sbjct: 77  GIEREIII-------MKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLP 129

Query: 325 EWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLD-QHIVE 383
           E    R F ++ +GV Y H   IVHRDLK EN                  LLLD ++ ++
Sbjct: 130 EHEAIRFFRQIIIGVSYCHALGIVHRDLKPEN------------------LLLDHKYNIK 171

Query: 384 LADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPF 443
           +ADFG+       ++  T CGS  Y +PEI+ G+PY G  SD W+ GVIL+ALL  RLPF
Sbjct: 172 IADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPF 231

Query: 444 D 444
           D
Sbjct: 232 D 232

>YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine
           protein kinase that genetically interacts with histone
           mutants and negatively regulates Swe1p protein kinase
           [4557 bp, 1518 aa]
          Length = 1518

 Score =  105 bits (261), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/144 (39%), Positives = 79/144 (54%), Gaps = 21/144 (14%)

Query: 304 MIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           +++ Y  GG+LF+ L S+  LPE      F ++  GV Y H   I HRDLK EN      
Sbjct: 191 LVLEYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPEN------ 244

Query: 363 LDDILAMHEQRELLLDQ--HIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYD 420
                       LLLD+    +++ADFG+     P+++  T CGS  Y SPEI+MG PY 
Sbjct: 245 ------------LLLDKKNRRIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYH 292

Query: 421 GRLSDSWAMGVILYALLEDRLPFD 444
           G  SD W+ G++L+ALL   LPF+
Sbjct: 293 GGPSDVWSCGIVLFALLTGHLPFN 316

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score =  103 bits (256), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 62/169 (36%), Positives = 88/169 (52%), Gaps = 21/169 (12%)

Query: 278 INDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELT 336
           I+ L  L  P  +   D+ +      M++ Y AG +LF+ +  ++ +PE   RR F ++ 
Sbjct: 84  ISYLRLLRHPHIIKLYDVIKSKDEIIMVIEY-AGNELFDYIVQRDKMPEQEARRFFQQII 142

Query: 337 LGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHI-VELADFGLCRRIEP 395
             V Y H + IVHRDLK EN                  LLLD+H+ V++ADFGL   +  
Sbjct: 143 SAVDYCHRHKIVHRDLKPEN------------------LLLDEHLNVKIADFGLSNIMTD 184

Query: 396 DEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPFD 444
                T CGS +Y +PE++ G  Y G   D W+ GVILY +L  RLPFD
Sbjct: 185 GNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFD 233

>Scas_660.28
          Length = 623

 Score =  103 bits (256), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 83/266 (31%), Positives = 120/266 (45%), Gaps = 62/266 (23%)

Query: 184 ALHDTSHALQWRKVRQIGVGNFSDVYLYESVNQTATHL---QKVAVKHVKYPEALVQSSS 240
           +L D SH   ++ V+ +G G+F  V L       A H+   QKVA+K +   + L +S  
Sbjct: 36  SLSDGSHIGNYQIVKTLGEGSFGKVKL-------AYHMTTGQKVALKIIN-KKVLAKSD- 86

Query: 241 PKXXXXXXXXXXXXXXXXXXXXALSGIWHPCIIHLHAINDLTFLNSPRPLSSRDLTRGLP 300
                                  L  + HP II L+                 D+ +   
Sbjct: 87  ------------MQGRIEREISYLRLLRHPHIIKLY-----------------DVIKSKD 117

Query: 301 PCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLI 359
              M+M Y AG +LF+ +  ++ + E   RR F ++   V+Y H + IVHRDLK EN   
Sbjct: 118 EIIMVMEY-AGNELFDYIVQRDKMSEDEARRFFQQIISAVEYCHRHKIVHRDLKPEN--- 173

Query: 360 KFPLDDILAMHEQRELLLDQHI-VELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVP 418
                          LLLD+H+ V++ADFGL   +       T CGS +Y +PE++ G  
Sbjct: 174 ---------------LLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKL 218

Query: 419 YDGRLSDSWAMGVILYALLEDRLPFD 444
           Y G   D W+ GVILY +L  RLPFD
Sbjct: 219 YAGPEVDVWSCGVILYVMLCRRLPFD 244

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score =  103 bits (257), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 57/144 (39%), Positives = 79/144 (54%), Gaps = 21/144 (14%)

Query: 304 MIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           +++ Y  GG+LF+ L S+  L E      F ++  GV Y H   I HRDLK EN      
Sbjct: 203 LVLEYVDGGELFDYLVSKGKLSEPEAVHYFTQIIQGVSYCHSFNICHRDLKPEN------ 256

Query: 363 LDDILAMHEQRELLLDQH--IVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYD 420
                       LLLD+   ++++ADFG+     P+++  T CGS  Y SPEI+MG PY 
Sbjct: 257 ------------LLLDKKNKVIKIADFGMAALELPNKLLETSCGSPHYASPEIVMGKPYH 304

Query: 421 GRLSDSWAMGVILYALLEDRLPFD 444
           G  SD W+ G+IL+ALL   LPF+
Sbjct: 305 GGPSDVWSCGIILFALLTGHLPFN 328

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score =  102 bits (253), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 62/169 (36%), Positives = 88/169 (52%), Gaps = 21/169 (12%)

Query: 278 INDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELT 336
           I+ L  L  P  +   D+ +      M++ Y AG +LF+ +  +N + E   RR F ++ 
Sbjct: 88  ISYLRLLRHPHIIKLYDVIKSKDEIIMVIEY-AGNELFDYIVQRNKMSEQEARRFFQQII 146

Query: 337 LGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHI-VELADFGLCRRIEP 395
             V+Y H + IVHRDLK EN                  LLLD+H+ V++ADFGL   +  
Sbjct: 147 SAVEYCHRHKIVHRDLKPEN------------------LLLDEHLNVKIADFGLSNIMTD 188

Query: 396 DEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPFD 444
                T CGS +Y +PE++ G  Y G   D W+ GVILY +L  RLPFD
Sbjct: 189 GNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFD 237

>Kwal_26.8709
          Length = 829

 Score =  102 bits (254), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 94/178 (52%), Gaps = 20/178 (11%)

Query: 278 INDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELT 336
           IN L  LN P  +   ++ +      +++ Y +GG+ ++ +  +  L E    R+FA+L 
Sbjct: 96  INALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKEGPACRLFAQLI 155

Query: 337 LGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEP- 395
            GV Y+H   +VHRDLKLEN+L+           ++ E LL      + DFG      P 
Sbjct: 156 SGVYYMHSKGLVHRDLKLENLLL-----------DKNENLL------ITDFGFVNEFLPE 198

Query: 396 DEMCTTRCGSEDYVSPEILMGV-PYDGRLSDSWAMGVILYALLEDRLPFDPLPTAAPG 452
           +E+  T CGS  Y +PE+++   PY+ R +D W+ GVILYA+L   LP+D  P    G
Sbjct: 199 NELMKTSCGSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPDG 256

>YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protein
           kinase involved in septin organization and cell cycle
           control [3114 bp, 1037 aa]
          Length = 1037

 Score =  100 bits (250), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 85/166 (51%), Gaps = 20/166 (12%)

Query: 281 LTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFEL-ASQNTLPEWLLRRIFAELTLGV 339
           +  L+ P  LS  D+        +I+ Y   G+LF L      LPE      F ++ +G+
Sbjct: 81  MKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGI 140

Query: 340 KYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQ-HIVELADFGLCRRIEPDEM 398
            Y H   IVHRDLK EN                  LLLD  + +++ADFG+       ++
Sbjct: 141 SYCHALGIVHRDLKPEN------------------LLLDSFYNIKIADFGMAALQTDADL 182

Query: 399 CTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPFD 444
             T CGS  Y +PEI+ G+PY+G  SD W+ GVIL+ALL  RLPFD
Sbjct: 183 LETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFD 228

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score =  100 bits (249), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 88/169 (52%), Gaps = 21/169 (12%)

Query: 278 INDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELT 336
           I+ L  L  P  +   D+ +      M++ Y AG +LF+ +  ++ + E   RR F ++ 
Sbjct: 104 ISYLRLLRHPHIIKLYDVIKSKDEIIMVIEY-AGNELFDYIVQRDKMSEQEARRFFQQII 162

Query: 337 LGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHI-VELADFGLCRRIEP 395
             V+Y H + IVHRDLK EN                  LLLD+H+ V++ADFGL   +  
Sbjct: 163 SAVEYCHRHKIVHRDLKPEN------------------LLLDEHLNVKIADFGLSNIMTD 204

Query: 396 DEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPFD 444
                T CGS +Y +PE++ G  Y G   D W+ GVILY +L  RLPFD
Sbjct: 205 GNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFD 253

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score = 99.4 bits (246), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 88/169 (52%), Gaps = 21/169 (12%)

Query: 278 INDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELT 336
           I+ L  L  P  +   D+ +      M++ Y AG +LF+ +  ++ + E   RR F ++ 
Sbjct: 88  ISYLRLLRHPHIIKLYDVIKSKDEIIMVIEY-AGNELFDYIVQRDKMSENEARRFFQQII 146

Query: 337 LGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHI-VELADFGLCRRIEP 395
             V+Y H + IVHRDLK EN                  LLLD+H+ V++ADFGL   +  
Sbjct: 147 SAVEYCHRHKIVHRDLKPEN------------------LLLDEHLNVKIADFGLSNIMTD 188

Query: 396 DEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPFD 444
                T CGS +Y +PE++ G  Y G   D W+ GVILY +L  RLPFD
Sbjct: 189 GNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFD 237

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score =  100 bits (248), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 56/144 (38%), Positives = 76/144 (52%), Gaps = 21/144 (14%)

Query: 304 MIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           +++ Y  GG+LF+ L ++  LPE      F ++  GV Y H   I HRDLK EN      
Sbjct: 141 LVLEYVEGGELFDYLIARGKLPEQEAIHYFKQIVQGVSYCHNFNICHRDLKPEN------ 194

Query: 363 LDDILAMHEQRELLLDQH--IVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYD 420
                       LLLD+    V++ADFG+      + +  T CGS  Y SPEI+MG  Y 
Sbjct: 195 ------------LLLDKKNKTVKIADFGMAALETTNRLLETSCGSPHYASPEIVMGQKYH 242

Query: 421 GRLSDSWAMGVILYALLEDRLPFD 444
           G  SD W+ G+IL+ALL   LPF+
Sbjct: 243 GSPSDVWSCGIILFALLTGHLPFN 266

>Kwal_47.18233
          Length = 598

 Score = 99.0 bits (245), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 88/169 (52%), Gaps = 21/169 (12%)

Query: 278 INDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELT 336
           I+ L  L  P  +   D+ +      M++ Y AG +LF+ +  ++ + E   RR F ++ 
Sbjct: 80  ISYLRLLRHPHIIKLYDVVKSKDEIVMVIEY-AGNELFDYIVQRDKMSENEARRFFQQII 138

Query: 337 LGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHI-VELADFGLCRRIEP 395
             V+Y H + IVHRDLK EN                  LLLD+H+ V++ADFGL   +  
Sbjct: 139 SAVEYCHRHKIVHRDLKPEN------------------LLLDEHLNVKIADFGLSNIMTD 180

Query: 396 DEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPFD 444
                T CGS +Y +PE++ G  Y G   D W+ GVILY +L  RLPFD
Sbjct: 181 GNFLRTSCGSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFD 229

>Scas_616.10
          Length = 1461

 Score = 99.0 bits (245), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 56/144 (38%), Positives = 77/144 (53%), Gaps = 21/144 (14%)

Query: 304 MIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           +++ Y  GG+LF+ L S+  L E      F ++  GV Y H   I HRDLK EN      
Sbjct: 213 LVLEYVDGGELFDYLVSKGKLSEKEAVHYFKQIIQGVSYCHSFNICHRDLKPEN------ 266

Query: 363 LDDILAMHEQRELLLDQH--IVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYD 420
                       LLLD+    +++ADFG+     P+++  T CGS  Y SPEI+MG  Y 
Sbjct: 267 ------------LLLDKKNKSIKIADFGMAALELPNKLLQTSCGSPHYASPEIVMGKSYH 314

Query: 421 GRLSDSWAMGVILYALLEDRLPFD 444
           G  SD W+ G+IL+ALL   LPF+
Sbjct: 315 GGPSDVWSCGIILFALLTGHLPFN 338

>Scas_640.14*
          Length = 728

 Score = 98.2 bits (243), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 58/171 (33%), Positives = 87/171 (50%), Gaps = 22/171 (12%)

Query: 278 INDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELT 336
           IN L  L  P  +   ++ +      +++ Y +GG+ ++ +  +  L E    R+FA+L 
Sbjct: 97  INSLKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRKRRLKEATACRLFAQLI 156

Query: 337 LGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQH-IVELADFGLCRRIEP 395
            GV Y+H   IVHRDLKLEN                  LLLD+H  + + DFG       
Sbjct: 157 SGVSYMHSKGIVHRDLKLEN------------------LLLDKHENLIITDFGFVNEFYA 198

Query: 396 D-EMCTTRCGSEDYVSPEILMGV-PYDGRLSDSWAMGVILYALLEDRLPFD 444
           D E+  T CGS  Y +PE+++   PY  R +D W+ G+ILY +L   LP+D
Sbjct: 199 DNELMKTSCGSPCYAAPELVITTEPYKARKADIWSCGIILYGMLAGYLPWD 249

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score = 97.8 bits (242), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 91/178 (51%), Gaps = 20/178 (11%)

Query: 278 INDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELT 336
           IN L  L  P  +   ++ +      +++ Y +GG+ ++ +  +  L E    R+FA+L 
Sbjct: 104 INALKHLTHPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKESTACRLFAQLI 163

Query: 337 LGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPD 396
            GV Y+H   +VHRDLKLEN+L+           ++ E L+      + DFG      PD
Sbjct: 164 SGVTYMHSKNLVHRDLKLENLLL-----------DKNENLV------ITDFGFVNEFLPD 206

Query: 397 -EMCTTRCGSEDYVSPEILMGV-PYDGRLSDSWAMGVILYALLEDRLPFDPLPTAAPG 452
            E   T CGS  Y +PE+++   PY  R +D W+ G+ILYA+L   LP+D   T   G
Sbjct: 207 NEYMKTSCGSPCYAAPELVISTRPYVARKADVWSCGIILYAMLAGYLPWDDDSTNPEG 264

>Kwal_26.7788
          Length = 1267

 Score = 97.1 bits (240), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 77/144 (53%), Gaps = 21/144 (14%)

Query: 304 MIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           +++ Y  GG+LF+ L S+  LPE      F ++  G  Y H   I HRDLK EN      
Sbjct: 134 LVLEYVDGGELFDYLVSRGRLPEKEAIHYFRQIIEGTAYCHGFNICHRDLKPEN------ 187

Query: 363 LDDILAMHEQRELLLDQHI--VELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYD 420
                       LLLD+    +++ADFG+      +++  T CGS  Y SPEI+MG  Y+
Sbjct: 188 ------------LLLDKKNKRIKIADFGMAALQTSNKLLETSCGSPHYASPEIVMGKNYN 235

Query: 421 GRLSDSWAMGVILYALLEDRLPFD 444
           G  SD W+ G+IL+ALL   LPF+
Sbjct: 236 GGPSDVWSCGIILFALLTGHLPFN 259

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score = 97.1 bits (240), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 76/144 (52%), Gaps = 21/144 (14%)

Query: 304 MIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           +++ Y  GG+LF+ L S+  LPE      F ++   V Y H   I HRDLK EN      
Sbjct: 151 LVLEYVEGGELFDYLVSKGKLPESEAIHYFKQIVQAVAYCHGFNICHRDLKPEN------ 204

Query: 363 LDDILAMHEQRELLLDQ--HIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYD 420
                       LLLD+    +++ADFG+      D++  T CGS  Y SPEI++G  Y 
Sbjct: 205 ------------LLLDKKKRSIKIADFGMAALETSDKLLETSCGSPHYASPEIVLGRKYH 252

Query: 421 GRLSDSWAMGVILYALLEDRLPFD 444
           G  SD W+ G+IL+ALL   LPF+
Sbjct: 253 GSPSDVWSCGIILFALLTGHLPFN 276

>YPL141C (YPL141C) [5305] chr16 complement(283463..286060)
           Serine/threonine protein kinase with similarity to Kin4p
           [2598 bp, 865 aa]
          Length = 865

 Score = 95.9 bits (237), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 59/181 (32%), Positives = 94/181 (51%), Gaps = 26/181 (14%)

Query: 278 INDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELT 336
           IN L  L+ P  +   ++ +      +++ Y  GG+ ++ +  +  L E    R+F++L 
Sbjct: 101 INALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQKKRRLKEMNACRLFSQLI 160

Query: 337 LGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFG----LCRR 392
            GV Y+H   +VHRDLKLEN+L+           ++ E L+      + DFG     C R
Sbjct: 161 SGVHYIHSKGLVHRDLKLENLLL-----------DKNENLV------ITDFGFVNEFCSR 203

Query: 393 IEPDEMCTTRCGSEDYVSPEILMGV-PYDGRLSDSWAMGVILYALLEDRLPFDPLPTAAP 451
              +E+  T CGS  Y +PE+++   PY+ R +D W+ GVILYA+L   LP+D  P    
Sbjct: 204 ---NELMKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAILAGYLPWDDDPNNPE 260

Query: 452 G 452
           G
Sbjct: 261 G 261

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score = 95.9 bits (237), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 76/143 (53%), Gaps = 20/143 (13%)

Query: 304 MIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           M + YC G +L++ L S++ LP      +FA++T  V Y H    VHRDLKLENVL    
Sbjct: 110 MALEYCPGKELYDHLLSKSRLPTLECAELFAQITGAVHYAHTLNCVHRDLKLENVL---- 165

Query: 363 LDDILAMHEQRELLLDQH-IVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDG 421
                         LD++   +L DFG  R      +  T CG+  Y++PE++   PYDG
Sbjct: 166 --------------LDKNGNAKLTDFGFTRESMTKAVLETVCGTTVYMAPEMIQHKPYDG 211

Query: 422 RLSDSWAMGVILYALLEDRLPFD 444
              D W++GVILY LL   LPFD
Sbjct: 212 FKVDIWSLGVILYTLLCGCLPFD 234

>CAGL0M02519g complement(290723..292993) highly similar to tr|Q03002
           Saccharomyces cerevisiae YPL141c or sp|Q01919
           Saccharomyces cerevisiae YOR233w KIN4, hypothetical
           start
          Length = 756

 Score = 94.7 bits (234), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 71/240 (29%), Positives = 116/240 (48%), Gaps = 37/240 (15%)

Query: 278 INDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELT 336
           IN L  L+ P  +   ++ +      +++ Y AGG+ ++ +  +  L E    R+F++L 
Sbjct: 118 INALKHLSHPNIVKLEEVLQNSKYIGIVLEYAAGGEFYKFIQRKRRLKENHACRLFSQLI 177

Query: 337 LGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRR-IEP 395
             V Y+H   +VHRDLKLEN+L+           +  E L+      + DFG     +  
Sbjct: 178 SAVHYIHSKGLVHRDLKLENLLL-----------DNEENLI------ITDFGFVNEFLRQ 220

Query: 396 DEMCTTRCGSEDYVSPEILM-GVPYDGRLSDSWAMGVILYALLEDRLPFDPLPTAAPGKR 454
           + M  T CGS  Y +PE+++   PYD R +D+W+ G+IL+A+L   LP+D  P    G  
Sbjct: 221 NGMMKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLPWDDDPKNPDG-- 278

Query: 455 QRRSSTAHRISRFEWRWIKMAESEYPAK-EIVENCLTRKNI------RCNIEKIYENPYV 507
                  H ISR  + +I     ++P     V   L RK +      R NI  I ++P++
Sbjct: 279 -------HDISRL-YNYILNTPLKFPEYINPVPRDLLRKILVIDPKKRINIRSIEKHPWL 330

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score = 94.0 bits (232), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 52/150 (34%), Positives = 75/150 (50%), Gaps = 18/150 (12%)

Query: 304 MIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           M + YC G +L++ L  +  +P    RR+FA++   V Y H    VHRDLKLEN+L+   
Sbjct: 105 MALEYCPGNELYDYLLLKQRIPLDETRRLFAQIVSAVFYAHSLQCVHRDLKLENILLD-- 162

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
             +  AM              L DFG  R         T CG+  Y++PE++    YDG 
Sbjct: 163 -KNGYAM--------------LTDFGFTRECATKTQLETVCGTTVYMAPELIKREAYDGY 207

Query: 423 LSDSWAMGVILYALLEDRLPFDPLPTAAPG 452
             D+W++G+ILY +L   +PFD   T   G
Sbjct: 208 KVDTWSLGIILYTMLHGYMPFDEDDTVRTG 237

>YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine
           protein kinase related to Kin1p and Kin2p, catalytic
           domain is highly related to Snf1p [2403 bp, 800 aa]
          Length = 800

 Score = 93.6 bits (231), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 89/171 (52%), Gaps = 22/171 (12%)

Query: 278 INDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELT 336
           IN L  L  P  +   ++ +      +++ + +GG+ ++ +  +  L E    R+FA+L 
Sbjct: 101 INALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSACRLFAQLI 160

Query: 337 LGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQH-IVELADFGLCRR-IE 394
            GV Y+H   +VHRDLKLEN                  LLLD+H  + + DFG      E
Sbjct: 161 SGVNYMHYKGLVHRDLKLEN------------------LLLDKHENLVITDFGFVNEFFE 202

Query: 395 PDEMCTTRCGSEDYVSPEILMGVP-YDGRLSDSWAMGVILYALLEDRLPFD 444
            +E+  T CGS  Y +PE+++    Y+ R +D W+ GVILYA+L   LP+D
Sbjct: 203 DNELMKTSCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWD 253

>ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -
           SH] complement(560761..563556) [2796 bp, 931 aa]
          Length = 931

 Score = 93.6 bits (231), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 91/179 (50%), Gaps = 21/179 (11%)

Query: 278 INDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELT 336
           +N L  L+ P  +   ++ +      +++ Y +GG+ ++ +  +  L E    R+FA+L 
Sbjct: 99  LNALKLLSHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPPACRLFAQLI 158

Query: 337 LGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQH-IVELADFGLCRRIEP 395
            GV Y+H   + HRDLKLEN                  LLLD+H  + + DFG       
Sbjct: 159 SGVHYIHYKGLAHRDLKLEN------------------LLLDEHENLIITDFGFVNEFHK 200

Query: 396 DEMCTTRCGSEDYVSPEILMGV-PYDGRLSDSWAMGVILYALLEDRLPFDPLPTAAPGK 453
           +++  T CGS  Y +PE+++   PY  + +D W+ GVILYA+L   LP+D  P    G+
Sbjct: 201 NDLMRTSCGSPCYAAPELVVSSKPYSAQKADVWSCGVILYAMLAGYLPWDDDPENPEGE 259

>Scas_700.34
          Length = 864

 Score = 93.2 bits (230), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 57/171 (33%), Positives = 88/171 (51%), Gaps = 22/171 (12%)

Query: 278 INDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELT 336
           IN L  L  P  +   ++ +      +++ Y +GG+ ++ +  +  L E    R+FA+L 
Sbjct: 108 INALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKKRLKEGPACRLFAQLI 167

Query: 337 LGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQH-IVELADFGLCRRI-E 394
            GV Y+H   +VHRDLKLEN                  LLLD+H  + + DFG       
Sbjct: 168 NGVHYIHSKGLVHRDLKLEN------------------LLLDKHENLIITDFGFVSEFYS 209

Query: 395 PDEMCTTRCGSEDYVSPEILMGV-PYDGRLSDSWAMGVILYALLEDRLPFD 444
             E+  T CGS  Y +PE+++   PY+ + +D W+ GVILYA+L   LP+D
Sbjct: 210 HGELMKTSCGSPCYAAPELVVSTKPYEAKKADIWSCGVILYAMLAGYLPWD 260

>Kwal_56.23717
          Length = 858

 Score = 90.5 bits (223), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 73/142 (51%), Gaps = 18/142 (12%)

Query: 304 MIMSYCAGGDLFELASQN-TLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           M+  Y +GG L +   Q+ +L E   R+    +   ++YLH N IVHRDLK+EN++I   
Sbjct: 10  MLFEYVSGGQLLDYIIQHGSLRERSARKFARGIASALQYLHMNNIVHRDLKIENIMISTS 69

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
            +                 +++ DFGL     P +   T CGS  + +PE+L   PY G 
Sbjct: 70  GE-----------------IKIIDFGLSNMYNPKKQLHTFCGSLYFAAPELLKACPYTGP 112

Query: 423 LSDSWAMGVILYALLEDRLPFD 444
             D W+ GV+L+ L+  ++PFD
Sbjct: 113 EVDVWSFGVVLFVLVCGKVPFD 134

>YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine
           protein kinase, related to Kin1p and S. pombe KIN1 [3444
           bp, 1147 aa]
          Length = 1147

 Score = 90.5 bits (223), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 61/213 (28%), Positives = 100/213 (46%), Gaps = 42/213 (19%)

Query: 304 MIMSYCAGGDLFELASQN-TLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           M+  Y +GG L +   Q+ +L E   R+    +   ++YLH N IVHRDLK+EN++I   
Sbjct: 200 MLFEYVSGGQLLDYIIQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSS 259

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
            +                 +++ DFGL    +  +   T CGS  + +PE+L   PY G 
Sbjct: 260 GE-----------------IKIIDFGLSNIFDYRKQLHTFCGSLYFAAPELLKAQPYTGP 302

Query: 423 LSDSWAMGVILYALLEDRLPFDPLPTAAPGKRQRRSSTAHRISRFEWRWIKMAESEYPAK 482
             D W+ G++LY L+  ++PFD             SS  H         IK  + +YP+ 
Sbjct: 303 EVDIWSFGIVLYVLVCGKVPFD----------DENSSILH-------EKIKKGKVDYPSH 345

Query: 483 EIVE--NCLTRKNI-----RCNIEKIYENPYVN 508
             +E  + LTR  +     R  ++ + E+P++N
Sbjct: 346 LSIEVISLLTRMIVVDPLRRATLKNVVEHPWMN 378

>Kwal_26.8751
          Length = 848

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 74/144 (51%), Gaps = 18/144 (12%)

Query: 304 MIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           M + YC G +L+E L ++  +P      +F+++   V Y H    VHRDLKLEN+L    
Sbjct: 105 MALEYCPGKELYEYLLAKKHIPLEECSELFSQIVGAVYYAHSMKCVHRDLKLENIL---- 160

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
                        L  +   +L DFG  R      +  T CG+  Y++PE++   PY+G 
Sbjct: 161 -------------LDKKGHAKLTDFGFTRECATKGILETICGTTVYMAPELIERKPYEGY 207

Query: 423 LSDSWAMGVILYALLEDRLPFDPL 446
             D+W++G+ILY ++   +PFD +
Sbjct: 208 KIDTWSLGIILYTMIHGTMPFDEV 231

>AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W
           (KIN1) - SH] complement(823632..826847) [3216 bp, 1071
           aa]
          Length = 1071

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 73/142 (51%), Gaps = 18/142 (12%)

Query: 304 MIMSYCAGGDLFELASQN-TLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           M+  Y +GG L +   Q+ +L E   R+    +   ++YLH N IVHRDLK+EN++I   
Sbjct: 157 MLFEYVSGGQLLDYIIQHGSLRERHARKFARGIASALQYLHLNNIVHRDLKIENIMISSS 216

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
            +                 + + DFGL    +P +   T CGS  + +PE+L   PY G 
Sbjct: 217 GE-----------------IRIIDFGLSNMYDPKKQLHTFCGSLYFAAPELLKAHPYTGP 259

Query: 423 LSDSWAMGVILYALLEDRLPFD 444
             D W+ GV+LY L+  ++PFD
Sbjct: 260 EVDIWSFGVVLYVLVCGKVPFD 281

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score = 89.4 bits (220), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 75/142 (52%), Gaps = 18/142 (12%)

Query: 304 MIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           M++ YC+G +L+E L  +  L     +++F+++   V Y HE   VHRDLKLENVL    
Sbjct: 105 MVLEYCSGHELYEHLLKEQRLSLEESKKLFSQIASAVYYAHELKCVHRDLKLENVL---- 160

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
                       L  + H  +L DFG  R +       T CG+  Y++PE++    YDG 
Sbjct: 161 ------------LDGNGH-AKLTDFGFTREMATRSQLETICGTTVYMAPELIERKCYDGF 207

Query: 423 LSDSWAMGVILYALLEDRLPFD 444
             D W++G+ILY ++   +PFD
Sbjct: 208 KVDIWSLGIILYTMINGYMPFD 229

>Scas_700.28
          Length = 896

 Score = 89.0 bits (219), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 72/142 (50%), Gaps = 18/142 (12%)

Query: 304 MIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           M + YC G +L++ + S + +P     ++FA++  GV Y H    VHRDLKLEN+L+   
Sbjct: 106 MALEYCPGKELYDRVLSMHRVPTDECVQLFAQIVGGVHYAHSLNCVHRDLKLENILLDKS 165

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
            D                  +L DFG  R         T CG+  Y++PE++    YDG 
Sbjct: 166 GD-----------------AKLTDFGFTRECMTKTTLETICGTTVYMAPELIERKSYDGF 208

Query: 423 LSDSWAMGVILYALLEDRLPFD 444
             D W++GVILY ++   +PFD
Sbjct: 209 KIDIWSLGVILYTMINGSMPFD 230

>CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase,
           hypothetical start
          Length = 1192

 Score = 88.2 bits (217), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 73/142 (51%), Gaps = 18/142 (12%)

Query: 304 MIMSYCAGGDLFELASQN-TLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           M+  Y AGG L +   Q+ +L E   R+    +   ++YLH N IVHRDLK+EN++I   
Sbjct: 209 MLFEYVAGGQLLDYIIQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMIS-- 266

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
                          +   +++ DFGL    +  +   T CGS  + +PE+L   PY G 
Sbjct: 267 ---------------NSGEIKIIDFGLSNVYDTRKQLHTFCGSLYFAAPELLKAHPYTGP 311

Query: 423 LSDSWAMGVILYALLEDRLPFD 444
             D W+ GV+LY L+  ++PFD
Sbjct: 312 EVDVWSFGVVLYVLVCGKVPFD 333

>KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062
           Saccharomyces cerevisiae YPL141c, start by similarity
          Length = 909

 Score = 87.8 bits (216), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 53/168 (31%), Positives = 85/168 (50%), Gaps = 22/168 (13%)

Query: 278 INDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELT 336
           IN L  L  P  ++  ++ +      +++ Y +GG+ ++ +  +  L E    R+FA+L 
Sbjct: 109 INALKHLAHPNIVTLEEVLQNSKYIGIVLHYASGGEFYKYIQKKRRLKEPAACRLFAQLI 168

Query: 337 LGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQH-IVELADFGLCRRIEP 395
            GV Y+H   + HRDLKLEN                  LLLD+H  + + DFG       
Sbjct: 169 SGVHYMHHKGLAHRDLKLEN------------------LLLDEHENLIITDFGFVNEFSS 210

Query: 396 -DEMCTTRCGSEDYVSPEILMGVP-YDGRLSDSWAMGVILYALLEDRL 441
            +++  T CGS  Y +PE+++    Y+ R +D W+ GVILYA+L   L
Sbjct: 211 RNDLMKTSCGSPCYAAPELVVTTKAYEARKADVWSCGVILYAMLAGYL 258

>Sklu_2361.3 YPL150W, Contig c2361 3677-6331
          Length = 884

 Score = 87.4 bits (215), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 71/142 (50%), Gaps = 18/142 (12%)

Query: 304 MIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           M + YC G +L+E L  Q+ +      ++FA++   V Y H    VHRDLKLEN+L    
Sbjct: 105 MALEYCPGKELYEYLLMQHRISLEESGKLFAQIVSAVYYAHSLQCVHRDLKLENIL---- 160

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
                        L  +   ++ DFG  R      M  T CG+  Y++PE++    YDG 
Sbjct: 161 -------------LDKKGRAKITDFGFTRECATKTMLETVCGTTVYMAPELIERKSYDGF 207

Query: 423 LSDSWAMGVILYALLEDRLPFD 444
             D W++GVILY ++   +PFD
Sbjct: 208 KIDIWSLGVILYTMIHGTMPFD 229

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score = 86.3 bits (212), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 74/270 (27%), Positives = 123/270 (45%), Gaps = 62/270 (22%)

Query: 175 EAQETLTGFALHDTSHALQWRKVRQIGVGNFSDVYLYESVNQTATHLQKVAVKHVKYPEA 234
           +A+ T   +AL+D      ++ +R +G G+F  V+L  S +    +  KV  K+      
Sbjct: 132 KARVTSGKYALYD------FQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKNTVVKLK 185

Query: 235 LVQSSSPKXXXXXXXXXXXXXXXXXXXXALSGIWHPCIIHLHAINDLTFLNSPRPLSSRD 294
            V+ ++ +                     LS + HP II +      TF +S +      
Sbjct: 186 QVEHTNDERN------------------MLSIVSHPFIIRMWG----TFQDSQQLF---- 219

Query: 295 LTRGLPPCDMIMSYCAGGDLFELASQNT-LPEWLLRRIFAELTLGVKYLHENLIVHRDLK 353
                    MIM Y  GG+LF L  ++   P  + +   AE+ L ++YLH   I++RDLK
Sbjct: 220 ---------MIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKGIIYRDLK 270

Query: 354 LENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEI 413
            EN+L+                  + HI +L DFG  + + PD +  T CG+ DY++PE+
Sbjct: 271 PENILLD----------------KNGHI-KLTDFGFAKYV-PD-VTYTLCGTPDYIAPEV 311

Query: 414 LMGVPYDGRLSDSWAMGVILYALLEDRLPF 443
           +   PY+  + D W+ GV++Y +L    PF
Sbjct: 312 VSTKPYNKSV-DWWSFGVLIYEMLAGYTPF 340

>Scas_690.13
          Length = 354

 Score = 84.7 bits (208), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/262 (26%), Positives = 121/262 (46%), Gaps = 62/262 (23%)

Query: 183 FALHDTSHALQWRKVRQIGVGNFSDVYLYESVNQTATHLQKVAVKHVKYPEALVQSSSPK 242
           + LHD      ++ +R +G G+F  V+L  SV+    +  KV  K        ++ ++ +
Sbjct: 39  YTLHD------FQVMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVRMKQIEHTNDE 92

Query: 243 XXXXXXXXXXXXXXXXXXXXALSGIWHPCIIHLHAINDLTFLNSPRPLSSRDLTRGLPPC 302
                                L  + HP +I +      TF +S      R+L       
Sbjct: 93  RR------------------MLKLVEHPFLIRMWG----TFQDS------RNLF------ 118

Query: 303 DMIMSYCAGGDLFELASQNT-LPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKF 361
            M+M Y  GG+LF L  ++   P  + +   AE+TLG++YLH + I++RDLK EN+L+  
Sbjct: 119 -MVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLGLEYLHSHNIIYRDLKPENILLD- 176

Query: 362 PLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDG 421
                           + HI ++ DFG  + +  D +  T CG  DY++PE++   PY+ 
Sbjct: 177 ---------------RNGHI-KITDFGFAKEV--DTVTWTLCGPPDYIAPEVIATKPYNK 218

Query: 422 RLSDSWAMGVILYALLEDRLPF 443
            + D W++GV+++ +L    PF
Sbjct: 219 SV-DWWSLGVLIFEMLAGYTPF 239

>Scas_693.17
          Length = 1049

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 72/142 (50%), Gaps = 18/142 (12%)

Query: 304 MIMSYCAGGDLFELASQN-TLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           M+  Y +GG L +   Q+ +L E   R    ++   +KYLH + IVHRDLK+EN++I   
Sbjct: 177 MLFEYVSGGQLLDYIIQHGSLKESRARTFTRQICSALKYLHSHNIVHRDLKIENIMISKD 236

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
            +                 ++L DFGL    +      T CGS  + +PE+L   PY G 
Sbjct: 237 GN-----------------IKLIDFGLSNLYDKCNKLKTYCGSLYFAAPELLKATPYIGP 279

Query: 423 LSDSWAMGVILYALLEDRLPFD 444
             D W+ GV+LY L+  ++PFD
Sbjct: 280 EIDVWSFGVVLYVLVCGKVPFD 301

>Scas_564.7
          Length = 1210

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 73/142 (51%), Gaps = 18/142 (12%)

Query: 304 MIMSYCAGGDLFELASQN-TLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           M+  Y +GG L +   Q+ +L E   R+    +   ++Y+H N IVHRDLK+EN++I   
Sbjct: 263 MLFEYVSGGQLLDYIIQHGSLREHHARKFARGIASALEYIHANNIVHRDLKIENIMISTS 322

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
            +                 +++ DFGL    +  +   T CGS  + +PE+L   PY G 
Sbjct: 323 GE-----------------IKIIDFGLSNVFDRKKQLHTFCGSLYFAAPELLKAHPYTGP 365

Query: 423 LSDSWAMGVILYALLEDRLPFD 444
             D W+ GV+LY L+  ++PFD
Sbjct: 366 EVDVWSFGVVLYVLVCGKVPFD 387

>CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces
           cerevisiae YDR122w KIN1 or sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2, hypothetical start
          Length = 944

 Score = 86.7 bits (213), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 76/148 (51%), Gaps = 18/148 (12%)

Query: 304 MIMSYCAGGDLFELASQN-TLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           M   + +GG L +   Q+ +L E   R++   +   ++YLH N IVHRDLK+EN++    
Sbjct: 168 MFFEFISGGQLLDYIIQHGSLKENHARKVSRGILSALQYLHANNIVHRDLKIENIM---- 223

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
                        L     ++L DFGL    +P +   T CGS  + +PE+L   PY G 
Sbjct: 224 -------------LSKTGEIKLIDFGLSNMYDPRKSLQTFCGSLYFAAPELLKAHPYLGP 270

Query: 423 LSDSWAMGVILYALLEDRLPFDPLPTAA 450
             D W+ GV+LY L+  ++PFD   ++A
Sbjct: 271 EVDVWSFGVVLYVLVCGKVPFDDENSSA 298

>KLLA0F11143g complement(1026129..1028570) similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 813

 Score = 86.7 bits (213), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 56/188 (29%), Positives = 92/188 (48%), Gaps = 24/188 (12%)

Query: 281 LTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGV 339
           L  LN PR +  +D         M+M + +GGDL + +A+  T+ E   R I  ++   V
Sbjct: 242 LQKLNHPRIVKLKDFFEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAGREITRQVLEAV 301

Query: 340 KYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMC 399
           KY+H+  I HRDLK +N++I           EQ + +L    +++ DFGL +    +   
Sbjct: 302 KYMHDQGISHRDLKPDNIMI-----------EQDDPVL----IKITDFGLAKVQNQNTFL 346

Query: 400 TTRCGSEDYVSPEILMGVPYDGR--------LSDSWAMGVILYALLEDRLPFDPLPTAAP 451
            T CG+  YV+PE++ G   + +        L D W++G ++Y +L   LPF        
Sbjct: 347 NTFCGTLAYVAPEVIDGKNAEDKTNRDLYSSLVDMWSIGCLVYVILTGHLPFSGQSQNEL 406

Query: 452 GKRQRRSS 459
            K+ +R S
Sbjct: 407 FKQIKRGS 414

>YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine protein
           kinase, related to Kin2p and S. pombe KIN1 [3195 bp,
           1064 aa]
          Length = 1064

 Score = 85.9 bits (211), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 72/142 (50%), Gaps = 18/142 (12%)

Query: 304 MIMSYCAGGDLFELASQN-TLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           M+  Y +GG L +   Q+ ++ E   R+    +   + YLH N IVHRDLK+EN++I   
Sbjct: 221 MLFEYVSGGQLLDYIIQHGSIREHQARKFARGIASALIYLHANNIVHRDLKIENIMIS-- 278

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
                          D   +++ DFGL    +  +   T CGS  + +PE+L   PY G 
Sbjct: 279 ---------------DSSEIKIIDFGLSNIYDSRKQLHTFCGSLYFAAPELLKANPYTGP 323

Query: 423 LSDSWAMGVILYALLEDRLPFD 444
             D W+ GV+L+ L+  ++PFD
Sbjct: 324 EVDVWSFGVVLFVLVCGKVPFD 345

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score = 83.6 bits (205), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 79/141 (56%), Gaps = 21/141 (14%)

Query: 304 MIMSYCAGGDLFELASQNT-LPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           M+M Y  GG+LF L  ++   P  + +   AE+TL ++YLH + I++RDLK EN+L+   
Sbjct: 126 MVMDYIEGGELFTLLRKSQRFPNPVAKFYAAEVTLALEYLHFHNIIYRDLKPENILLD-- 183

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
                          + HI ++ DFG  + +E   +  T CG+ DY++PE++   PY+  
Sbjct: 184 --------------RNGHI-KITDFGFAKEVET--VTWTLCGTPDYIAPEVIATKPYNKS 226

Query: 423 LSDSWAMGVILYALLEDRLPF 443
           + D W++GV++Y +L    PF
Sbjct: 227 V-DWWSLGVLIYEMLAGYTPF 246

>KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase, start by
           similarity
          Length = 1104

 Score = 85.1 bits (209), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 73/142 (51%), Gaps = 18/142 (12%)

Query: 304 MIMSYCAGGDLFELASQN-TLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           M+  Y +GG L +   Q+ +L E   R+    +   ++YLH N IVHRDLK+EN++I   
Sbjct: 199 MLFEYVSGGQLLDYIIQHGSLRERHARKFVRGIASALQYLHLNNIVHRDLKIENIMISTS 258

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
            +                 +++ DFGL    +  +   T CGS  + +PE+L   PY G 
Sbjct: 259 GE-----------------IKIIDFGLSNLYDNKKQLHTFCGSLYFAAPELLKANPYIGP 301

Query: 423 LSDSWAMGVILYALLEDRLPFD 444
             D W+ GV++Y L+  ++PFD
Sbjct: 302 EVDIWSFGVVIYVLVCGKVPFD 323

>YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic
           subunit of cAMP-dependent protein kinase 3, protein
           kinase A or PKA [1197 bp, 398 aa]
          Length = 398

 Score = 83.2 bits (204), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 82/327 (25%), Positives = 140/327 (42%), Gaps = 85/327 (25%)

Query: 197 VRQIGVGNFSDVYLYESVNQTATHLQKVAVKHVKYPEALVQSSSPKXXXXXXXXXXXXXX 256
           +R +G G+F  V+L  S +    +  K   KH       V+ ++ +              
Sbjct: 91  LRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERR------------ 138

Query: 257 XXXXXXALSGIWHPCIIHLHAINDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE 316
                  LS + HP II +      TF +S +               M+M Y  GG+LF 
Sbjct: 139 ------MLSIVSHPFIIRMWG----TFQDSQQVF-------------MVMDYIEGGELFS 175

Query: 317 LASQNT-LPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQREL 375
           L  ++   P  + +   AE+ L ++YLH   I++RDLK EN+L+                
Sbjct: 176 LLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLD--------------- 220

Query: 376 LLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYA 435
             + HI ++ DFG  + + PD +  T CG+ DY++PE++   PY+  + D W+ GV++Y 
Sbjct: 221 -KNGHI-KITDFGFAKYV-PD-VTYTLCGTPDYIAPEVVSTKPYNKSV-DWWSFGVLIYE 275

Query: 436 LLEDRLPFDPLPTAAPGKRQRRSSTAHRISRFEWRWIKMAESEYP------AKEIVENCL 489
           +L    PF              S+T           I  AE ++P      A+++++  +
Sbjct: 276 MLAGYTPF------------YNSNTMKTYEN-----ILNAELKFPPFFHPDAQDLLKKLI 318

Query: 490 TRK------NIRCNIEKIYENPYVNEV 510
           TR       N++   E +  +P+ NEV
Sbjct: 319 TRDLSERLGNLQNGSEDVKNHPWFNEV 345

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score = 83.2 bits (204), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 68/262 (25%), Positives = 121/262 (46%), Gaps = 62/262 (23%)

Query: 183 FALHDTSHALQWRKVRQIGVGNFSDVYLYESVNQTATHLQKVAVKHVKYPEALVQSSSPK 242
           + LHD      ++ +R +G G+F  V+L  SV+    +  KV  KH       ++ ++ +
Sbjct: 57  YTLHD------FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQIIRMKQIEHTNDE 110

Query: 243 XXXXXXXXXXXXXXXXXXXXALSGIWHPCIIHLHAINDLTFLNSPRPLSSRDLTRGLPPC 302
                                L  + HP +I +      TF +S      R+L       
Sbjct: 111 RR------------------MLKLVEHPFLIRMWG----TFQDS------RNLF------ 136

Query: 303 DMIMSYCAGGDLFELASQNT-LPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKF 361
            M+M Y  GG+LF L  ++   P  + +   AE+TL ++YLH + I++RDLK EN+L+  
Sbjct: 137 -MVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHSHNIIYRDLKPENILLD- 194

Query: 362 PLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDG 421
                           + HI ++ DFG  + +    +  T CG+ DY++PE++   PY+ 
Sbjct: 195 ---------------RNGHI-KITDFGFAKEVI--TVTWTLCGTPDYIAPEVITTKPYNK 236

Query: 422 RLSDSWAMGVILYALLEDRLPF 443
            + D W++G++++ +L    PF
Sbjct: 237 SV-DWWSLGILIFEMLAGYTPF 257

>YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic
           subunit of cAMP-dependent protein kinase 1, protein
           kinase A or PKA [1194 bp, 397 aa]
          Length = 397

 Score = 83.2 bits (204), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 80/322 (24%), Positives = 137/322 (42%), Gaps = 73/322 (22%)

Query: 197 VRQIGVGNFSDVYLYESVNQTATHLQKVAVKHVKYPEALVQSSSPKXXXXXXXXXXXXXX 256
           +R +G G+F  V+L  S +    +  KV  K +      V+ ++ +              
Sbjct: 90  LRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERL------------ 137

Query: 257 XXXXXXALSGIWHPCIIHLHAINDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE 316
                  LS + HP II +      TF ++ +               MIM Y  GG+LF 
Sbjct: 138 ------MLSIVTHPFIIRMWG----TFQDAQQIF-------------MIMDYIEGGELFS 174

Query: 317 LASQNT-LPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQREL 375
           L  ++   P  + +   AE+ L ++YLH   I++RDLK EN+L                L
Sbjct: 175 LLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENIL----------------L 218

Query: 376 LLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYA 435
             + HI ++ DFG  + + PD +  T CG+ DY++PE++   PY+  + D W+ G+++Y 
Sbjct: 219 DKNGHI-KITDFGFAKYV-PD-VTYTLCGTPDYIAPEVVSTKPYNKSI-DWWSFGILIYE 274

Query: 436 LLEDRLPFDPLPTAAPGKRQRRSSTAHRISRFEWRWIKMAESEYPAKEIVENCLTRK--- 492
           +L    PF    T           T  +I   E R+      +   K+++   +TR    
Sbjct: 275 MLAGYTPFYDSNTM---------KTYEKILNAELRFPPFFNED--VKDLLSRLITRDLSQ 323

Query: 493 ---NIRCNIEKIYENPYVNEVA 511
              N++   E +  +P+  EV 
Sbjct: 324 RLGNLQNGTEDVKNHPWFKEVV 345

>KLLA0E01584g 149713..150960 highly similar to sp|P39009
           Saccharomyces cerevisiae YDL101c DUN1 protein kinase,
           start by similarity
          Length = 415

 Score = 83.2 bits (204), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 51/146 (34%), Positives = 79/146 (54%), Gaps = 10/146 (6%)

Query: 304 MIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKF- 361
           +++     G+LFE +  +N L E   + +F +L  G+KYLH   I+HRD+K EN+L+   
Sbjct: 181 LVLEKINDGELFERIVRKNNLREDETKALFRQLLNGLKYLHSRNIIHRDIKPENILLSIS 240

Query: 362 ----PLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGV 417
               P +  L   +  EL +    V++ADFGL +     +   T CG+  YV+PE+L+  
Sbjct: 241 KRRSPEEIALGPWDDDELDIQ---VKIADFGLAKFTGEMKFTNTLCGTPSYVAPEVLVKT 297

Query: 418 PYDGRLSDSWAMGVILYALLEDRLPF 443
            Y  R+ D W+ GV+LY  L    PF
Sbjct: 298 GYTSRV-DMWSAGVLLYVCLCGFPPF 322

>CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces
           cerevisiae YDL101c DUN1 protein kinase, start by
           similarity
          Length = 506

 Score = 83.2 bits (204), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 59/187 (31%), Positives = 97/187 (51%), Gaps = 24/187 (12%)

Query: 264 LSGIWHPCIIHLHAINDLTFLNS-PRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQN 321
           L  I HP I++L        L+S   P+S   + + L     ++     G+LF+ +  + 
Sbjct: 245 LMKIHHPNIVNL--------LDSFVEPISKTQIQKYL-----VLEKIDDGELFDRIVKKT 291

Query: 322 TLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKF-----PLDDILAMHEQRELL 376
           +LP+   + IF ++  G+KYLH   I+HRD+K EN+L+       P +  L   ++ E+ 
Sbjct: 292 SLPQEESKAIFKQILTGLKYLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEID 351

Query: 377 LDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYAL 436
           +    V++ADFGL +     +   T CG+  YV+PE+L+   Y  ++ D W+ GVILY  
Sbjct: 352 IQ---VKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVLVKKGYTSKV-DLWSAGVILYVC 407

Query: 437 LEDRLPF 443
           L    PF
Sbjct: 408 LCGFPPF 414

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/248 (26%), Positives = 110/248 (44%), Gaps = 56/248 (22%)

Query: 197 VRQIGVGNFSDVYLYESVNQTATHLQKVAVKHVKYPEALVQSSSPKXXXXXXXXXXXXXX 256
           +R +G G+F  V+L  S +    +  K   KH       V+ ++ +              
Sbjct: 155 LRTLGTGSFGRVHLIRSNHNGRFYALKALKKHTVVKLKQVEHTNDERR------------ 202

Query: 257 XXXXXXALSGIWHPCIIHLHAINDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE 316
                  LS + HP II +      TF +S                 M+M Y  GG+LF 
Sbjct: 203 ------MLSIVSHPFIIRMWG----TFQDSQHVF-------------MVMDYIEGGELFS 239

Query: 317 LASQNT-LPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQREL 375
           L  ++   P  + +   AE+ L ++YLH   I++RDLK EN+L+                
Sbjct: 240 LLRKSQRFPNPVAKFYAAEVCLALEYLHSKEIIYRDLKPENILLD--------------- 284

Query: 376 LLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYA 435
             + HI ++ DFG  + + PD +  T CG+ DY++PE++   PY+  + D W+ G+++Y 
Sbjct: 285 -KNGHI-KITDFGFAKYV-PD-VTYTLCGTPDYIAPEVVSTKPYNKSV-DWWSFGILIYE 339

Query: 436 LLEDRLPF 443
           +L    PF
Sbjct: 340 MLAGYTPF 347

>ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH]
           complement(597519..600032) [2514 bp, 837 aa]
          Length = 837

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 87/173 (50%), Gaps = 25/173 (14%)

Query: 281 LTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGV 339
           L  LN PR +S +          ++M + +GGDL + +A+  ++ E   R I  ++   V
Sbjct: 267 LRRLNHPRIVSLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAV 326

Query: 340 KYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMC 399
           +Y+HE  I HRDLK +N+LI           EQ + +L    V++ DFGL +  +     
Sbjct: 327 RYIHEQGISHRDLKPDNILI-----------EQDDPVL----VKITDFGLAKIQDNTTFM 371

Query: 400 TTRCGSEDYVSPEILMGVPYDGR---------LSDSWAMGVILYALLEDRLPF 443
            T CG+  YV+PE++ G   +G          L D W++G ++Y +L   LPF
Sbjct: 372 KTFCGTLAYVAPEVIGGKNPEGNGANGNLYSSLVDMWSIGCLVYVILTGHLPF 424

>KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31, start by similarity
          Length = 1229

 Score = 82.8 bits (203), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 79/154 (51%), Gaps = 21/154 (13%)

Query: 313  DLFELASQNT-LPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHE 371
            DLF+L    T + E+  + +F ++  G+K+LH+N IVHRD+K ENV++            
Sbjct: 1064 DLFDLIELKTNMTEFEAKLLFKQVASGIKHLHDNGIVHRDIKDENVIVD----------- 1112

Query: 372  QRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGV 431
                  ++  V+L DFG    ++         G+ DY +PE+L G PY+G+  D WA+GV
Sbjct: 1113 ------NKGFVKLIDFGSAAYVKSGPF-DVFVGTIDYAAPEVLGGEPYEGKPQDIWAIGV 1165

Query: 432  ILYALLEDRLPFDPLPTAAPGKRQRRSSTAHRIS 465
            +LY ++    PF  +     G    R  + H +S
Sbjct: 1166 LLYTIIYKENPFYNIDEILDG--DLRIQSTHEVS 1197

>YPL203W (TPK2) [5245] chr16 (166255..167397) Catalytic subunit of
           cAMP-dependent protein kinase 2, protein kinase A or PKA
           [1143 bp, 380 aa]
          Length = 380

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 78/141 (55%), Gaps = 21/141 (14%)

Query: 304 MIMSYCAGGDLFELASQNT-LPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           M+M Y  GG+LF L  ++   P  + +   AE+ L ++YLH + I++RDLK EN+L+   
Sbjct: 145 MVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLD-- 202

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
                          + HI ++ DFG  + ++   +  T CG+ DY++PE++   PY+  
Sbjct: 203 --------------RNGHI-KITDFGFAKEVQ--TVTWTLCGTPDYIAPEVITTKPYNKS 245

Query: 423 LSDSWAMGVILYALLEDRLPF 443
           + D W++GV++Y +L    PF
Sbjct: 246 V-DWWSLGVLIYEMLAGYTPF 265

>Sklu_2086.4 , Contig c2086 6437-7168 reverse complement
          Length = 243

 Score = 78.6 bits (192), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 76/150 (50%), Gaps = 19/150 (12%)

Query: 313 DLFELASQNT-LPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHE 371
           DLF+L    T + E   + IF ++  G+K+LH+N IVHRD+K EN+++            
Sbjct: 78  DLFDLIELKTNMTEHEAKLIFKQVASGIKHLHDNGIVHRDIKDENIIVD----------- 126

Query: 372 QRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGV 431
                 ++  V+L DFG    ++         G+ DY +PE+L G PY+G+  D WA+GV
Sbjct: 127 ------NKGFVKLIDFGSAAYVKSGPF-DVFVGTIDYAAPEVLGGDPYEGKPQDIWAIGV 179

Query: 432 ILYALLEDRLPFDPLPTAAPGKRQRRSSTA 461
           +LY ++    PF  +     G  +  SS  
Sbjct: 180 LLYTIIFKENPFYNIDEILDGDLRISSSVT 209

>AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH]
           complement(274336..275376) [1041 bp, 346 aa]
          Length = 346

 Score = 80.5 bits (197), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 79/141 (56%), Gaps = 21/141 (14%)

Query: 304 MIMSYCAGGDLFELASQNT-LPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           ++M Y  GG+LF L  ++   P  + +   AE+TL ++YLH + I++RDLK EN+L+   
Sbjct: 111 IVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHAHNIIYRDLKPENILLD-- 168

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
                          + HI ++ DFG  +  E D +  T CG+ DY++PE++   PY+  
Sbjct: 169 --------------RNGHI-KITDFGFAK--EVDTVTWTLCGTPDYIAPEVITTKPYNKS 211

Query: 423 LSDSWAMGVILYALLEDRLPF 443
           + D W++G++++ +L    PF
Sbjct: 212 I-DWWSLGILIFEMLAGYTPF 231

>Kwal_56.24059
          Length = 353

 Score = 80.1 bits (196), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 78/141 (55%), Gaps = 21/141 (14%)

Query: 304 MIMSYCAGGDLFELASQNT-LPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           M+M Y  GG+LF L  ++   P  + +   AE+ L ++YLH + I++RDLK EN+L+   
Sbjct: 118 MVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHSHDIIYRDLKPENILLD-- 175

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
                          + HI ++ DFG  + +  D +  T CG+ DY++PE++   PY+  
Sbjct: 176 --------------RNGHI-KITDFGFAKEV--DTVTWTLCGTPDYIAPEVIATKPYNKS 218

Query: 423 LSDSWAMGVILYALLEDRLPF 443
           + D W++G++++ +L    PF
Sbjct: 219 V-DWWSLGILIFEMLAGYTPF 238

>Scas_651.18
          Length = 371

 Score = 79.7 bits (195), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 111/248 (44%), Gaps = 56/248 (22%)

Query: 197 VRQIGVGNFSDVYLYESVNQTATHLQKVAVKHVKYPEALVQSSSPKXXXXXXXXXXXXXX 256
           +R +G G+F  V+L  S +    +  KV  KH       V+ ++ +              
Sbjct: 62  LRTLGTGSFGRVHLIRSNHNGRFYALKVLKKHTIVKLKQVEHTNDERL------------ 109

Query: 257 XXXXXXALSGIWHPCIIHLHAINDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE 316
                  LS + HP ++ +      TF +  +               MIM Y  GG+LF 
Sbjct: 110 ------MLSVVSHPFLVRMWG----TFQDFEQVF-------------MIMDYIEGGELFS 146

Query: 317 LASQNT-LPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQREL 375
           L  ++   P  + +   AE+ L ++YLH   I++RDLK EN+L+                
Sbjct: 147 LLRKSQRFPNPVAKFYAAEVCLALEYLHSMDIIYRDLKPENILLD--------------- 191

Query: 376 LLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYA 435
             + HI ++ DFG  + + PD +  T CG+ DY++PE++   PY+  + D W+ G+++Y 
Sbjct: 192 -KNGHI-KITDFGFAKYV-PD-ITYTLCGTPDYIAPEVVSTKPYNKSV-DWWSFGILIYE 246

Query: 436 LLEDRLPF 443
           +L    PF
Sbjct: 247 MLAGYTPF 254

>ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..683847)
            [3450 bp, 1149 aa]
          Length = 1149

 Score = 81.3 bits (199), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 75/143 (52%), Gaps = 27/143 (18%)

Query: 306  MSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDD 365
            M +  GGDL        L     +   AE+ L +KY H+N I++RDLKLEN+L       
Sbjct: 902  MEFIGGGDLMWHVQNQRLSVRRAKFYAAEVLLALKYFHDNGIIYRDLKLENIL------- 954

Query: 366  ILAMHEQRELLLDQHIVELADFGLCRRIEPDEM-----CTTRCGSEDYVSPEILMGVPYD 420
                     L L+ HI ++AD+GLC+    DEM      +T CG+ ++++PEIL    Y 
Sbjct: 955  ---------LTLEGHI-KIADYGLCK----DEMWFGNRTSTFCGTPEFMAPEILREQAY- 999

Query: 421  GRLSDSWAMGVILYALLEDRLPF 443
             +  D WA GV+LY +L  + PF
Sbjct: 1000 TKAVDWWAFGVLLYQMLLCQSPF 1022

>Scas_613.5
          Length = 517

 Score = 80.5 bits (197), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 94/186 (50%), Gaps = 22/186 (11%)

Query: 264 LSGIWHPCIIHLHAINDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNT 322
           L  I HP I++L     L F     P+S   + + L     ++     G+LFE +  +  
Sbjct: 256 LMRIHHPNIVNL-----LDFF--IEPVSKSQIQKYL-----VLDKIDDGELFERIVKKTC 303

Query: 323 LPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKF-----PLDDILAMHEQRELLL 377
           L +   + IF ++ +G+K+LH+  I+HRD+K EN+L+       P    L   ++ E+ +
Sbjct: 304 LRQDETKAIFNQILMGLKHLHQQNIIHRDIKPENILLNITRRTNPEQKQLGPWDEDEIDI 363

Query: 378 DQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALL 437
               V++ADFGL +     +   T CG+  YV+PE+L    Y  ++ D W+ GVILY  L
Sbjct: 364 Q---VKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVLTKKGYTSKV-DMWSAGVILYVCL 419

Query: 438 EDRLPF 443
               PF
Sbjct: 420 CGFPPF 425

>YPL150W (YPL150W) [5297] chr16 (268187..270892) Serine/threonine
           protein kinase with unknown role [2706 bp, 901 aa]
          Length = 901

 Score = 81.3 bits (199), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 71/143 (49%), Gaps = 20/143 (13%)

Query: 304 MIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           M + YC G +L++ L S   +       +FA+++  V Y H    VHRDLKLEN+L    
Sbjct: 109 MALEYCPGKELYDHLLSLRRISLLECGELFAQISGAVYYAHSMHCVHRDLKLENIL---- 164

Query: 363 LDDILAMHEQRELLLDQH-IVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDG 421
                         LD++   +L DFG  R         T CG+  Y++PE++    YDG
Sbjct: 165 --------------LDKNGNAKLTDFGFTRECMTKTTLETVCGTTVYMAPELIERRTYDG 210

Query: 422 RLSDSWAMGVILYALLEDRLPFD 444
              D W++GVILY L+   LPFD
Sbjct: 211 FKIDIWSLGVILYTLITGYLPFD 233

>YPL153C (RAD53) [5294] chr16 complement(261726..264191)
           Serine/threonine/tyrosine protein kinase with a
           checkpoint function in S and G2 phases, contains
           forkhead associated (FHA) domain [2466 bp, 821 aa]
          Length = 821

 Score = 80.9 bits (198), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 84/176 (47%), Gaps = 28/176 (15%)

Query: 281 LTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGV 339
           L  LN PR +  +          M+M + +GGDL + +A+   + E   R I  ++   +
Sbjct: 248 LQKLNHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILTAI 307

Query: 340 KYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMC 399
           KY+H   I HRDLK +N+LI           EQ + +L    V++ DFGL +        
Sbjct: 308 KYIHSMGISHRDLKPDNILI-----------EQDDPVL----VKITDFGLAKVQGNGSFM 352

Query: 400 TTRCGSEDYVSPEILMGVP-------YDGR-----LSDSWAMGVILYALLEDRLPF 443
            T CG+  YV+PE++ G         Y+ R     L D W+MG ++Y +L   LPF
Sbjct: 353 KTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPF 408

>Kwal_33.13846
          Length = 375

 Score = 79.3 bits (194), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 67/249 (26%), Positives = 111/249 (44%), Gaps = 58/249 (23%)

Query: 197 VRQIGVGNFSDVYLYESVNQTATHLQKVAVKHVKYPEALVQSSSPKXXXXXXXXXXXXXX 256
           +R +G G+F  V+L  S +    +  KV  K        V+ ++ +              
Sbjct: 68  LRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKRTIVKLKQVEHTNDERRM----------- 116

Query: 257 XXXXXXALSGIWHPCIIHLHAINDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE 316
                  LS + HP II +      TF ++                 MIM Y  GG+LF 
Sbjct: 117 -------LSVVSHPFIIRMWG----TFQDAEHVF-------------MIMDYIEGGELFS 152

Query: 317 LASQNT-LPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQREL 375
           L  ++   P  + +   AE+ L ++YLH   I++RDLK ENV                  
Sbjct: 153 LLRKSQRFPNPVAKFYAAEVCLALEYLHAQDIIYRDLKPENV------------------ 194

Query: 376 LLDQHI-VELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILY 434
           LLD++  V++ DFG  + + PD +  T CG+ DY++PE++   PY+  + D W+ G++++
Sbjct: 195 LLDKNGHVKITDFGFAKFV-PD-VTYTLCGTPDYIAPEVVSTKPYNKSV-DWWSFGILIF 251

Query: 435 ALLEDRLPF 443
            +L    PF
Sbjct: 252 EMLAGYTPF 260

>Scas_689.25*
          Length = 409

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 77/142 (54%), Gaps = 23/142 (16%)

Query: 304 MIMSYCAGGDLFELASQNT-LPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           MIM Y  GG+LF L  ++   P  + +   AE+ L + YLH   I++RDLK EN      
Sbjct: 174 MIMDYVEGGELFSLLRRSQRFPNPVAKFYAAEVCLALDYLHSLDIIYRDLKPEN------ 227

Query: 363 LDDILAMHEQRELLLDQH-IVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDG 421
                       LLLD++  +++ DFG  + + PD +  T CG+ DY++PE++   PY+ 
Sbjct: 228 ------------LLLDRNGHIKVTDFGFAKYV-PD-VTYTLCGTPDYIAPEVISAKPYNK 273

Query: 422 RLSDSWAMGVILYALLEDRLPF 443
            + D W+ G+++Y +L    PF
Sbjct: 274 SV-DWWSFGILIYEMLSGHTPF 294

>Scas_715.34
          Length = 1150

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 73/143 (51%), Gaps = 27/143 (18%)

Query: 306  MSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDD 365
            M +  GGDL        L     +   AE+ L +KY H+N +++RDLKLEN+        
Sbjct: 903  MEFIGGGDLMWHVQNQRLSVRRAKFYAAEVLLALKYFHDNGVIYRDLKLENI-------- 954

Query: 366  ILAMHEQRELLLDQHIVELADFGLCRRIEPDEM-----CTTRCGSEDYVSPEILMGVPYD 420
                     LL  Q  +++AD+GLC+    DEM      +T CG+ ++++PEIL    Y 
Sbjct: 955  ---------LLTPQGHIKIADYGLCK----DEMWYNNKTSTFCGTPEFMAPEILKEQGY- 1000

Query: 421  GRLSDSWAMGVILYALLEDRLPF 443
             R  D WA GV+LY +L  + PF
Sbjct: 1001 TRAVDWWAFGVLLYQMLLCQSPF 1023

>CAGL0J11638g complement(1128620..1130860) highly similar to
           sp|P32562 Saccharomyces cerevisiae YMR001c CDC5 involved
           in regulation of DNA replication, hypothetical start
          Length = 746

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 77/145 (53%), Gaps = 24/145 (16%)

Query: 304 MIMSYCAGGDLFEL-ASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           +++  C  G L EL   + T+ E  +R    ++  G++Y+H N ++HRDLKL N+     
Sbjct: 155 ILLEICPNGSLMELIKKRKTITEPEVRFFMTQICGGIQYMHSNRVIHRDLKLGNI----- 209

Query: 363 LDDILAMHEQRELLLDQHI-VELADFGLCRRIEPD-EMCTTRCGSEDYVSPEILMGVPYD 420
                          D+H  +++ DFGL   +  D E   T CG+ +Y++PE+LMG  + 
Sbjct: 210 -------------FFDEHYNLKIGDFGLAAVLANDRERKFTICGTPNYIAPEVLMG-KHS 255

Query: 421 GRL--SDSWAMGVILYALLEDRLPF 443
           G     D W++GV+LYALL  + PF
Sbjct: 256 GHSYEVDIWSIGVMLYALLIGKPPF 280

>YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kinase
           required for induction of Rnr3p and DNA repair genes
           after DNA damage [1542 bp, 513 aa]
          Length = 513

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/187 (31%), Positives = 94/187 (50%), Gaps = 24/187 (12%)

Query: 264 LSGIWHPCIIHLHAINDLTFLNS-PRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQN 321
           L  + HP I++L        L+S   P+S   + + L     ++     G+LFE +  + 
Sbjct: 252 LMRVQHPNIVNL--------LDSFVEPISKSQIQKYL-----VLEKIDDGELFERIVRKT 298

Query: 322 TLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKF-----PLDDILAMHEQRELL 376
            L +   + +F +L  G+KYLHE  I+HRD+K EN+L+       P    L   ++ E+ 
Sbjct: 299 CLRQDESKALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEID 358

Query: 377 LDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYAL 436
           +    V++ADFGL +     +   T CG+  YV+PE+L    Y  ++ D W+ GVILY  
Sbjct: 359 IQ---VKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVLTKKGYTSKV-DLWSAGVILYVC 414

Query: 437 LEDRLPF 443
           L    PF
Sbjct: 415 LCGFPPF 421

>CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31 or sp|Q08217 Saccharomyces
            cerevisiae YOL045w, start by similarity
          Length = 1206

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 71/132 (53%), Gaps = 19/132 (14%)

Query: 313  DLFELAS-QNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHE 371
            DLF++   ++ + E+  + IF ++  G+K+LH+  IVHRD+K ENV++            
Sbjct: 1041 DLFDIIEFKSNMTEFEAKLIFKQIVSGIKHLHDQGIVHRDIKDENVIVD----------- 1089

Query: 372  QRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGV 431
                   +  V+L DFG    ++         G+ DY +PE+L G PY+G+  D WA+G+
Sbjct: 1090 ------SKGFVKLIDFGSAAYVKSGPF-DVFVGTIDYAAPEVLGGNPYEGKSQDIWAIGI 1142

Query: 432  ILYALLEDRLPF 443
            +LY L+    PF
Sbjct: 1143 LLYTLIYKENPF 1154

>Kwal_26.7154
          Length = 1213

 Score = 79.0 bits (193), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 68/131 (51%), Gaps = 20/131 (15%)

Query: 313  DLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQ 372
            DL E+ +  T  E +L  IF ++  G+K LH+N IVHRD+K ENV++             
Sbjct: 1051 DLIEMKTDMTEHEAML--IFKQIASGIKNLHDNGIVHRDIKDENVIVDC----------- 1097

Query: 373  RELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVI 432
                     V++ DFG    ++         G+ DY +PE+L G PY+G+  D WA+GV+
Sbjct: 1098 ------NGFVKIVDFGSAAYVKSGPF-DVFVGTIDYAAPEVLGGEPYEGKPQDIWAIGVL 1150

Query: 433  LYALLEDRLPF 443
            LY ++    PF
Sbjct: 1151 LYTIIYKENPF 1161

>Scas_548.6
          Length = 1382

 Score = 78.6 bits (192), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 70/132 (53%), Gaps = 19/132 (14%)

Query: 313  DLFELASQNT-LPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHE 371
            DLF+L    T + E+  + IF ++  G+K+LH+  IVHRD+K ENV++            
Sbjct: 1217 DLFDLIEFKTNMTEFEAKLIFKQIVSGIKHLHDQGIVHRDIKDENVIVD----------- 1265

Query: 372  QRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGV 431
                   +  V++ DFG    ++         G+ DY +PE+L G PY+G+  D WA+G+
Sbjct: 1266 ------SKGCVKIIDFGSAAYVKSGPF-DVFVGTIDYAAPEVLSGEPYEGKPQDIWAIGI 1318

Query: 432  ILYALLEDRLPF 443
            +LY ++    PF
Sbjct: 1319 LLYTIVFKENPF 1330

>Sklu_2211.5 YBL105C, Contig c2211 10237-13764
          Length = 1175

 Score = 78.2 bits (191), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 74/143 (51%), Gaps = 27/143 (18%)

Query: 306  MSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDD 365
            M +  GGDL        L     +   AE+ L +KY H+N +V+RDLKLEN+L       
Sbjct: 928  MEFIGGGDLMWHVQNQRLSVRRAKFYAAEVLLALKYFHDNGVVYRDLKLENIL------- 980

Query: 366  ILAMHEQRELLLDQHIVELADFGLCRRIEPDEM-----CTTRCGSEDYVSPEILMGVPYD 420
                     L  + HI ++AD+GLC+    DEM      +T CG+ ++++PEIL    Y 
Sbjct: 981  ---------LTPEGHI-KIADYGLCK----DEMWYGNKTSTFCGTPEFMAPEILKEQEYT 1026

Query: 421  GRLSDSWAMGVILYALLEDRLPF 443
              + D WA GV+LY +L  + PF
Sbjct: 1027 KSV-DWWAFGVLLYQMLLCQSPF 1048

>Kwal_27.10581
          Length = 1154

 Score = 78.2 bits (191), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 74/143 (51%), Gaps = 27/143 (18%)

Query: 306  MSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDD 365
            M +  GGDL        L     +   AE+ L +KY H+N +++RDLKLEN+L       
Sbjct: 907  MEFIGGGDLMWHVQNQRLSVRRAKFYAAEVLLALKYFHDNGVIYRDLKLENIL------- 959

Query: 366  ILAMHEQRELLLDQHIVELADFGLCRRIEPDEM-----CTTRCGSEDYVSPEILMGVPYD 420
                     L  + HI ++AD+GLC+    DEM      +T CG+ ++++PEIL    Y 
Sbjct: 960  ---------LTPEGHI-KIADYGLCK----DEMWYGNKTSTFCGTPEFMAPEILKEQEY- 1004

Query: 421  GRLSDSWAMGVILYALLEDRLPF 443
             +  D WA GV+LY +L  + PF
Sbjct: 1005 TKAVDWWAFGVLLYQMLLCQSPF 1027

>YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase C,
            regulates MAP kinase cascade involved in regulating cell
            wall metabolism [3456 bp, 1151 aa]
          Length = 1151

 Score = 77.8 bits (190), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 74/143 (51%), Gaps = 27/143 (18%)

Query: 306  MSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDD 365
            M +  GGDL        L     +   AE+ L +KY H+N +++RDLKLEN+L       
Sbjct: 904  MEFIGGGDLMWHVQNQRLSVRRAKFYAAEVLLALKYFHDNGVIYRDLKLENIL------- 956

Query: 366  ILAMHEQRELLLDQHIVELADFGLCRRIEPDEM-----CTTRCGSEDYVSPEILMGVPYD 420
                     L  + HI ++AD+GLC+    DEM      +T CG+ ++++PEIL    Y 
Sbjct: 957  ---------LTPEGHI-KIADYGLCK----DEMWYGNRTSTFCGTPEFMAPEILKEQEY- 1001

Query: 421  GRLSDSWAMGVILYALLEDRLPF 443
             +  D WA GV+LY +L  + PF
Sbjct: 1002 TKAVDWWAFGVLLYQMLLCQSPF 1024

>CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31, start by similarity
          Length = 1336

 Score = 77.8 bits (190), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 75/148 (50%), Gaps = 19/148 (12%)

Query: 313  DLFELASQNT-LPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHE 371
            DLF+L    T + E   + +F ++  GVK+LH+  IVHRD+K EN+++            
Sbjct: 1171 DLFDLIEFKTNMTEIEAKLLFKQVVSGVKHLHDQGIVHRDIKDENIIVD----------- 1219

Query: 372  QRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGV 431
                   Q  V++ DFG    ++         G+ DY +PE+L G PY+G+  D WA+G+
Sbjct: 1220 ------SQGFVKIIDFGSAAYVKSGPF-DVFVGTIDYAAPEVLGGSPYEGKPQDIWAIGI 1272

Query: 432  ILYALLEDRLPFDPLPTAAPGKRQRRSS 459
            +LY ++    PF  +     G+ +  SS
Sbjct: 1273 LLYTIVFKENPFYNIDEILEGELKFNSS 1300

>Kwal_27.10004
          Length = 735

 Score = 77.4 bits (189), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 79/173 (45%), Gaps = 47/173 (27%)

Query: 295 LTRGLPPCDMIMSYCAGGDLFELASQNTLPEWLLRRI------FAELTLGVKYLHENLIV 348
           +TRG      +M YC  GDLF L S+   P W  R +      + ++  G+K++H   +V
Sbjct: 355 MTRGWA---FVMEYCTEGDLFSLISK---PNWKKRPLKEKYEYWRQVVEGIKFIHSQGVV 408

Query: 349 HRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCR--RIEPDEMCT------ 400
           HRD+K ENVLI                   + I ++ DFG+      +PD++ +      
Sbjct: 409 HRDIKPENVLIS-----------------KEGIAKMTDFGISDWGNEDPDDLTSPVRLFD 451

Query: 401 TRCGSEDYVSPEILM----------GVPYDGRLSDSWAMGVILYALLEDRLPF 443
           T  GS  Y +PE++             PYD    D WA+GV+L+ L+    PF
Sbjct: 452 TYVGSPPYSAPEVVAFKDEDSTYQDRKPYDAYKMDCWALGVLLFTLVYQCTPF 504

>CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent or
           sp|P38622 Saccharomyces cerevisiae YGL158w RCK1,
           hypothetical start
          Length = 514

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 110/238 (46%), Gaps = 41/238 (17%)

Query: 304 MIMSYCAGGDLF-ELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
            I  Y  GG++F ++       E L R +  ++   VK LHEN I+HRD+K EN++ + P
Sbjct: 153 FIQEYIEGGEIFNQIVKYTYFSEDLTRHVIRQVATAVKGLHENNIIHRDIKPENLIFE-P 211

Query: 363 LDDILAMHEQRELL--------LDQ------------HIVELADFGLCRRIEPDEM-CTT 401
           +     +H  ++L         LD+              V L DFGL R ++P E    T
Sbjct: 212 IIKEQTIHRYQKLRKSDDPKTKLDEGKFIPGIGGGGIGKVRLVDFGLSRLMDPAESGART 271

Query: 402 RCGSEDYVSPEILMGVPYDGRLS--------DSWAMGVILYALLEDRLPFDPLPTAAPGK 453
            CG+  Y++PE+L     D R S        D WA+G ILY +L    PF     +    
Sbjct: 272 PCGTFGYLAPEVLNQYKVDPRTSNTSYSYKVDIWAIGCILYTMLCGFPPFYEDEFS---- 327

Query: 454 RQRRSSTAHRISRFEWRWIK--MAESEYPAKEIVENCL-TRKNIRCNIEKIYENPYVN 508
              + S   +ISR  ++++     E    A++++ N L      R +I+++  +P++N
Sbjct: 328 ---KESLGDKISRGNYKFLAPWWDEISIEAQDLIRNLLQVDPAKRYDIDQLLAHPWLN 382

>AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C
           (TPK1) - SH] (405062..406222) [1161 bp, 386 aa]
          Length = 386

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 73/270 (27%), Positives = 122/270 (45%), Gaps = 62/270 (22%)

Query: 175 EAQETLTGFALHDTSHALQWRKVRQIGVGNFSDVYLYESVNQTATHLQKVAVKHVKYPEA 234
           E + T   + L+D      ++ +R +G G+F  V+L  S +    +  KV  KHV     
Sbjct: 63  EGRTTKGKYTLYD------FQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKHVVVKLK 116

Query: 235 LVQSSSPKXXXXXXXXXXXXXXXXXXXXALSGIWHPCIIHLHAINDLTFLNSPRPLSSRD 294
            V+ ++ +                     LS + HP II +      TF ++ +      
Sbjct: 117 QVEHTNDERKM------------------LSVVSHPFIIRMWG----TFQDAHQVF---- 150

Query: 295 LTRGLPPCDMIMSYCAGGDLFELASQNT-LPEWLLRRIFAELTLGVKYLHENLIVHRDLK 353
                    MIM Y  GG+LF L  ++   P  + +   AE+ L ++YLH   I++RDLK
Sbjct: 151 ---------MIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLK 201

Query: 354 LENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEI 413
            EN+L+                  + HI +L DFG  + + PD +  T CG+ DY++PE+
Sbjct: 202 PENILLD----------------KNGHI-KLTDFGFAKYV-PD-VTYTLCGTPDYIAPEV 242

Query: 414 LMGVPYDGRLSDSWAMGVILYALLEDRLPF 443
           +   PY+  + D W+ G+++Y +L    PF
Sbjct: 243 VSTKPYNKSV-DWWSFGILIYEMLAGYTPF 271

>ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) - SH]
            (864528..868307) [3780 bp, 1259 aa]
          Length = 1259

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 71/132 (53%), Gaps = 19/132 (14%)

Query: 313  DLFELASQNT-LPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHE 371
            DLF+L    T + E   + +F ++  G+++LHEN IVHRD+K ENV++            
Sbjct: 1094 DLFDLIELKTNMTEHEAKLLFKQVASGLRHLHENGIVHRDIKDENVIVD----------- 1142

Query: 372  QRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGV 431
                  ++  V++ DFG    ++         G+ DY +PE+L G PY+G+  D WA+GV
Sbjct: 1143 ------NRGRVKIIDFGSAAYVKRGPF-DVFVGTIDYAAPEVLGGDPYEGKPQDVWAVGV 1195

Query: 432  ILYALLEDRLPF 443
            +LY ++    PF
Sbjct: 1196 LLYTIIYKENPF 1207

>Scas_700.54
          Length = 698

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 80/168 (47%), Gaps = 23/168 (13%)

Query: 284 LNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGVKYL 342
           L+ PR +  +          M+M + +GGDL + +A+   + E   + I  ++   VKY+
Sbjct: 276 LDHPRIVRLKGFYEDKDSYYMVMEFVSGGDLMDFVAAHGAVGEEAGKEISRQILEAVKYI 335

Query: 343 HENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTR 402
           H   I HRDLK +N+LI           EQ + +L    V++ DFGL +         T 
Sbjct: 336 HSKGISHRDLKPDNILI-----------EQDDPVL----VKITDFGLAKVQGNGSFMKTF 380

Query: 403 CGSEDYVSPEILMGVPYDGR-------LSDSWAMGVILYALLEDRLPF 443
           CG+  YV+PE++ G             L D W+MG ++Y +L   LPF
Sbjct: 381 CGTLAYVAPEVIGGKGETNEERNEYSSLVDMWSMGCLVYVILTGHLPF 428

>Kwal_26.8796
          Length = 796

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 84/171 (49%), Gaps = 23/171 (13%)

Query: 281 LTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGV 339
           L  L+ PR +S +          ++M + +GGDL + +A+  ++ E   R I  ++   V
Sbjct: 238 LQRLDHPRIVSLKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAV 297

Query: 340 KYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMC 399
           KY+H   I HRDLK +N+LI            +R+   D  +V++ DFGL +        
Sbjct: 298 KYIHSMGISHRDLKPDNILI------------ERD---DPVLVKITDFGLAKIQGNGTFM 342

Query: 400 TTRCGSEDYVSPEILMGVPYDGR-------LSDSWAMGVILYALLEDRLPF 443
            T CG+  YV+PE++ G     +       L D W++G ++Y +L   LPF
Sbjct: 343 KTFCGTLAYVAPEVISGKNSGEKEGNTYSSLVDMWSIGCLVYVILTGHLPF 393

>YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine protein
            kinase involved in the regulation of carbohydrate
            storage, has similarity to human PIM-1 oncogene [4071 bp,
            1356 aa]
          Length = 1356

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 70/132 (53%), Gaps = 19/132 (14%)

Query: 313  DLFELASQNT-LPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHE 371
            DLF+L    T + E+  + IF ++  G+K+LH+  IVHRD+K ENV++            
Sbjct: 1191 DLFDLIEFKTNMTEFEAKLIFKQVVAGIKHLHDQGIVHRDIKDENVIVD----------- 1239

Query: 372  QRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGV 431
                   +  V++ DFG    ++         G+ DY +PE+L G PY+G+  D WA+G+
Sbjct: 1240 ------SKGFVKIIDFGSAAYVKSGPF-DVFVGTIDYAAPEVLGGNPYEGQPQDIWAIGI 1292

Query: 432  ILYALLEDRLPF 443
            +LY ++    PF
Sbjct: 1293 LLYTVVFKENPF 1304

>AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..90211)
           [1419 bp, 472 aa]
          Length = 472

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 78/146 (53%), Gaps = 10/146 (6%)

Query: 304 MIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKF- 361
           +++     G+LF+ +  +  L +   R +F ++  G+KYLH+  I+HRD+K EN+L+   
Sbjct: 235 LVLEKIQDGELFDKIVRKTKLHQDETRALFKQILAGLKYLHDRNIIHRDIKPENILLSIR 294

Query: 362 ----PLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGV 417
               P    L   ++ EL +    V++ADFGL +     +  TT CG+  YV+ E+L   
Sbjct: 295 RRTSPDQVQLGPWDEDELDI---TVKIADFGLAKFTGEMQFTTTLCGTPSYVAAEVLTKT 351

Query: 418 PYDGRLSDSWAMGVILYALLEDRLPF 443
            Y  ++ D W+ GV+LY  L    PF
Sbjct: 352 GYTSKV-DLWSAGVLLYVCLCGFPPF 376

>Scas_580.6
          Length = 1015

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 74/142 (52%), Gaps = 20/142 (14%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPL 363
           +IM YCAGG L  L     + E  +  I  EL + +KY+H++ ++HRD+K  NVLI    
Sbjct: 111 IIMEYCAGGSLRSLLRPGKIDEKYIGVIMRELLVALKYIHKDNVIHRDIKAANVLI---- 166

Query: 364 DDILAMHEQRELLLDQHIVELADFGLCRRIEPDEM-CTTRCGSEDYVSPEILM-GVPYDG 421
                         ++  V+L DFG+  ++    +   T  G+  +++PE++M GV YD 
Sbjct: 167 -------------TNEGSVKLCDFGVAAQLNQSTLRRQTMAGTPYWMAPEVIMEGVYYDT 213

Query: 422 RLSDSWAMGVILYALLEDRLPF 443
           ++ D W++G+  Y +     P+
Sbjct: 214 KV-DIWSLGITAYEIATGNPPY 234

>KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732.1
            Kluyveromyces lactis protein kinase C, start by
            similarity
          Length = 1161

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 73/143 (51%), Gaps = 27/143 (18%)

Query: 306  MSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDD 365
            M +  GGDL        L     +   AE+ L +KY H+N +++RDLKLEN+L       
Sbjct: 914  MEFIGGGDLMWHVQNRRLSVRRAKFYAAEVLLSLKYFHDNGVIYRDLKLENIL------- 966

Query: 366  ILAMHEQRELLLDQHIVELADFGLCRRIEPDEM-----CTTRCGSEDYVSPEILMGVPYD 420
                     L  + HI ++AD+GLC+    D M      +T CG+ ++++PEIL G  Y 
Sbjct: 967  ---------LTPEGHI-KIADYGLCK----DNMWYGNKTSTFCGTPEFMAPEILKGQAY- 1011

Query: 421  GRLSDSWAMGVILYALLEDRLPF 443
             +  D W  GV+LY +L  + PF
Sbjct: 1012 TKAVDWWTFGVLLYQMLLCQSPF 1034

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 53/179 (29%), Positives = 85/179 (47%), Gaps = 33/179 (18%)

Query: 281 LTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGV 339
           L  LN PR +S +          M+M + +GGDL + +A+   + E   R I  ++   +
Sbjct: 238 LQKLNHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGAVGEEAGREISRQILEAI 297

Query: 340 KYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMC 399
           +Y+H   I HRDLK +N+LI           EQ + +L    V++ DFGL +      + 
Sbjct: 298 QYIHSKGISHRDLKPDNILI-----------EQDDPVL----VKITDFGLAKVQGNGSIM 342

Query: 400 TTRCGSEDYVSPEILMGVPYDG---------------RLSDSWAMGVILYALLEDRLPF 443
            T CG+  YV+PE++ G  + G                L D W+MG +++ +L   LPF
Sbjct: 343 KTFCGTLAYVAPEVIGG--FTGATGEEETEEERIEYSSLVDMWSMGCLVFVILTGHLPF 399

>Kwal_23.3590
          Length = 499

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 76/148 (51%), Gaps = 14/148 (9%)

Query: 304 MIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           +++   + G+LF+ +  +  L E     IF ++  G++YLH   I+HRD+K EN+L+   
Sbjct: 266 LVLEKVSDGELFDRIVRKTRLREDETNAIFKQILNGLRYLHAKNIIHRDIKPENILLS-- 323

Query: 363 LDDILAMHEQRELLL----DQHI---VELADFGLCRRIEPDEMCTTRCGSEDYVSPEILM 415
              I       E  L    D  I   +++ADFGL + I   +   T CG+  YV+PE+L 
Sbjct: 324 ---IRKRRHSDEQQLGPWDDDEIDITIKIADFGLAKFIGEMQFTNTLCGTPSYVAPEVLT 380

Query: 416 GVPYDGRLSDSWAMGVILYALLEDRLPF 443
              Y  R+ D W+ GV+LY  L    PF
Sbjct: 381 KTGYTSRV-DMWSAGVLLYVCLCGFPPF 407

>YDR523C (SPS1) [1335] chr4 complement(1485554..1487026)
           Serine/threonine protein kinase involved in middle/late
           stage of meiosis [1473 bp, 490 aa]
          Length = 490

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/174 (31%), Positives = 84/174 (48%), Gaps = 32/174 (18%)

Query: 304 MIMSYCAGG---DLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIK 360
           ++M YC GG   DL + +  N LPE  +  I  E+TLG+KYLHE   +HRD+K  N+L+ 
Sbjct: 91  IVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRKIHRDIKAANILLN 150

Query: 361 FPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYD 420
                            ++ +V+L DFG+   I       T  G+  +++PE++     D
Sbjct: 151 -----------------EEGMVKLGDFGVSGHIRSTLKRDTFVGTPYWMAPEVVC-CEVD 192

Query: 421 G--RLSDSWAMGVILYALLEDRLP---FDP------LPTAAPGKRQRRSSTAHR 463
           G    +D W++G+  Y LL+   P   +DP      LP   P K Q   S A +
Sbjct: 193 GYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGPFSDAAK 246

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 70/142 (49%), Gaps = 19/142 (13%)

Query: 304 MIMSYCAGGDLFELASQNT-LPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           ++M Y   G+L++    N  L E L      ++   + Y+H   I+HRD+K EN+LI F 
Sbjct: 175 LLMEYVYYGELYKFLKNNGPLNETLASYFVYQMANALDYMHSKNILHRDIKPENILIGF- 233

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
                            + ++L DFG     E  +   T CG+ DY+SPE++    Y+ +
Sbjct: 234 ----------------NNTIKLTDFGWSVYNEDGQKRKTLCGTIDYLSPELIKSREYNNK 277

Query: 423 LSDSWAMGVILYALLEDRLPFD 444
           + D WA+GV+ Y LL    PF+
Sbjct: 278 V-DVWALGVLTYELLVGSPPFE 298

>KLLA0F23507g complement(2198603..2200066) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, start by similarity
          Length = 487

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 90/366 (24%), Positives = 148/366 (40%), Gaps = 74/366 (20%)

Query: 167 GSQHIIEPEAQETLTGF--ALHDTSHALQWRKV-RQIGVGNFSDVYLYESVNQTATHLQK 223
           G++        ET++ F   L   S   +W+ V R +G G F  V + E V+      ++
Sbjct: 109 GAKFKFSAVKSETMSQFMTGLRIKSEWDRWKIVPRIVGSGTFGHVLVAEKVDHNMK--RQ 166

Query: 224 VAVKHVKYPEALVQSSSPKXXXXXXXXXXXXXXXXXXXXALSGIWHPCIIHLHAINDLTF 283
           VA K V Y   ++ ++  +                     L  + HP II +H       
Sbjct: 167 VAKKTVSYAVKVINTAKTRMVKEAT--------------ILEKLNHPNIIRIHQ------ 206

Query: 284 LNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLH 343
            +    L +  + + L     + SY A GD     S+    E L+  I  ++ L +K+LH
Sbjct: 207 -SCVDALGNVYIFQDLISGGDLFSYLAKGDCLVPISET---ESLI--IIYQILLALKFLH 260

Query: 344 ENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPD--EMCTT 401
            N IVHRDLKL+N+L+  P                   V LADFG+ + +  +  E   T
Sbjct: 261 SNGIVHRDLKLDNILLHTPEPCTK--------------VVLADFGIAKELSQNTKERMHT 306

Query: 402 RCGSEDYVSPEILMGVP-------------------YDGRLSDSWAMGVILYALLEDRLP 442
             G+ +Y +PE+                        YD +  D W++GVI + +L    P
Sbjct: 307 VVGTPEYCAPEVGFKADRNIYRSFSRTATLDPDNNGYDSK-CDIWSLGVITHIMLTGISP 365

Query: 443 FDPLPTAAPGKRQRRSSTAHRISRFEWRWIKMAESEYPAKEIVENCLTRKNI-RCNIEKI 501
           F    + A   +  R+   +  +R   +WI + +S   AK  V+ CL      RC++E+ 
Sbjct: 366 FYGDGSEASIIKNVRTGKLNFTAR---QWIAITDS---AKSFVKKCLQVSTFNRCDVEEA 419

Query: 502 YENPYV 507
               +V
Sbjct: 420 LHQVWV 425

>Scas_627.7
          Length = 349

 Score = 73.9 bits (180), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 74/143 (51%), Gaps = 21/143 (14%)

Query: 304 MIMSYCAGGDLFEL-ASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           ++M Y   G+L++L  S     + +  R   ++   + YLH+  I+HRDLK EN+LI F 
Sbjct: 166 LLMEYLVYGELYKLLRSHGPFNDVIASRFVFQIADALNYLHDKQIIHRDLKPENILIGF- 224

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMC-TTRCGSEDYVSPEILMGVPYDG 421
                            ++++L DFG    I P  +   T CG+ DY+SPE++    YD 
Sbjct: 225 ----------------NNVIKLTDFGWS-IINPRGVKRKTLCGTIDYLSPEMIRSREYDD 267

Query: 422 RLSDSWAMGVILYALLEDRLPFD 444
           ++ D WA+GV+ Y L+    PF+
Sbjct: 268 KV-DVWALGVLTYELIVGSPPFE 289

>KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces
           cerevisiae YKL126w YPK1 ser/thr-specific protein kinase,
           start by similarity
          Length = 716

 Score = 75.1 bits (183), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 76/142 (53%), Gaps = 20/142 (14%)

Query: 304 MIMSYCAGGDLF-ELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           +++++  GG+LF  L  +        R   AEL   ++ LH+  I++RDLK EN+L+ + 
Sbjct: 457 LVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENILLDY- 515

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCR-RIEPDEMCTTRCGSEDYVSPEILMGVPYDG 421
                           Q  + L DFGLC+  ++  E  TT CG+ +Y++PE+L+G  Y  
Sbjct: 516 ----------------QGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGY-T 558

Query: 422 RLSDSWAMGVILYALLEDRLPF 443
           ++ D W +GV+LY +L    P+
Sbjct: 559 KVVDWWTLGVLLYEMLTGLPPY 580

>Kwal_47.16761
          Length = 744

 Score = 74.7 bits (182), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 74/146 (50%), Gaps = 21/146 (14%)

Query: 301 PCDM--IMSYCAGGDLF-ELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENV 357
           P D+  +  + +GG+LF  L  +    E   R   AEL L ++YLHEN IV+RDLK EN+
Sbjct: 407 PADLYLVTDFMSGGELFWHLQKEGRFAEDRARFYIAELVLALEYLHENDIVYRDLKPENI 466

Query: 358 LIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGV 417
           L+    +                 + L DFGL +    D    T CG+ +Y++PE+L+  
Sbjct: 467 LLDANGN-----------------IALCDFGLSKADLKDR-TNTFCGTTEYLAPELLLDE 508

Query: 418 PYDGRLSDSWAMGVILYALLEDRLPF 443
               ++ D W++GV+++ +     PF
Sbjct: 509 SGYTKMVDFWSLGVLIFEMCCGWSPF 534

>Kwal_56.24091
          Length = 381

 Score = 73.2 bits (178), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 69/142 (48%), Gaps = 19/142 (13%)

Query: 304 MIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           ++M Y   G+L++ L S     +        ++   + Y+H   I+HRD+K EN+L+ F 
Sbjct: 198 LLMEYLVNGELYKHLRSHGPFNDITASHFVHQMADALNYMHSKNILHRDIKPENILLGF- 256

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
                           Q+ ++L DFG       +    T CG+ DY+SPE++    YD +
Sbjct: 257 ----------------QNTLKLTDFGWSVSNVGNSKRKTLCGTMDYLSPELIKSREYDNK 300

Query: 423 LSDSWAMGVILYALLEDRLPFD 444
           + D WA+GV+ Y LL    PF+
Sbjct: 301 V-DVWALGVLTYELLVGSPPFE 321

>YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine
           protein kinase involved in the cell integrity signaling
           pathway and required for endocytosis, possibly involved
           in a sphingolipid-mediated signaling pathway, has
           similarity to protein kinase C [2043 bp, 680 aa]
          Length = 680

 Score = 74.3 bits (181), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 74/142 (52%), Gaps = 20/142 (14%)

Query: 304 MIMSYCAGGDLF-ELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
            ++++  GG+LF  L  +        R   AEL   +  LH+  +V+RDLK EN+L+ + 
Sbjct: 422 FVLAFINGGELFYHLQKEGRFDLSRARFYTAELLCALDNLHKLDVVYRDLKPENILLDY- 480

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCR-RIEPDEMCTTRCGSEDYVSPEILMGVPYDG 421
                           Q  + L DFGLC+  ++ D+   T CG+ +Y++PE+L+G+ Y  
Sbjct: 481 ----------------QGHIALCDFGLCKLNMKDDDKTDTFCGTPEYLAPELLLGLGY-T 523

Query: 422 RLSDSWAMGVILYALLEDRLPF 443
           +  D W +GV+LY +L    P+
Sbjct: 524 KAVDWWTLGVLLYEMLTGLPPY 545

>YPL209C (IPL1) [5240] chr16 complement(156489..157592)
           Serine/threonine protein kinase of the mitotic spindle,
           involved in chromosome segregation and activation of the
           spindle checkpoint by detection of kinetochore tension,
           required for proper spindle disassembly and orientation
           [1104 bp, 367 aa]
          Length = 367

 Score = 73.2 bits (178), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 71/142 (50%), Gaps = 19/142 (13%)

Query: 304 MIMSYCAGGDLFELAS-QNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           ++M Y   G++++L        + L      ++   + Y+H+  I+HRD+K EN+LI F 
Sbjct: 179 LLMEYLVNGEMYKLLRLHGPFNDILASDYIYQIANALDYMHKKNIIHRDIKPENILIGF- 237

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
                            ++++L DFG      P+    T CG+ DY+SPE++    YD  
Sbjct: 238 ----------------NNVIKLTDFGWSIINPPENRRKTVCGTIDYLSPEMVESREYDHT 281

Query: 423 LSDSWAMGVILYALLEDRLPFD 444
           + D+WA+GV+ + LL    PF+
Sbjct: 282 I-DAWALGVLAFELLTGAPPFE 302

>CAGL0K07458g complement(736336..738450) similar to sp|P12688
           Saccharomyces cerevisiae YKL126w or sp|P18961
           Saccharomyces cerevisiae YMR104c ser/thr-specific
           protein kinases, start by similarity
          Length = 704

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 77/142 (54%), Gaps = 20/142 (14%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWLLRRIFA-ELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           ++++   GG+LF    +  + +    R +A EL L +  LH+  +V+RDLK EN+L+   
Sbjct: 452 LVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLD-- 509

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCR-RIEPDEMCTTRCGSEDYVSPEILMGVPYDG 421
                           Q  + L DFGLC+  ++ +E  +T CG+ +Y++PE+L+G  Y  
Sbjct: 510 ---------------SQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGY-T 553

Query: 422 RLSDSWAMGVILYALLEDRLPF 443
           ++ D W +GV+LY +L    P+
Sbjct: 554 KVVDWWTLGVLLYEMLTGLPPY 575

>YFR014C (CMK1) [1695] chr6 complement(172529..173869)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type I [1341 bp, 446 aa]
          Length = 446

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/171 (32%), Positives = 84/171 (49%), Gaps = 21/171 (12%)

Query: 273 IHLHAIND----LTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWL 327
           + L A+ D    L  L+ P  ++ +D         +I     GG+LF+ +  +    E  
Sbjct: 78  VQLEALYDELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEED 137

Query: 328 LRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADF 387
             RI  E+   VKY+H   IVHRDLK EN+L    +D             D+  + +ADF
Sbjct: 138 AVRILVEILSAVKYMHSQNIVHRDLKPENLLY---IDKS-----------DESPLVVADF 183

Query: 388 GLCRRIEPDEMCTTR-CGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALL 437
           G+ +R++ DE    +  GS  YV+PE+L    + G+  D W++GVI Y LL
Sbjct: 184 GIAKRLKSDEELLYKPAGSLGYVAPEVLTQDGH-GKPCDIWSIGVITYTLL 233

>Kwal_47.18307
          Length = 621

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 82/175 (46%), Gaps = 33/175 (18%)

Query: 304 MIMSYCAGGDLFELASQ-NTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
            ++ Y +GG+L  L  +   L E L R I A+L   V Y+H   ++HRDLK ENVL+   
Sbjct: 89  FVLEYVSGGELLALIQRLGRLTEDLSRHITAQLVDTVDYMHSKGVIHRDLKPENVLLS-- 146

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLC-----RRIEPDEMCTTRCGSEDYVSPEILMGV 417
                   E R        V + DFG       R+ E  +   +  G+ +YVSPE+L+  
Sbjct: 147 -------QEGR--------VVITDFGAACTAADRKFENTKRTASFVGTAEYVSPELLLHS 191

Query: 418 PYDGRLSDSWAMGVILYALLEDRLPFDPLPTAAPGKRQRRSSTAHRISRFEWRWI 472
              G  SD WA+G I+Y L + + PF         + +    T  +I   +++W+
Sbjct: 192 QC-GFSSDIWALGCIIYQLNQGKPPF---------RGENELQTFEKIVALDYKWL 236

>AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W
           (RCK1) - SH] complement(289989..291593) [1605 bp, 534
           aa]
          Length = 534

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 78/159 (49%), Gaps = 22/159 (13%)

Query: 304 MIMSYCAGGDLF-ELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           ++    AGG++F E+       E L R +  +L L VK++H   IVHRD+K EN+L   P
Sbjct: 195 IVQELLAGGEIFGEIVRLTYFSEDLSRHVIRQLALAVKHMHSLGIVHRDIKPENLLFS-P 253

Query: 363 LDDILAMHEQRELLLD------------------QHIVELADFGLCRRIEPDEMCTTRCG 404
           +D I +  +Q     D                    +++LADFGL ++I      TT CG
Sbjct: 254 IDFIPSKRQQLRQSDDPKTKQDEGLFRPGIGGGGIGVIKLADFGLSKQIYATN-TTTPCG 312

Query: 405 SEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPF 443
           +  Y +PE++    Y  ++ D W +G +LY +L    PF
Sbjct: 313 TVGYTAPEVVKDERYSMKV-DMWGIGCVLYTVLCGFPPF 350

>KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent ser/thr
           protein kinase, start by similarity
          Length = 546

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/159 (32%), Positives = 79/159 (49%), Gaps = 22/159 (13%)

Query: 304 MIMSYCAGGDLF-ELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           +I    AGG++F E+       E L R +  +L   VKY+H+  IVHRD+K EN+L + P
Sbjct: 220 IIQELLAGGEIFGEIVKYTYFSEDLSRHVIRQLANAVKYMHQLGIVHRDIKPENLLFE-P 278

Query: 363 LDDI------LAMHEQRELLLDQ------------HIVELADFGLCRRIEPDEMCTTRCG 404
           +D I      L   +     LD+             +V+LADFGL ++I       T CG
Sbjct: 279 IDFIPNPKPKLRSSDDPSTKLDEGVFRPGIGGGGIGVVKLADFGLSKQIYQTN-TKTPCG 337

Query: 405 SEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPF 443
           +  Y +PE++    Y  ++ D W +G +LY +L    PF
Sbjct: 338 TVGYTAPEVVKDERYSMQV-DMWGVGCVLYTVLCGFPPF 375

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 73/142 (51%), Gaps = 20/142 (14%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPL 363
           +IM YCAGG L  L     + E  +  I  EL + +K +H++ ++HRD+K  NVLI    
Sbjct: 90  IIMEYCAGGSLRSLLRPGKIDEKYIGVIMRELLVALKVIHKDNVIHRDIKAANVLI---- 145

Query: 364 DDILAMHEQRELLLDQHIVELADFGLCRRIEPDEM-CTTRCGSEDYVSPEILM-GVPYDG 421
                         ++  V+L DFG+  ++    +   T  G+  +++PE++M GV YD 
Sbjct: 146 -------------TNEGQVKLCDFGVAAQLNQTSLRRQTMAGTPYWMAPEVIMEGVYYDT 192

Query: 422 RLSDSWAMGVILYALLEDRLPF 443
           ++ D W++G+  Y +     P+
Sbjct: 193 KV-DIWSLGITAYEIATGNPPY 213

>Scas_201.1*
          Length = 274

 Score = 70.9 bits (172), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 79/162 (48%), Gaps = 17/162 (10%)

Query: 284 LNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGVKYL 342
           L+ P  ++ +D         ++     GG+LF+ +  +    E     I  +L   VKY+
Sbjct: 91  LHHPNIVAFKDWFESRDKFYIVTQLATGGELFDRIIKKGKFTEVDAVNIMVQLLDAVKYI 150

Query: 343 HENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEP-DEMCTT 401
           H   IVHRDLK ENVL   P D       + +L+       +ADFG+ + ++  D++   
Sbjct: 151 HSQNIVHRDLKPENVLYLDPSD-------ESQLV-------IADFGIAKELKSNDDLIFK 196

Query: 402 RCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPF 443
             GS  YV+PE+L    + G+  D W++GVI Y LL    PF
Sbjct: 197 GAGSLGYVAPEVLTKEGH-GKPCDIWSLGVITYTLLSGYSPF 237

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 74/146 (50%), Gaps = 21/146 (14%)

Query: 301 PCDM--IMSYCAGGDLF-ELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENV 357
           P D+  +  + +GG+LF  L  +    E   +   AEL L ++YLH+N IV+RDLK EN+
Sbjct: 398 PTDLYLVTDFMSGGELFWHLQKEGRFTEDRAKFYIAELVLALEYLHDNDIVYRDLKPENI 457

Query: 358 LIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGV 417
           L+    +                 + L DFGL +    D    T CG+ +Y++PE+LM  
Sbjct: 458 LLDANGN-----------------IALCDFGLSKADLKDR-TNTFCGTTEYLAPELLMDE 499

Query: 418 PYDGRLSDSWAMGVILYALLEDRLPF 443
               ++ D W++GV+++ +     PF
Sbjct: 500 TGYTKMVDFWSLGVLIFEMCCGWSPF 525

>KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, start by similarity
          Length = 427

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/209 (28%), Positives = 97/209 (46%), Gaps = 22/209 (10%)

Query: 284 LNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGVKYL 342
           LN P  +  +D         ++     GG+LF+ +  +    E     I  ++  GV+YL
Sbjct: 102 LNHPNIVRFKDWFESKEKFYIVTQLATGGELFDRILEKGKFCEVDAVFIVKQILQGVQYL 161

Query: 343 HENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPD-EMCTT 401
           H+  IVHRDLK EN+L     DD                + + DFG+ + ++ D E+   
Sbjct: 162 HQRNIVHRDLKPENILYLNKSDD--------------SPLVIGDFGIAKELKDDNELIHK 207

Query: 402 RCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPFDPLPTAAPGKRQRRSSTA 461
             GS  YV+PE+L    + G+  D W++GVI Y LL    PF  L  +A G  +  +S  
Sbjct: 208 AAGSMGYVAPEVLTSSGH-GKPCDIWSIGVITYTLLCGYSPF--LAESADGFIEECTSGQ 264

Query: 462 HRISRFEWRWIKMAESEYPAKEIVENCLT 490
           + +   +  W  ++++   AKE +   LT
Sbjct: 265 YPVVFHKPYWNNVSKT---AKEFILWALT 290

>Scas_707.34
          Length = 905

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/277 (25%), Positives = 115/277 (41%), Gaps = 52/277 (18%)

Query: 198 RQIGVGNFSDVYLYESVNQTATHLQKVAV--KHVKYPEALVQSSSPKXXXXXXXXXXXXX 255
           ++IG G+F+ V+    +  T+ HL +  V    +  P        P+             
Sbjct: 42  KEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKIVPRSKLKNKKLLENLE 101

Query: 256 XXXXXXXALSGIWHPCIIHLHAINDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDL- 314
                   L  I HP I+ L                  D  R      +IM YC+ GDL 
Sbjct: 102 IEIA---ILKKISHPHIVKL-----------------IDFERTSKDFYLIMEYCSLGDLT 141

Query: 315 FELASQNTLPEW--LLRRIFA----------------------ELTLGVKYLHENLIVHR 350
           F +  +  L +   LL +IF                       +L+  +K+L    +VHR
Sbjct: 142 FLIKKRQQLIKNHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKNLVHR 201

Query: 351 DLKLENVLIKFPL---DDILAMHEQREL-LLDQHIVELADFGLCRRIEPDEMCTTRCGSE 406
           D+K +N+L+  PL   +D  + H+   + + +  I+++ADFG  R +    M  T CGS 
Sbjct: 202 DIKPQNLLLSAPLINYNDPKSFHDLGFVGIYNLPILKIADFGFARFLPNTSMAETLCGSP 261

Query: 407 DYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPF 443
            Y++PEIL    Y+ + +D W++G +LY +     PF
Sbjct: 262 LYMAPEILNYQKYNAK-ADLWSVGTVLYEMCYGNPPF 297

>YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine protein
           kinase involved in sensitivity to salt [1812 bp, 603 aa]
          Length = 603

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 68/142 (47%), Gaps = 23/142 (16%)

Query: 305 IMSYCAGGDLFELASQNTLPEWL-LRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPL 363
           +M YCAGGDLF L       E++     F +L  GV Y+HE  + HRDLK EN+      
Sbjct: 402 VMEYCAGGDLFTLVVAAGKLEYMEADCFFKQLIRGVVYMHEMGVCHRDLKPENL------ 455

Query: 364 DDILAMHEQRELLLDQHIVELADFG--LCRRIEPDE---MCTTRCGSEDYVSPEILMGVP 418
                      LL    ++++ DFG   C ++  ++   +    CGS  Y++PE  +   
Sbjct: 456 -----------LLTHDGVLKITDFGNSECFKMAWEKNIHLSGGVCGSSPYIAPEEYIKEE 504

Query: 419 YDGRLSDSWAMGVILYALLEDR 440
           +D R  D WA GVI  A+   R
Sbjct: 505 FDPRPVDIWACGVIYMAMRTGR 526

>KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces
           cerevisiae YGL180w APG1 essential for autophagocytosis,
           start by similarity
          Length = 831

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (46%), Gaps = 37/182 (20%)

Query: 298 GLPPCD-------MIMSYCAGGDL--------------------FE-----LASQNTLPE 325
           GL  C+       +IM YCA GDL                    FE         N L  
Sbjct: 83  GLIDCERTSSDFYLIMEYCALGDLTFFIKKRKNLVLKHPLIKTVFEHYPPPSTEHNGLNR 142

Query: 326 WLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPL---DDILAMHEQREL-LLDQHI 381
            L+     +L+  +K+L    +VHRD+K +N+L+  PL   +D    HE   + + +  I
Sbjct: 143 VLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLCTPLLDYNDPKTFHELGFVGIYNLPI 202

Query: 382 VELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRL 441
           +++ADFG  R +    +  T CGS  Y++PEIL    Y+ + +D W++G +LY +   R 
Sbjct: 203 LKIADFGFARFLPNTSLAETLCGSPLYMAPEILNYQKYNAK-ADLWSVGTVLYEMCCGRP 261

Query: 442 PF 443
           PF
Sbjct: 262 PF 263

>ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH]
           complement(344395..346521) [2127 bp, 708 aa]
          Length = 708

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 71/144 (49%), Gaps = 22/144 (15%)

Query: 304 MIMSYCAGGDLFELASQ-NTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           +++  C  G L +L  Q   L E  +R    ++   +KY+H   I+HRDLKL N+     
Sbjct: 147 ILLEICPNGSLMDLLKQRKQLTEPEVRFFTTQIVGAIKYMHSRRIIHRDLKLGNI----- 201

Query: 363 LDDILAMHEQRELLLDQHI-VELADFGLCRRIEPD-EMCTTRCGSEDYVSPEILMGVPYD 420
                          D+H  +++ DFGL   +  D E   T CG+ +Y++PE+L G    
Sbjct: 202 -------------FFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIAPEVLTGKHTG 248

Query: 421 GRLS-DSWAMGVILYALLEDRLPF 443
                D W++GV++YALL  + PF
Sbjct: 249 HSFEVDIWSIGVMIYALLIGKPPF 272

>Scas_703.5
          Length = 749

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 74/146 (50%), Gaps = 21/146 (14%)

Query: 301 PCDM--IMSYCAGGDLF-ELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENV 357
           P D+  +  + +GG+LF  L  +    E   +   AEL L ++YLH+N IV+RDLK EN+
Sbjct: 417 PTDLYLVTDFMSGGELFWHLQKEGRFTEERAKFYIAELVLALEYLHDNDIVYRDLKPENI 476

Query: 358 LIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGV 417
           L+    +                 + L DFGL +    D    T CG+ +Y++PE+L+  
Sbjct: 477 LLDANGN-----------------IALCDFGLSKADLKDR-TNTFCGTTEYLAPELLLDE 518

Query: 418 PYDGRLSDSWAMGVILYALLEDRLPF 443
               ++ D W++GV+++ +     PF
Sbjct: 519 AGYTKMVDFWSLGVLIFEMCCGWSPF 544

>CAGL0K01661g complement(146952..148400) some similarities with
           tr|Q12100 Saccharomyces cerevisiae YDL025c, hypothetical
           start
          Length = 482

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/145 (33%), Positives = 70/145 (48%), Gaps = 23/145 (15%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPL 363
           M+M Y A  D F+L   NT+    +   F +L  GV YLH   I HRDLKL+N ++    
Sbjct: 257 MVMEY-APYDFFDLVMTNTMSPDEISCYFKQLCHGVNYLHAMGIAHRDLKLDNCVVT--- 312

Query: 364 DDILAMHEQRELLLDQHIVELADFGLCRRIE-PDE----MCTTRCGSEDYVSPEILMGVP 418
                         +  I++L DFG     + P E      T   GS+ Y+SPE+L    
Sbjct: 313 --------------NDGILKLIDFGSAVIFQYPYERNIVKATGIVGSDPYLSPELLEMNH 358

Query: 419 YDGRLSDSWAMGVILYALLEDRLPF 443
           YD RL+D W++ +I Y +   R P+
Sbjct: 359 YDPRLADVWSLAIIYYCMTLKRFPW 383

>Scas_593.14d
          Length = 495

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 70/270 (25%), Positives = 116/270 (42%), Gaps = 60/270 (22%)

Query: 194 WRKVRQIGVGNFSDVYLYESVNQTATHLQKVAVKHVKYPEALVQSSSPKXXXXXXXXXXX 253
           +R VR +G G +  V L   V    T+ +  A+K +K  E L+  S              
Sbjct: 136 FRPVRVLGQGAYGKVIL---VKDKLTN-KLYAMKQLKKAEILITESPKSNEEDDVNLGKR 191

Query: 254 XXXXXXXXXALSGIWHPCIIHL-HAINDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGG 312
                     L+ + HP I+ L ++ +D + L                   +++ Y  GG
Sbjct: 192 IERTFAEKSILAELEHPNIVKLFYSFHDNSKLY------------------LLLQYIPGG 233

Query: 313 DLF-ELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHE 371
           +LF  L  Q TL E  +    AE++  +K+LH+  IV+RDLK EN L+            
Sbjct: 234 ELFFHLKEQGTLDEDTVAFYAAEISCALKFLHDKGIVYRDLKPENCLLN----------- 282

Query: 372 QRELLLDQHIVELADFGLCRRI---------------EPDEMCTTR---CGSEDYVSPEI 413
                 D+  + L DFGL ++                EP E  +T     G+ +Y +PEI
Sbjct: 283 ------DKGHLVLTDFGLSKKSVTQNSANPSEVTSLNEPSEDLSTLHSIIGTPEYCAPEI 336

Query: 414 LMGVPYDGRLSDSWAMGVILYALLEDRLPF 443
           L G+PY+ +  D +++G ++Y +L  + P+
Sbjct: 337 LQGLPYN-KNCDWYSLGCLIYDMLSGKPPY 365

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 74/146 (50%), Gaps = 21/146 (14%)

Query: 301 PCDM--IMSYCAGGDLF-ELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENV 357
           P D+  +  + +GG+LF  L  +    E   +   AEL L ++YLH+N IV+RDLK EN+
Sbjct: 377 PTDLYLVTDFLSGGELFWHLQKEGRFTEERAKFYIAELVLALEYLHDNDIVYRDLKPENI 436

Query: 358 LIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGV 417
           L+    +                 + L DFGL +    D    T CG+ +Y++PE+L+  
Sbjct: 437 LLDANGN-----------------IALCDFGLSKADLKDR-TNTFCGTTEYLAPELLLDE 478

Query: 418 PYDGRLSDSWAMGVILYALLEDRLPF 443
               ++ D W++GV+++ +     PF
Sbjct: 479 TGYTKMVDFWSLGVLIFEMCCGWSPF 504

>Scas_628.9
          Length = 621

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/146 (33%), Positives = 69/146 (47%), Gaps = 23/146 (15%)

Query: 305 IMSYCAGGDLFEL-ASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPL 363
           +M YC+GGDLF L  S   L        F +L  GV Y+H+  + HRDLK EN+L     
Sbjct: 417 VMEYCSGGDLFSLIVSAGKLEYAEADCFFKQLMRGVVYMHDMGVSHRDLKPENLL----- 471

Query: 364 DDILAMHEQRELLLDQHIVELADFG--LCRRI--EPD-EMCTTRCGSEDYVSPEILMGVP 418
                       L    ++++ DFG   C ++  E D  +    CGS  Y++PE  +   
Sbjct: 472 ------------LTSDGVLKITDFGNSECFKMAWEDDIHLSGGVCGSSPYIAPEEYIKEE 519

Query: 419 YDGRLSDSWAMGVILYALLEDRLPFD 444
           +D R  D WA GVI  A+   R  +D
Sbjct: 520 FDPRCVDIWACGVIYMAMRTGRQLWD 545

>ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C
           (YPK2) - SH] complement(345955..348123) [2169 bp, 722
           aa]
          Length = 722

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 74/142 (52%), Gaps = 20/142 (14%)

Query: 304 MIMSYCAGGDLF-ELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           +++++  GG+LF  L  +        R   AEL   ++ LH   +++RDLK EN+L+ + 
Sbjct: 464 LVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDY- 522

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCR-RIEPDEMCTTRCGSEDYVSPEILMGVPYDG 421
                           Q  + L DFGLC+  ++  +   T CG+ +Y++PE+L+G  Y  
Sbjct: 523 ----------------QGHIALCDFGLCKLNMKDQDKTNTFCGTPEYLAPELLLGQGY-S 565

Query: 422 RLSDSWAMGVILYALLEDRLPF 443
           ++ D W +GV+LY +L    P+
Sbjct: 566 KVVDWWTLGVLLYEMLTGLPPY 587

>Scas_644.15
          Length = 726

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 74/143 (51%), Gaps = 20/143 (13%)

Query: 304 MIMSYCAGGDLFELASQ-NTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           +++  C+ G L +L  +  TL E  +R    ++   VKY+H   ++HRDLKL N+   F 
Sbjct: 166 ILLEICSNGSLMDLMKKRKTLTEPEVRFFTTQICGAVKYMHSRRVIHRDLKLGNIF--FD 223

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPD-EMCTTRCGSEDYVSPEILMGVPYDG 421
            D               + +++ DFGL   +  + E   T CG+ +Y++PE+LMG     
Sbjct: 224 KD---------------YNLKVGDFGLAAVLANNRERKYTVCGTPNYIAPEVLMGKHAGH 268

Query: 422 RLS-DSWAMGVILYALLEDRLPF 443
               D W++GV++YALL  + PF
Sbjct: 269 SFEVDIWSIGVMIYALLVGKPPF 291

>Sklu_2430.5 YKL126W, Contig c2430 8144-10345
          Length = 733

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 74/142 (52%), Gaps = 20/142 (14%)

Query: 304 MIMSYCAGGDLF-ELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           +++++  GG+LF  L  +        R   AEL   ++ LH   +++RDLK EN+L+ + 
Sbjct: 475 LVLAFINGGELFYHLQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDY- 533

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCR-RIEPDEMCTTRCGSEDYVSPEILMGVPYDG 421
                           Q  + L DFGLC+  ++  +   T CG+ +Y++PE+L+G  Y  
Sbjct: 534 ----------------QGHIALCDFGLCKLNMQDQDKTNTFCGTPEYLAPELLLGQGY-S 576

Query: 422 RLSDSWAMGVILYALLEDRLPF 443
           ++ D W +GV+LY +L    P+
Sbjct: 577 KVVDWWTLGVLLYEMLTGLPPY 598

>Scas_618.15
          Length = 620

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 61/227 (26%), Positives = 106/227 (46%), Gaps = 34/227 (14%)

Query: 304 MIMSYCAGGDLFELASQNT-LPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           ++  Y  GG++++   + T   E L R +  +L   VK+LH   I+HRD+K EN+L + P
Sbjct: 254 IVQEYLHGGEIYDQIVRLTYFSEDLTRHVIRQLAHAVKHLHSMGIIHRDIKPENLLFE-P 312

Query: 363 LDDILAMHEQRE------LLLDQHI------------VELADFGLCRRIEPDEMCTTRCG 404
           +  I + H +          +D+ +            V+L DFGL +++   E   T CG
Sbjct: 313 IQHIPSTHVKLRKTDNPFTKVDEGMFRPAIGGGGIGAVKLTDFGLSKQLST-ETTNTPCG 371

Query: 405 SEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPFDPLPTAAPGKRQRRSSTAHRI 464
           +  Y +PE++    YD ++ D W +G +LY LL    PF            +  S   +I
Sbjct: 372 TISYAAPELIRNHQYDNKI-DLWGIGCVLYTLLCGFPPF---------YADQHKSVTRKI 421

Query: 465 SRFEWRWIK--MAESEYPAKEIVENCL-TRKNIRCNIEKIYENPYVN 508
              E+ ++     E    AK  V++ L    + R NI+ +  +P++N
Sbjct: 422 RHGEYHFLSPWWDEISSGAKNCVKHLLEVDVSKRYNIDDLLADPWLN 468

>CAGL0M09361g complement(928484..931918) highly similar to sp|P24583
            Saccharomyces cerevisiae YBL105c PKC1 ser/thr protein
            kinase, start by similarity
          Length = 1144

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 72/139 (51%), Gaps = 19/139 (13%)

Query: 306  MSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDD 365
            M +  GGDL        L     +   AE+ L +K+ H+N +++RDLKLEN+L       
Sbjct: 897  MEFIGGGDLMWHVQNQRLSVRRAKFYAAEVLLALKFFHDNGVIYRDLKLENIL------- 949

Query: 366  ILAMHEQRELLLDQHIVELADFGLCRR-IEPDEMCTTRCGSEDYVSPEILMGVPYDGRLS 424
                     L  + HI ++AD+GLC+  +      +T CG+ ++++PE+L    Y  +  
Sbjct: 950  ---------LTPEGHI-KIADYGLCKDGMWYGNKTSTFCGTPEFMAPELLREQDY-TKAV 998

Query: 425  DSWAMGVILYALLEDRLPF 443
            D WA GV+LY +L  + PF
Sbjct: 999  DWWAFGVLLYQMLLCQSPF 1017

>YOL045W (PSK2) [4773] chr15 (243495..246800) Serine/threonine protein
            kinase of unknown function [3306 bp, 1101 aa]
          Length = 1101

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 97/201 (48%), Gaps = 43/201 (21%)

Query: 313  DLFELAS-QNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHE 371
            DLF++   +  + E   + +F ++   +K+LH+  IVHRD+K ENV++            
Sbjct: 936  DLFDVIEFKKDMVEHEAKLVFKQVVASIKHLHDQGIVHRDIKDENVIV------------ 983

Query: 372  QRELLLDQH-IVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMG 430
                  D H  V+L DFG    I+         G+ DY +PE+L G  Y G+  D WA+G
Sbjct: 984  ------DSHGFVKLIDFGSAAYIKSGPF-DVFVGTMDYAAPEVLGGSSYKGKPQDIWALG 1036

Query: 431  VILYALLEDRLPFDPLPTAAPGKRQRRSSTAHRISRFEWRWIKMAESEYPAKE---IVEN 487
            V+LY ++    P+  +     G+                  ++  +SE+ ++E   +++ 
Sbjct: 1037 VLLYTIIYKENPYYNIDEILEGE------------------LRFDKSEHVSEECISLIKR 1078

Query: 488  CLTRK-NIRCNIEKIYENPYV 507
             LTR+ + R  I++IYE+ ++
Sbjct: 1079 ILTREVDKRPTIDEIYEDKWL 1099

>ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH]
           (1222346..1225018) [2673 bp, 890 aa]
          Length = 890

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 74/152 (48%), Gaps = 32/152 (21%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWL--LRRIFAELTLGVKYLHENLIVHRDLKLENVLIKF 361
           +IM YC+GGDL+E    +T+P     L  I +++   V+++H   I HRD+K EN+LI  
Sbjct: 131 IIMEYCSGGDLYEAIKADTIPRKTRQLTHIISQILDAVEFVHSKGIYHRDIKPENILI-- 188

Query: 362 PLDDILAMHEQRELLLDQH-IVELADFGLCRRIEPDEMCTTR-CGSEDYVSPEIL----- 414
                           D +  V+L D+GL      D+    R  GSE Y++PE+      
Sbjct: 189 ---------------ADSNWTVKLTDWGLA---TTDQTSMDRNVGSERYMAPELFESNLD 230

Query: 415 ---MGVPYDGRLSDSWAMGVILYALLEDRLPF 443
                 PY+    D WA+G++L  ++  + PF
Sbjct: 231 YDERNEPYECSKVDIWAIGIVLLNIVFHKNPF 262

>Scas_653.25
          Length = 666

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 74/154 (48%), Gaps = 35/154 (22%)

Query: 305 IMSYCAGGDLFELASQNTLPEWLLRR----IFAELTLGVKYLHENLIVHRDLKLENVLIK 360
           IM +C   D F +    T    L RR     F +L  GV+YLH   I HRDLKL+N +I 
Sbjct: 348 IMEWCPH-DFFNIVMSRT--HLLTRRETFCYFKQLCNGVRYLHTLGIAHRDLKLDNCVIT 404

Query: 361 FPLDDILAMHEQRELLLDQHIVELADFGLCRRI-------EPDEMCTTR--CGSEDYVSP 411
           +                   I++L DFG            E  E+  +R   GS+ Y++P
Sbjct: 405 Y-----------------NGILKLIDFGSATIFQLNKSTEEKPELIPSRGIVGSDPYLAP 447

Query: 412 EILMG--VPYDGRLSDSWAMGVILYALLEDRLPF 443
           E+L+   +PYD  L+D W++G+I  A++  R P+
Sbjct: 448 EVLLSKEIPYDASLADVWSLGIIFCAIMLKRFPW 481

>Scas_721.124
          Length = 684

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 74/142 (52%), Gaps = 20/142 (14%)

Query: 304 MIMSYCAGGDLF-ELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           ++++   GG+LF  L  +        R   AEL   ++ LH   +++RDLK EN+L+ + 
Sbjct: 426 LVLACINGGELFYHLQKEGRFDLSRSRFYAAELLCALETLHNLNVIYRDLKPENILLDY- 484

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCR-RIEPDEMCTTRCGSEDYVSPEILMGVPYDG 421
                           Q  + L DFGLC+  ++ D+   T CG+ +Y++PE+L+G  Y  
Sbjct: 485 ----------------QGHIALCDFGLCKLNMKDDDKTDTFCGTPEYLAPELLLGQGY-T 527

Query: 422 RLSDSWAMGVILYALLEDRLPF 443
           ++ D W +GV+LY +L    P+
Sbjct: 528 KVVDWWTLGVLLYEMLTGLPPY 549

>YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway that is probably
           parallel to cAMP pathway, affects life span [2475 bp,
           824 aa]
          Length = 824

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 72/141 (51%), Gaps = 19/141 (13%)

Query: 304 MIMSYCAGGDLF-ELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           ++  Y +GG+LF  L  +    E   +   AEL L +++LH+N IV+RDLK EN+L+   
Sbjct: 490 LVTDYMSGGELFWHLQKEGRFSEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILLDAN 549

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
            +                 + L DFGL +    D    T CG+ +Y++PE+L+      +
Sbjct: 550 GN-----------------IALCDFGLSKADLKDR-TNTFCGTTEYLAPELLLDETGYTK 591

Query: 423 LSDSWAMGVILYALLEDRLPF 443
           + D W++GV+++ +     PF
Sbjct: 592 MVDFWSLGVLIFEMCCGWSPF 612

>Kwal_55.20189
          Length = 812

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 76/150 (50%), Gaps = 28/150 (18%)

Query: 304 MIMSYCAGGDLFELASQNTLPEW--LLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKF 361
           ++M YC+GGDL+E    + +P+   ++  I +++   ++++H+  I HRDLK EN+LI+ 
Sbjct: 131 IVMEYCSGGDLYEAIKADLIPKRTKVITHIASQIMEAIEFVHQKGIYHRDLKPENILIEG 190

Query: 362 PLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEIL------- 414
                               ++L D+GL    EP  +  +  GSE Y++PE+        
Sbjct: 191 ----------------SDWTIKLTDWGLA-TTEPTSLDRS-VGSERYMAPELFEENLDRD 232

Query: 415 -MGVPYDGRLSDSWAMGVILYALLEDRLPF 443
               PYD    D WA+G++L  ++  + PF
Sbjct: 233 ERSEPYDCSKVDLWAIGIVLLNIVFQKNPF 262

>YLR248W (RCK2) [3644] chr12 (634254..636086)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) [1833 bp, 610 aa]
          Length = 610

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 107/226 (47%), Gaps = 32/226 (14%)

Query: 304 MIMSYCAGGDLF-ELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVL---I 359
           +I     GG++F E+       E L R +  +L L VK++H   +VHRD+K EN+L   I
Sbjct: 265 IIQELLTGGEIFGEIVRLTYFSEDLSRHVIKQLALAVKHMHSLGVVHRDIKPENLLFEPI 324

Query: 360 KF--PLDDILAMHEQRELLLDQHIV------------ELADFGLCRRIEPDEMCTTRCGS 405
           +F   +   L   +  +   D+ I             +LADFGL ++I   +   T CG+
Sbjct: 325 EFTRSIKPKLRKSDDPQTKADEGIFTPGVGGGGIGIVKLADFGLSKQIFS-KNTKTPCGT 383

Query: 406 EDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPFDPLPTAAPGKRQRRSSTAHRIS 465
             Y +PE++    Y  ++ D W +G +LY +L    PF           ++  +   +IS
Sbjct: 384 VGYTAPEVVKDEHYSMKV-DMWGIGCVLYTMLCGFPPF---------YDEKIDTLTEKIS 433

Query: 466 RFEWRWIK--MAESEYPAKEIVENCLTRK-NIRCNIEKIYENPYVN 508
           R E+ ++K    E    AK  V   L  + + R +I++  ++P++N
Sbjct: 434 RGEYTFLKPWWDEISAGAKNAVAKLLELEPSKRYDIDQFLDDPWLN 479

>YMR104C (YPK2) [4061] chr13 complement(473419..475452)
           Serine/threonine protein kinase with similarity to
           Ypk1p, involved in the cell integrity signaling pathway
           [2034 bp, 677 aa]
          Length = 677

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 74/142 (52%), Gaps = 20/142 (14%)

Query: 304 MIMSYCAGGDLF-ELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           +++++  GG+LF  L  +        R   AEL   +  LH+  +++RDLK EN+L+ + 
Sbjct: 419 LVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDY- 477

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCR-RIEPDEMCTTRCGSEDYVSPEILMGVPYDG 421
                           Q  + L DFGLC+  ++ ++   T CG+ +Y++PEIL+G  Y  
Sbjct: 478 ----------------QGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYT- 520

Query: 422 RLSDSWAMGVILYALLEDRLPF 443
           +  D W +G++LY ++    P+
Sbjct: 521 KTVDWWTLGILLYEMMTGLPPY 542

>YHR082C (KSP1) [2372] chr8 complement(268460..271549)
           Serine/threonine kinase that suppresses prp20 mutant
           when oveproduced [3090 bp, 1029 aa]
          Length = 1029

 Score = 71.2 bits (173), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 72/151 (47%), Gaps = 30/151 (19%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWL--LRRIFAELTLGVKYLHENLIVHRDLKLENVLIKF 361
           +IM YC+GGDL+E    + +P+    +  I  ++   ++Y+H   I HRD+K EN+LI  
Sbjct: 158 IIMEYCSGGDLYEAIKADAVPKKTKSITHIITQIMDAIEYVHNKGIYHRDIKPENILIS- 216

Query: 362 PLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTR-CGSEDYVSPEIL------ 414
            +D                 ++L D+GL      D+    R  GSE Y+SPE+       
Sbjct: 217 GID---------------WTIKLTDWGLA---TTDKTSMDRNVGSERYMSPELFDSNLDI 258

Query: 415 --MGVPYDGRLSDSWAMGVILYALLEDRLPF 443
                PYD    D WAMG++   ++  + PF
Sbjct: 259 KERKEPYDCAKVDLWAMGIVFLNIVFHKNPF 289

>Scas_643.20
          Length = 1082

 Score = 71.2 bits (173), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 68/132 (51%), Gaps = 19/132 (14%)

Query: 313  DLFELAS-QNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHE 371
            DLF+L   +  + E+  + IF ++  G+K+LH+  IVHRD+K ENV++            
Sbjct: 917  DLFDLIELKKNMTEYEEKLIFKQVVSGLKHLHDQGIVHRDIKDENVIVD----------- 965

Query: 372  QRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGV 431
                   +  V+L D+G     +         G+ DY +PE+L G  YDG+  D WA+G+
Sbjct: 966  ------SKGHVKLIDYGSAAYTKSGPF-DVFVGTIDYAAPEVLGGSVYDGKPQDIWAIGI 1018

Query: 432  ILYALLEDRLPF 443
            +LY ++    PF
Sbjct: 1019 LLYTIIFKENPF 1030

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score = 71.2 bits (173), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 73/142 (51%), Gaps = 20/142 (14%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPL 363
           +IM +CAGG L  L     + E  +  I  EL + +K +H++ ++HRD+K  NVLI    
Sbjct: 97  IIMEHCAGGSLRSLLRPGKIDEKYIGVIMRELLVALKCIHKDNVIHRDIKAANVLI---- 152

Query: 364 DDILAMHEQRELLLDQHIVELADFGLCRRIEPDEM-CTTRCGSEDYVSPEILM-GVPYDG 421
                         ++  V+L DFG+  ++    +   T  G+  +++PE++M GV YD 
Sbjct: 153 -------------TNEGNVKLCDFGVAAQVNQTSLRRQTMAGTPYWMAPEVIMEGVYYDT 199

Query: 422 RLSDSWAMGVILYALLEDRLPF 443
           ++ D W++G+  Y +     P+
Sbjct: 200 KV-DIWSLGITTYEIATGNPPY 220

>Sklu_2429.5 YOL016C, Contig c2429 9000-10298 reverse complement
          Length = 432

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 78/165 (47%), Gaps = 17/165 (10%)

Query: 281 LTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGV 339
           L  LN P  +  +D         ++     GG+LF+ +  +    E    +I  ++   V
Sbjct: 99  LQKLNHPNIVKFKDWFESKEKFYIVTQLATGGELFDRILQKGKFTEVDAVKIVVQILKAV 158

Query: 340 KYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPD-EM 398
           +YLH   IVHRDLK EN+L        L   +  +L+       L DFG+ + ++ D ++
Sbjct: 159 EYLHSRNIVHRDLKPENLL-------YLDKSDNSQLV-------LGDFGIAKELKNDGDL 204

Query: 399 CTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPF 443
                GS  YV+PE+L    + G+  D W++GVI Y LL    PF
Sbjct: 205 IHKAAGSMGYVAPEVLTSNGH-GKPCDIWSIGVITYTLLCGYSPF 248

>Kwal_27.9763
          Length = 868

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 76/148 (51%), Gaps = 22/148 (14%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPL 363
           +++ YC+ G L +L  +  + E   +    +   G+KYLH+  ++HRD+K  N       
Sbjct: 95  ILLEYCSQGSLRDLIKRGPVEEQQCKTYIRQTLHGLKYLHDQGVIHRDIKAAN------- 147

Query: 364 DDILAMHEQRELLLD-QHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
                      LLLD Q++V+LADFG+  R+  + +  T  GS ++++PE++MG      
Sbjct: 148 -----------LLLDAQNVVKLADFGVSTRV--NNLAMTYAGSPNWMAPEVMMG-QGAST 193

Query: 423 LSDSWAMGVILYALLEDRLPFDPLPTAA 450
           +SD W++G  +  +L    PF  L   A
Sbjct: 194 VSDIWSLGATVVEILTGNPPFHNLVNEA 221

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 74/146 (50%), Gaps = 21/146 (14%)

Query: 301 PCDM--IMSYCAGGDLF-ELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENV 357
           P D+  +  Y +GG+LF  L  +    E   +   AEL L +++LH+N IV+RDLK EN+
Sbjct: 413 PTDLYLVTDYMSGGELFWHLQREGRFTEDRAKFYIAELVLALEHLHDNDIVYRDLKPENI 472

Query: 358 LIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGV 417
           L+    +                 + L DFGL +    D    T CG+ +Y++PE+L+  
Sbjct: 473 LLDANGN-----------------IALCDFGLSKADLKDR-TNTFCGTTEYLAPELLLDE 514

Query: 418 PYDGRLSDSWAMGVILYALLEDRLPF 443
               ++ D W++GV+++ +     PF
Sbjct: 515 SGYTKMVDFWSLGVLIFEMCCGWSPF 540

>Sklu_2118.2 YAR018C, Contig c2118 1397-2677
          Length = 426

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 81/167 (48%), Gaps = 30/167 (17%)

Query: 304 MIMSYCAGGDLFEL-----ASQNTLPEWLLRRIFAELTLGVKYLH--------------- 343
           + M YC+ GDL ++       +  +PE ++ RI A++ + +   H               
Sbjct: 112 LYMEYCSHGDLSQMIKHYKQQKKYIPESIVWRIMAQILMALYRCHYGTDIPPLESVYDRC 171

Query: 344 ------ENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPD- 396
                 + +++HRDLK  NV +   ++D  +    R +   + +V+L DFGL + +    
Sbjct: 172 KPPHKGKTVVIHRDLKPGNVFLSGDIED--SEQPGRGMDYRKAVVKLGDFGLAKSLGSSV 229

Query: 397 EMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPF 443
           +  TT  G+  Y+SPE+LM  PY   LSD W++G ++Y +     PF
Sbjct: 230 DFATTYVGTPYYMSPEVLMDQPYSP-LSDVWSLGCVVYEMCSLHPPF 275

>YMR001C (CDC5) [3966] chr13 complement(269019..271136)
           Serine/threonine protein kinase required for exit from
           mitosis and for inactivation of the Rad53p checkpoint
           kinase during adaptation to unrepaired DNA damage,
           member of the polo family of protein kinases [2118 bp,
           705 aa]
          Length = 705

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 70/143 (48%), Gaps = 20/143 (13%)

Query: 304 MIMSYCAGGDLFEL-ASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           +++  C  G L EL   +  L E  +R    ++   +KY+H   ++HRDLKL N+     
Sbjct: 156 ILLEICPNGSLMELLKRRKVLTEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFD-- 213

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPD-EMCTTRCGSEDYVSPEILMGVPYDG 421
                            + +++ DFGL   +  + E   T CG+ +Y++PE+LMG     
Sbjct: 214 ---------------SNYNLKIGDFGLAAVLANESERKYTICGTPNYIAPEVLMGKHSGH 258

Query: 422 RLS-DSWAMGVILYALLEDRLPF 443
               D W++GV+LYALL  + PF
Sbjct: 259 SFEVDIWSLGVMLYALLIGKPPF 281

>CAGL0K10604g complement(1029226..1030566) similar to sp|P27466
           Saccharomyces cerevisiae YFR014c CMK1
           Ca2+/calmodulin-dependent ser/thr protein kinase type I,
           hypothetical start
          Length = 446

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/168 (31%), Positives = 82/168 (48%), Gaps = 17/168 (10%)

Query: 278 INDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELT 336
           +N +  L+ P  +  +D         ++    +GG+LF+ +       E     I  ++ 
Sbjct: 114 LNIIQHLDHPNIVKFKDWFETESKFYIVTQLASGGELFDRIMHDGKYTEEDAVNIVVQIL 173

Query: 337 LGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPD 396
             V+YLH   I+HRDLK EN         +L + + +    D  IV LADFG+ R++E D
Sbjct: 174 KAVEYLHSQNIIHRDLKPEN---------LLYLDKSK----DSRIV-LADFGIARQLEND 219

Query: 397 EMCTTR-CGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPF 443
           +    R  GS  YV+PE+     + G+ SD W++GVI Y LL    PF
Sbjct: 220 DDVIYRPAGSLGYVAPEVFTSDGH-GKPSDIWSVGVITYTLLCGYSPF 266

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 78/165 (47%), Gaps = 17/165 (10%)

Query: 281 LTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGV 339
           L  L+ P  +  +D         ++     GG+LF+ +  +    E    +I  ++   V
Sbjct: 107 LQKLDHPNIVKFKDWFESREKFYIVTQLATGGELFDRILKKGKFTETDAVKIVVQMLTAV 166

Query: 340 KYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMC 399
           +Y+H   +VHRDLK ENVL   P D             +  +V ++DFG+ +++  +   
Sbjct: 167 EYMHSQNVVHRDLKPENVLYLDPSD-------------ESQLV-ISDFGIAKQLSSESQL 212

Query: 400 TTR-CGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPF 443
             R  GS  YV+PE+L    + G+  D W++GVI Y LL    PF
Sbjct: 213 IHRAAGSMGYVAPEVLTTSGH-GKPCDIWSLGVITYTLLCGYSPF 256

>CAGL0K03399g complement(310487..312598) highly similar to sp|P12688
           Saccharomyces cerevisiae YKL126w
           Serine/threonine-protein kinase, start by similarity
          Length = 703

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 73/142 (51%), Gaps = 20/142 (14%)

Query: 304 MIMSYCAGGDLF-ELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           ++++   GG+LF  L  +        R   AEL   +  LH+  +++RDLK EN+L+ + 
Sbjct: 445 LVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDY- 503

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCT-TRCGSEDYVSPEILMGVPYDG 421
                           Q  + L DFGLC+    DE  T T CG+ +Y++PE+L+G  Y  
Sbjct: 504 ----------------QGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGY-S 546

Query: 422 RLSDSWAMGVILYALLEDRLPF 443
           ++ D W +GV+LY +L    P+
Sbjct: 547 KVVDWWTLGVLLYEMLTGLPPY 568

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 80/173 (46%), Gaps = 20/173 (11%)

Query: 274 HLHAINDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFELASQNTLPEWLLRRIFA 333
           H+  I+ L  L     +  R   +      +I+ YCA G L ++     L E        
Sbjct: 52  HMLEIDLLKNLRHQNIVEYRGFIQKAHELYIILEYCARGSLRDILKHGPLLEDDTVNYVT 111

Query: 334 ELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRI 393
           +   G++YLHE  ++HRD+K  N+                 LL ++ IV+LADFG+  RI
Sbjct: 112 QTLYGLQYLHEQGVIHRDIKAANL-----------------LLTEEGIVKLADFGVSTRI 154

Query: 394 EPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPFDPL 446
             + M  T  GS ++++PE++ G      +SD W++G  +  LL    PF  L
Sbjct: 155 --NRMAMTYAGSPNWMAPEVMTG-QGASTVSDIWSLGATVVELLTGNPPFHNL 204

>CAGL0J04972g 472984..474003 some similarities with tr|Q12100
           Saccharomyces cerevisiae YDL025c, hypothetical start
          Length = 339

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 58/110 (52%), Gaps = 20/110 (18%)

Query: 332 FAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLC- 390
           F ++   V+YLH   IVHRDLKLEN++                L  D   ++L DFG+  
Sbjct: 147 FLQICEAVQYLHSRGIVHRDLKLENIM----------------LCADACQIKLIDFGVAV 190

Query: 391 RRIEPDEM---CTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALL 437
            R +P  +   C   CG+E  ++PE+L  + Y G  +D W++G+I++ + 
Sbjct: 191 NRQDPQSLTTACKGMCGTEALMAPEVLGSISYVGEYADCWSVGIIMFQIF 240

>YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine
           protein kinase of unknown function [2697 bp, 898 aa]
          Length = 898

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 105/236 (44%), Gaps = 58/236 (24%)

Query: 304 MIMSYCAGGDLFELASQ-NTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
            ++ +  GG+L  L  +  T  +   R   A+L   ++++H + I+HRDLK ENVL    
Sbjct: 90  FVLDFAPGGELLSLLHKMGTFNDIWTRHFTAQLIDALEFIHSHGIIHRDLKPENVL---- 145

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEP------------------DEMCTTRCG 404
                       L  D  ++ + DFG    I+P                  ++ C +  G
Sbjct: 146 ------------LDRDGRLM-ITDFGAAATIDPSLSGDSAKFNSDSNGSKDNQNCASFVG 192

Query: 405 SEDYVSPEILMGVPYD--GRLSDSWAMGVILYALLEDRLPFDPLPTAAPGKRQRRSSTAH 462
           + +YVSPE+L+   Y+  G  SD WA+G ++Y  ++ + PF         + +    T  
Sbjct: 193 TAEYVSPELLL---YNQCGYGSDIWALGCMIYQFVQGQPPF---------RGENELKTFE 240

Query: 463 RISRFEWRW---IKMAESEYPAKEIVENCLTR-----KNIRCNIEKIYENPYVNEV 510
           +I   ++ W    ++  S  P   +V N + +      N R ++E+I  +PY ++V
Sbjct: 241 KIVALDYPWGPNNRINNSTSPINPLVINLVQKILVIEVNERISLEQIKRHPYFSKV 296

>Kwal_33.13222
          Length = 148

 Score = 65.1 bits (157), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 57/114 (50%), Gaps = 18/114 (15%)

Query: 304 MIMSYCAGGDLFEL-ASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           M++ Y   G+LF L   +  LPE    R F ++ +G+ Y H   IVHRDLK EN+L+   
Sbjct: 24  MVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHK 83

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMG 416
            +                 +++ADFG+      D++  T CGS  Y +PEI+ G
Sbjct: 84  FN-----------------IKIADFGMAALESKDKLLETSCGSPHYAAPEIVSG 120

>YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine
           protein kinase involved in induction of autophagy after
           nutrient limitation [2694 bp, 897 aa]
          Length = 897

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 87/182 (47%), Gaps = 37/182 (20%)

Query: 298 GLPPCD-------MIMSYCAGGDL-FELASQNTLPEW--LLRRIF--------------- 332
           GL  C+       +IM YCA GDL F L  +  L E   LLR +F               
Sbjct: 87  GLIDCERTSTDFYLIMEYCALGDLTFLLKRRKELMENHPLLRTVFEKYPPPSENHNGLHR 146

Query: 333 -------AELTLGVKYLHENLIVHRDLKLENVLIKFPL---DDILAMHEQREL-LLDQHI 381
                   +L   +K+L    +VHRD+K +N+L+  PL    D  + HE   + + +  I
Sbjct: 147 AFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGYHDSKSFHELGFVGIYNLPI 206

Query: 382 VELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRL 441
           +++ADFG  R +    +  T CGS  Y++PEIL    Y+ + +D W++G +++ +     
Sbjct: 207 LKIADFGFARFLPNTSLAETLCGSPLYMAPEILNYQKYNAK-ADLWSVGTVVFEMCCGTP 265

Query: 442 PF 443
           PF
Sbjct: 266 PF 267

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 83/180 (46%), Gaps = 36/180 (20%)

Query: 266 GIWHPCIIHLHAINDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLP 324
           G+ HP II L+A     F +  R               ++M +   G+L++ L +     
Sbjct: 154 GMDHPNIIKLYA----HFHDEKR-------------VYLLMEHSINGELYKSLKNNGPFN 196

Query: 325 EWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVEL 384
           + L      ++   + Y+H+  I+HRD+K ENVLI F                  ++V+L
Sbjct: 197 DVLASHYIYQIADALHYMHKKRIIHRDVKPENVLIGF-----------------DNVVKL 239

Query: 385 ADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPFD 444
           ADFG            T CG+ DY+SPE++    YD ++ D WA+GV+ Y L+    PF+
Sbjct: 240 ADFGWSILNPEGSKRKTLCGTIDYLSPEMITPREYDEQV-DVWALGVLAYELVVGVPPFE 298

>Kwal_55.21545
          Length = 865

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 87/188 (46%), Gaps = 29/188 (15%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPL 363
           +IM YCAGG L  L     + E  +  I  EL   + ++H++ ++HRD+K  NVLI    
Sbjct: 93  VIMEYCAGGSLRTLLRPGKIGEQYIGVIMRELLTALMHIHKDGVIHRDIKAANVLITN-- 150

Query: 364 DDILAMHEQRELLLDQHIVELADFGLCRRIEPDEM-CTTRCGSEDYVSPEILM-GVPYDG 421
                         D HI +L DFG+  ++   ++   T  G+  +++PE++M GV YD 
Sbjct: 151 --------------DGHI-KLCDFGVAAQLSQTKIRRQTMAGTPYWMAPEVIMEGVYYDT 195

Query: 422 RLSDSWAMGVILYALLEDRLPFDPLPTAAPGKRQRRSSTAHRISRFEWRWIKMAESEYPA 481
           ++ D W++G+  Y +     P+          R  +  T  +  R E R    A      
Sbjct: 196 KV-DIWSLGITAYEIATGNPPY----CEVEALRAMQLITKSKPPRLEGRQHSSA-----L 245

Query: 482 KEIVENCL 489
           KEI+  CL
Sbjct: 246 KEIIALCL 253

>CAGL0L07810g complement(857656..859446) similar to sp|P25333
           Saccharomyces cerevisiae YCR008w SAT4
           serine/threonine-specific protein kinase, start by
           similarity
          Length = 596

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 68/142 (47%), Gaps = 23/142 (16%)

Query: 305 IMSYCAGGDLFELASQNTLPEWLLRR-IFAELTLGVKYLHENLIVHRDLKLENVLIKFPL 363
           +M YCAGGDLF L       E++     F +L  GV Y+H+  + HRDLK EN++     
Sbjct: 377 VMEYCAGGDLFTLIIAAGKLEYMEADCFFKQLLRGVVYMHDMGVCHRDLKPENLI----- 431

Query: 364 DDILAMHEQRELLLDQHIVELADFG--LCRRIEPDE---MCTTRCGSEDYVSPEILMGVP 418
                       L    ++++ DFG   C ++  +E   +    CGS  Y++PE  +   
Sbjct: 432 ------------LTHDGVLKITDFGNSECFKMAWEEDIHLSGGVCGSSPYIAPEEYVLEE 479

Query: 419 YDGRLSDSWAMGVILYALLEDR 440
           +D R  D WA GVI  A+   R
Sbjct: 480 FDPRPVDIWACGVIYMAMRTGR 501

>Kwal_0.96
          Length = 427

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 77/165 (46%), Gaps = 17/165 (10%)

Query: 281 LTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGV 339
           L  L+ P  +  +D         ++     GG+LF+ +  Q    E    RI  ++   V
Sbjct: 99  LQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILKQGKFTEEDAVRIVYQILKAV 158

Query: 340 KYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIE-PDEM 398
           +YLH   IVHRDLK EN+L        L      +L+       L DFG+ + ++  DE+
Sbjct: 159 EYLHSRNIVHRDLKPENLL-------YLTEAADSQLV-------LGDFGIAKELKNDDEL 204

Query: 399 CTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPF 443
                GS  YV+PE++    + G+  D W++GV+ Y LL    PF
Sbjct: 205 IHKAAGSMGYVAPEVVTTSGH-GKPCDIWSLGVVTYTLLCGYSPF 248

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 98/218 (44%), Gaps = 44/218 (20%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPL 363
           ++M Y  GG L ++ +   L E  +  +  E   G+++LH   ++HRD+K +N+L+    
Sbjct: 770 VVMEYMEGGSLTDVVTHCILTEGQIGAVSRETLKGLQFLHSKGVIHRDIKSDNILLSMNG 829

Query: 364 DDILAMHEQRELLLDQHIVELADFGLCRRI-EPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
           D                 ++L DFG C +I E +   TT  G+  +++PE++    Y  +
Sbjct: 830 D-----------------IKLTDFGFCAQINEVNLKRTTMVGTPYWMAPEVVSRKEYGPK 872

Query: 423 LSDSWAMGVILYALLEDRLPF---DPL------PTAAPGKRQRRSSTAHRISRFEWRWIK 473
           + D W++G+++  ++E   P+    PL       T    K +   + +H+++ F   W  
Sbjct: 873 V-DIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKDPGNLSHKMAMF-LNWCL 930

Query: 474 MAESEYPAKEIVENCLTRKNIRCNIEKIYENPYVNEVA 511
           M + E                R     + E+P++ E+A
Sbjct: 931 MVDPED---------------RGTAADLLEDPFITEIA 953

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 70/142 (49%), Gaps = 19/142 (13%)

Query: 304 MIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           ++M Y   G+L++ L  ++   + +      ++   + Y+HE  I+HRD+K EN++I F 
Sbjct: 184 LLMEYLVNGELYKHLKGRSHFNDVVASYYVYQMADALDYMHERNILHRDIKPENIIIGF- 242

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
                            + ++L DFG            T CG+ DY+SPE++    Y+ +
Sbjct: 243 ----------------NNTIKLTDFGWSVITPKGSKRKTLCGTVDYLSPELIRSREYNEK 286

Query: 423 LSDSWAMGVILYALLEDRLPFD 444
           + D WA+GV+ Y LL    PF+
Sbjct: 287 V-DVWALGVLTYELLVGSPPFE 307

>KLLA0F24618g complement(2288943..2290613) similar to sp|P38070
           Saccharomyces cerevisiae YBR028c, start by similarity
          Length = 556

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 83/173 (47%), Gaps = 30/173 (17%)

Query: 304 MIMSYCAGGDLF-ELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           +++ Y  GG+LF  L  Q TL E  +    AEL+  +K+LH   IV+RDLK EN L    
Sbjct: 258 LVLQYIPGGELFYHLKEQGTLDEGTVAFYAAELSCALKFLHSKGIVYRDLKPENCL---- 313

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCT-----------TRCGSEDYVSP 411
                 ++E+  L+       L DFGL ++   D+  T           +  G+ +Y +P
Sbjct: 314 ------LNERGHLV-------LTDFGLSKKSVFDDAATPEEGENVNQLYSIIGTPEYCAP 360

Query: 412 EILMGVPYDGRLSDSWAMGVILYALLEDRLPFDPLPTAAPGKRQRRSSTAHRI 464
           EIL G PY     D +++G ++Y +L  + PF  +       + ++  T  RI
Sbjct: 361 EILAGEPYTQN-CDWYSLGCLVYDMLIGKPPFTGVNHKIILNKIKQEKTGARI 412

>ACL054W [995] [Homologous to ScYGL180W (APG1) - SH]
           complement(269703..272621) [2919 bp, 972 aa]
          Length = 972

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 90/182 (49%), Gaps = 37/182 (20%)

Query: 298 GLPPCD-------MIMSYCAGGDL-FELASQNTLPEW--LLRRIF--------------- 332
           GL  C+       ++M YCA GDL F +  + +L +   L+R +F               
Sbjct: 81  GLLECERTGTDFYLMMEYCALGDLTFFIKKRRSLMDKHPLVRTLFEKYPPPSEHHNGLNR 140

Query: 333 -------AELTLGVKYLHENLIVHRDLKLENVLIKFPL---DDILAMHEQREL-LLDQHI 381
                   +L+  +K+L    +VHRD+K +N+L+  PL   +D    H +  + + +  I
Sbjct: 141 VLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLSTPLVDYNDPAEFHARGFVGIYNLPI 200

Query: 382 VELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRL 441
           +++ADFG  R +    +  T CGS  Y++PEIL    Y+ + +D W++G +LY +   + 
Sbjct: 201 LKIADFGFARFLPNTSLAETLCGSPLYMAPEILNYQKYNAK-ADLWSVGTVLYEMCCGKP 259

Query: 442 PF 443
           PF
Sbjct: 260 PF 261

>YDL025C (YDL025C) [836] chr4 complement(405341..407203)
           Serine/threonine protein kinase with similarity to
           members of the NPR1 subfamily [1863 bp, 620 aa]
          Length = 620

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 69/145 (47%), Gaps = 23/145 (15%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPL 363
           ++M Y A  D F L   N + +  +   F +L  GV YLH   + HRDLKL+N ++    
Sbjct: 384 LVMEY-APYDFFNLVMSNLMTQDEVNCYFKQLCHGVNYLHSMGLAHRDLKLDNCVV---- 438

Query: 364 DDILAMHEQRELLLDQHIVELADFGLCRRIE-PDEMCTTR----CGSEDYVSPEILMGVP 418
                            I++L DFG     + P E    +     GS+ Y++PE+L    
Sbjct: 439 -------------TKDGILKLIDFGSAVVFQYPYEDTIVKSHGIVGSDPYLAPELLKQTS 485

Query: 419 YDGRLSDSWAMGVILYALLEDRLPF 443
           YD R++D W++ +I Y ++  R P+
Sbjct: 486 YDPRVADVWSIAIIFYCMVLKRFPW 510

>ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH]
           (157357..160200) [2844 bp, 947 aa]
          Length = 947

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 73/142 (51%), Gaps = 20/142 (14%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPL 363
           +IM YCAGG L  L     + E  L  I  +L + + Y+H++ ++HRD+K  NVLI    
Sbjct: 99  VIMEYCAGGSLRTLLRPGKIDEKYLGVIVRKLLIALVYIHKDNVIHRDIKAANVLIT--- 155

Query: 364 DDILAMHEQRELLLDQHIVELADFGLCRRI-EPDEMCTTRCGSEDYVSPEILM-GVPYDG 421
                         ++  V+L DFG+  ++   +    T  G+  +++PE++M GV Y+ 
Sbjct: 156 --------------NEGHVKLCDFGVAAQLTAANHKRQTMAGTPYWMAPEVIMEGVYYNT 201

Query: 422 RLSDSWAMGVILYALLEDRLPF 443
           + +D W++G+  Y +     P+
Sbjct: 202 K-ADIWSLGITAYEIATGNPPY 222

>Kwal_14.1273
          Length = 415

 Score = 68.2 bits (165), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 61/205 (29%), Positives = 95/205 (46%), Gaps = 35/205 (17%)

Query: 304 MIMSYCAGGDLFELA------SQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENV 357
            +M Y A GDL+++       S   +P  L R +  +L   ++Y H   I HRD+K ENV
Sbjct: 81  FVMEYAARGDLYDVIRGWKRHSAERVPVELARVVL-QLCSAIEYAHSCGIAHRDIKPENV 139

Query: 358 LIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGV 417
           L+                      V+LAD+GL  R+     C TR G+E Y++PE     
Sbjct: 140 LLD-----------------SAGNVKLADWGLSTRMRVS--CDTRIGTEKYLAPEAYAS- 179

Query: 418 PYDGRLSDSWAMGVILYALLEDRLPF-DPLPTAAPGKRQRRSSTA--HR-ISRFEWRWIK 473
           P+D  L+D W++GV L  ++    PF +   T +P         A  HR IS + +  ++
Sbjct: 180 PHDTFLADFWSLGVTLLFVMFGACPFKNACLTKSPNNPNFAHFVASPHRFISEYYFLPLR 239

Query: 474 MAESEYPAKEI----VENCLTRKNI 494
            A S  PA+ +    V + L R+ +
Sbjct: 240 AARSAKPAEWLSLPHVSDALQREQL 264

>AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH]
           (1044971..1047679) [2709 bp, 902 aa]
          Length = 902

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 73/147 (49%), Gaps = 20/147 (13%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPL 363
           +++ YC  G L +L  +  L E   +    +   G++YLH+  ++HRD+K  N+      
Sbjct: 91  ILLEYCIRGSLRDLIKKEALSEAKAKTYVRQTLRGLQYLHDQGVIHRDIKAANL------ 144

Query: 364 DDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRL 423
                      LL +  +V+LADFG+  R+  + M  T  GS ++++PE+++G      +
Sbjct: 145 -----------LLTENGVVKLADFGVSTRV--NNMAMTYAGSPNWMAPEVMLG-KGASTV 190

Query: 424 SDSWAMGVILYALLEDRLPFDPLPTAA 450
           SD W++G  +  LL    PF  L   A
Sbjct: 191 SDIWSLGATVVELLTGNPPFYNLVNEA 217

>Kwal_47.17252
          Length = 872

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 87/182 (47%), Gaps = 37/182 (20%)

Query: 298 GLPPCD-------MIMSYCAGGDL-FELASQNTLPEW--LLRRIF--------------- 332
           GL  C+       +IM YCA GDL F +  +  L E   L+R +F               
Sbjct: 85  GLMDCERTGADFFLIMEYCALGDLTFLIKKRGGLIEKHPLVRTMFEKYPPPSESHNGLNR 144

Query: 333 -------AELTLGVKYLHENLIVHRDLKLENVLIKFPL---DDILAMHEQREL-LLDQHI 381
                   +L+  + +L    +VHRD+K +N+L+  PL    D    H+   + + +  I
Sbjct: 145 VVVVSYLQQLSSALMFLRSKNLVHRDIKPQNLLLSTPLVNYSDRETFHKMGFVGIYNLPI 204

Query: 382 VELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRL 441
           +++ADFG  R +    +  T CGS  Y++PEIL    Y+ + +D W++G +LY +   R 
Sbjct: 205 LKIADFGFARFLPNTSLAETLCGSPLYMAPEILDYQKYNAK-ADLWSVGTVLYEMCCGRP 263

Query: 442 PF 443
           PF
Sbjct: 264 PF 265

>Kwal_26.7635
          Length = 691

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 73/142 (51%), Gaps = 20/142 (14%)

Query: 304 MIMSYCAGGDLF-ELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           +++++  GG+LF  L  +        R   AEL   ++ LH   +++RDLK EN+L+   
Sbjct: 433 IVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDH- 491

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCR-RIEPDEMCTTRCGSEDYVSPEILMGVPYDG 421
                           Q  + L DFGLC+  ++  +   T CG+ +Y++PE+L+G  Y  
Sbjct: 492 ----------------QGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGY-S 534

Query: 422 RLSDSWAMGVILYALLEDRLPF 443
           ++ D W +GV+LY ++    P+
Sbjct: 535 KVVDWWTLGVLLYEMMTGLPPY 556

>CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces
           cerevisiae YMR291w, hypothetical start
          Length = 622

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 76/162 (46%), Gaps = 23/162 (14%)

Query: 304 MIMSYCAGGDLFE--LASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKF 361
           +I   C   DL++  + +Q    E  ++   A L   +++LH N IVHRD+K ENVL  F
Sbjct: 149 LITQLCQKDDLYDTIIKNQKLDLETQVKPYTACLISALEFLHSNGIVHRDIKAENVL--F 206

Query: 362 PLDDILAMHEQRE---LLLDQHIVELADFGLCRRIEPDEMCTTR--CGSEDYVSPEILM- 415
            L   +  +E  E     L  H + LADFGL  R+  +   T R   G+  Y+SPEI+  
Sbjct: 207 RLKHQINPNETAENATYDLAAHDLILADFGLATRVNVESTTTLREYVGTVSYISPEIVAC 266

Query: 416 -------------GVPYDGRLSDSWAMGVILYALLEDRLPFD 444
                         +P  G   D WA+GV+ Y +     PFD
Sbjct: 267 KGVSSIDNTKEIEKIPKYGTPVDIWALGVLTYFMALGYTPFD 308

>Sklu_2342.5 YMR291W, Contig c2342 6908-8599 reverse complement
          Length = 563

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 77/159 (48%), Gaps = 18/159 (11%)

Query: 304 MIMSYCAGGDLFELA-SQNTLP-EWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKF 361
           ++   C+GGDL+++  +  +L     ++   A L   +++LH+N +VHRD+K ENVL   
Sbjct: 121 LVTQLCSGGDLYDMIINAGSLDLRTQVKPYTACLLSALEFLHDNGVVHRDIKAENVLFTL 180

Query: 362 PLDDILAMHEQRELLLD--QHIVELADFGLCRRIEPD-EMCTTRCGSEDYVSPEILM--- 415
             D  +    +  L  D   H + LADFGL   +    E      G+  Y++PEI+    
Sbjct: 181 RSDKEIQSPAKHSLQYDLKAHDLILADFGLATELTAKGEELKEYVGTISYIAPEIVRCEG 240

Query: 416 ----------GVPYDGRLSDSWAMGVILYALLEDRLPFD 444
                      VP  G   D WA+GV+ Y ++   +PFD
Sbjct: 241 INRLSPDEYNKVPKYGTEVDIWALGVLCYFMMCGYMPFD 279

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 91/209 (43%), Gaps = 37/209 (17%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPL 363
           +IM YCAGG L  L     + E  +  I  E+ + +  +H + ++HRD+K  N+LI    
Sbjct: 90  VIMEYCAGGSLRTLLRPGIIEEKYIGVIMREILVALISIHRDNVIHRDIKAANILIA--- 146

Query: 364 DDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMC-TTRCGSEDYVSPEILM-GVPYDG 421
                         +   V+L DFG+  ++    +   T  G+  +++PE++M GV YD 
Sbjct: 147 --------------NNGSVKLCDFGVAAQLSQSMLKRQTMAGTPYWMAPEVIMEGVYYDT 192

Query: 422 RLSDSWAMGVILYALLEDRLPFDPLPTAAPGKRQRRSSTAHRISRFEWRWIKMAESEYPA 481
           ++ D W++G+  Y +     P+  +       R  +  T  +  R E R     E   P 
Sbjct: 193 KV-DIWSLGITAYEIATGNPPYCHMEAI----RAMQMITKSKPPRLEGR-----EYSQPL 242

Query: 482 KEIVENCLTRKNIRCNIEKIYENPYVNEV 510
           KE +  CL         E   E PY  E+
Sbjct: 243 KEFIALCLD--------EDPKERPYAEEL 263

>CAGL0L06006g complement(670707..673535) similar to sp|P53104
           Saccharomyces cerevisiae YGL180w APG1 essential for
           autophagocytosis, hypothetical start
          Length = 942

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 68/251 (27%), Positives = 110/251 (43%), Gaps = 49/251 (19%)

Query: 298 GLPPCD-------MIMSYCAGGDLFELAS-----QNTLPEWLLRRIF------------- 332
           GL  C+       ++M YCA GDL  L       +N  P  LL+ +F             
Sbjct: 74  GLIDCERTTTDFYLVMDYCALGDLTFLIKKRKELENNHP--LLQTVFNKYPPPSKEHNGL 131

Query: 333 ---------AELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQREL----LLDQ 379
                     +L   +K+L    +VHRD+K +N+L+  PL +        EL    + + 
Sbjct: 132 NRAFVVCYLQQLASALKFLRSKNLVHRDIKPQNLLLATPLTNYRDSKTFHELGYVGIYNL 191

Query: 380 HIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLED 439
            I+++ADFG  R +    +  T CGS  Y++PEIL    Y+ + +D W++G +L+ +   
Sbjct: 192 PILKIADFGFARFLPSTSLAETLCGSPLYMAPEILNYQKYNAK-ADLWSVGTVLFEMCCG 250

Query: 440 RLPFDPLPTAAPGKRQRRSSTAHRISRFEWRWIKMAESEYPAKEIVENCLTRK-NIRCNI 498
             PF         K+ +R   AH     E  + ++ E E   KE++ + LT     R   
Sbjct: 251 VPPFTASNHLELFKKIKR---AHD----EINFPEVCEVEDGLKELICSLLTFDPAKRIGF 303

Query: 499 EKIYENPYVNE 509
           E+ + N  V E
Sbjct: 304 EEFFNNKIVTE 314

>Scas_673.20*
          Length = 758

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 71/141 (50%), Gaps = 19/141 (13%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPL 363
           ++M Y  GG L ++ S  T  E  +  I  E   G+ +LH   IVHRD+K +N+L+    
Sbjct: 553 IVMEYMDGGSLADIVSFFTPTEEQMATICRETLFGLNFLHSRGIVHRDIKSDNILLSMNG 612

Query: 364 DDILAMHEQRELLLDQHIVELADFGLCRRI-EPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
           D                 +++ DFG C ++ E +   TT  G+  +++PE++    Y  +
Sbjct: 613 D-----------------IKITDFGFCGQLTESNTKRTTMVGTPYWMAPEVIASKEYGPK 655

Query: 423 LSDSWAMGVILYALLEDRLPF 443
           + D W++G+++  ++E   P+
Sbjct: 656 V-DVWSLGIMIIEMIEGEPPY 675

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 72/154 (46%), Gaps = 33/154 (21%)

Query: 304 MIMSYCAGGDLFELASQ-NTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
            ++ Y   GD   +  +  +L E   R   A++  G+KYLH   I+HRD+K EN+     
Sbjct: 258 FLLEYAPNGDFLSVMKKYGSLSEDCTRYYSAQIIDGIKYLHSKGIIHRDIKPENI----- 312

Query: 363 LDDILAMHEQRELLLDQHI-VELADFGLCRRIEP---DE---------MCTTRCGSEDYV 409
                        LLD+ + V++ DFG  + +EP   DE            +  G+ +YV
Sbjct: 313 -------------LLDKDMKVKITDFGTAKILEPKNEDEDNPEFNLLTRSKSFVGTAEYV 359

Query: 410 SPEILMGVPYDGRLSDSWAMGVILYALLEDRLPF 443
           SPE+L     D R  D WA G +++ ++  + PF
Sbjct: 360 SPELLNDSYVDARC-DIWAFGCMVFQMIAGKPPF 392

>Kwal_0.307
          Length = 490

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 66/142 (46%), Gaps = 23/142 (16%)

Query: 305 IMSYCAGGDLFELASQNTLPEWLLRR-IFAELTLGVKYLHENLIVHRDLKLENVLIKFPL 363
           +M YC GGDLF L       E++     F +L  GV Y+H+  + HRDLK EN+L     
Sbjct: 350 VMEYCFGGDLFTLIIAAGKLEYMEADCFFKQLIRGVVYMHDMGVCHRDLKPENLL----- 404

Query: 364 DDILAMHEQRELLLDQHIVELADFG--LCRRI--EPD-EMCTTRCGSEDYVSPEILMGVP 418
                       L     +++ DFG   C R+  E D  +    CGS  Y++PE  +   
Sbjct: 405 ------------LSSNGTLKITDFGNSECFRMAWEKDIHLSGGVCGSSPYIAPEEYVHEE 452

Query: 419 YDGRLSDSWAMGVILYALLEDR 440
           +D R  D WA GVI  A+   R
Sbjct: 453 FDPRPVDIWACGVIYMAMRTGR 474

>Scas_668.22
          Length = 893

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 72/141 (51%), Gaps = 19/141 (13%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPL 363
           +IM Y  GG L ++ +   L E  +  +  E   G+++LH   ++HRD+K +N+L+    
Sbjct: 683 VIMEYMEGGSLTDVVTHCILTEGQIGAVCRETLSGLQFLHSKGVLHRDIKSDNILLSISG 742

Query: 364 DDILAMHEQRELLLDQHIVELADFGLCRRI-EPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
           D                 ++L DFG C +I E +   TT  G+  +++PE++    Y  +
Sbjct: 743 D-----------------IKLTDFGFCAQINEINLKRTTMVGTPYWMAPEVVSRKEYGPK 785

Query: 423 LSDSWAMGVILYALLEDRLPF 443
           + D W++G+++  ++E   P+
Sbjct: 786 V-DIWSLGIMIIEMIEGEPPY 805

>KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication, start by similarity
          Length = 708

 Score = 68.2 bits (165), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 72/144 (50%), Gaps = 22/144 (15%)

Query: 304 MIMSYCAGGDLFELASQNT-LPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           +++  C  G + EL  Q   L E  +R    ++   ++Y+H   ++HRDLKL N+     
Sbjct: 164 ILLEICPNGSVMELLRQRKHLTEPEVRFCMIQIIGAIRYMHSRRVIHRDLKLGNIFFD-- 221

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPD-EMCTTRCGSEDYVSPEILMGVPYDG 421
                           ++ +++ DFGL   +  D E   T CG+ +Y++PE+L G  + G
Sbjct: 222 ---------------KEYNLKIGDFGLAAVLANDKERKYTICGTPNYIAPEVLTG-KHTG 265

Query: 422 RL--SDSWAMGVILYALLEDRLPF 443
                D W++GV+LYALL  + PF
Sbjct: 266 HSYEVDIWSIGVMLYALLFGKPPF 289

>YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine
           protein kinase with similarity to mammalian
           3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk2p, required for
           endocytosis [3246 bp, 1081 aa]
          Length = 1081

 Score = 68.2 bits (165), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 67/153 (43%), Gaps = 31/153 (20%)

Query: 304 MIMSYCAGGDLFELASQ-NTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
            ++ Y   GD   L  +  +L E   R   A++   + YLH N I+HRD+K EN+L+   
Sbjct: 255 FLLEYAPNGDFLSLMKKYGSLDETCARYYAAQIIDAIDYLHSNGIIHRDIKPENILLDGE 314

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTR------------CGSEDYVS 410
           +                  ++L DFG  + + P     ++             G+ +YVS
Sbjct: 315 MK-----------------IKLTDFGTAKLLNPTNNSVSKPEYDLSTRSKSFVGTAEYVS 357

Query: 411 PEILMGVPYDGRLSDSWAMGVILYALLEDRLPF 443
           PE+L     D R  D WA G IL+ ++  + PF
Sbjct: 358 PELLNDSFTDYRC-DIWAFGCILFQMIAGKPPF 389

>CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, hypothetical start
          Length = 442

 Score = 67.4 bits (163), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 76/159 (47%), Gaps = 17/159 (10%)

Query: 281 LTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGV 339
           L  L  P  +  +D         ++     GG+LF+ + ++    E     I  ++   V
Sbjct: 98  LQMLKHPNIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKGKFTERDAVSITMQILSAV 157

Query: 340 KYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEP-DEM 398
            Y+H   +VHRDLK ENVL     D             D  +V +ADFG+ ++++  D++
Sbjct: 158 DYMHSKNVVHRDLKPENVLYIDKSD-------------DSQLV-IADFGIAKQLQDNDDL 203

Query: 399 CTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALL 437
                GS  YV+PE+L    + G+  D W++GVI+Y LL
Sbjct: 204 IFKAAGSLGYVAPEVLTNNGH-GKPCDIWSIGVIVYTLL 241

>Kwal_56.22476
          Length = 697

 Score = 67.8 bits (164), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 72/145 (49%), Gaps = 24/145 (16%)

Query: 304 MIMSYCAGGDLFEL-ASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           +++  C  G L +L   +  L E  +R    ++   VKY+H   ++HRDLKL N+     
Sbjct: 153 ILLEICPNGSLMDLLKRRKMLTEPEVRFFTTQIVGAVKYMHSRRVIHRDLKLGNI----- 207

Query: 363 LDDILAMHEQRELLLDQHI-VELADFGLCRRIEPD-EMCTTRCGSEDYVSPEILMGVPYD 420
                          D+H  +++ DFGL   +  D E   T CG+ +Y++PE+L G  + 
Sbjct: 208 -------------FFDKHYNLKVGDFGLAAVLANDRERKYTVCGTPNYIAPEVLTG-KHT 253

Query: 421 GRL--SDSWAMGVILYALLEDRLPF 443
           G     D W+ GV++YALL  + PF
Sbjct: 254 GHSYEVDIWSCGVMIYALLIGKPPF 278

>Kwal_23.5290
          Length = 819

 Score = 67.8 bits (164), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 77/155 (49%), Gaps = 30/155 (19%)

Query: 304 MIMSYCAGGDLFEL--------ASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLE 355
           ++M Y  GG L +L        +S + L E  +  I  E   G+K+LH+  I+HRD+K +
Sbjct: 615 VVMEYMEGGSLTDLIENSPANGSSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSD 674

Query: 356 NVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRI-EPDEMCTTRCGSEDYVSPEIL 414
           NV                 LL ++  V++ DFG C ++ +      T  G+  +++PE++
Sbjct: 675 NV-----------------LLDNRARVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVV 717

Query: 415 MGVPYDGRLSDSWAMGVILYALLEDRLPF---DPL 446
               YD ++ D W++G++   +LE   P+   DPL
Sbjct: 718 KQREYDEKV-DVWSLGIMTIEMLEGEPPYLNEDPL 751

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 73/141 (51%), Gaps = 19/141 (13%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPL 363
           +IM Y  GG L ++ +   L E  +  +  E   G+ +LH   ++HRD+K +N+L     
Sbjct: 755 VIMEYMEGGSLTDVVTHCILTEGQIAAVSRETLRGLHFLHSKGVIHRDIKSDNIL----- 809

Query: 364 DDILAMHEQRELLLDQHIVELADFGLCRRI-EPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
                      L +D +I +L DFG C +I E +   TT  G+  +++PE++    Y  +
Sbjct: 810 -----------LSMDGNI-KLTDFGFCAQINETNLKRTTMVGTPYWMAPEVVSRKEYGPK 857

Query: 423 LSDSWAMGVILYALLEDRLPF 443
           + D W++G+++  ++E   P+
Sbjct: 858 V-DIWSLGIMIIEMIEGEPPY 877

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 72/141 (51%), Gaps = 19/141 (13%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPL 363
           +IM Y  GG L ++ +   L E  +  +  E   G+++LH   ++HRD+K +N+L+    
Sbjct: 692 VIMEYMEGGSLTDVVTHCILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEG 751

Query: 364 DDILAMHEQRELLLDQHIVELADFGLCRRI-EPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
           D                 ++L DFG C +I E +   TT  G+  +++PE++    Y  +
Sbjct: 752 D-----------------IKLTDFGFCAQINELNLKRTTMVGTPYWMAPEVVSRKEYGPK 794

Query: 423 LSDSWAMGVILYALLEDRLPF 443
           + D W++G+++  ++E   P+
Sbjct: 795 V-DIWSLGIMIIEMIEGEPPY 814

>ADR313W [2054] [Homologous to ScYDL025C - SH]
           complement(1255932..1257668) [1737 bp, 578 aa]
          Length = 578

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 69/140 (49%), Gaps = 13/140 (9%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPL 363
           ++M YC   D F L   N + +  +   F ++  GV YLH   + HRDLKL+N ++    
Sbjct: 340 VVMEYCPY-DFFNLVMSNQMTKHEVWCYFKQICRGVDYLHSQGLAHRDLKLDNCVVT--A 396

Query: 364 DDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRL 423
           D IL        L+D     +  +    ++EP +      GS+ Y++PE+L  + YD   
Sbjct: 397 DGILK-------LIDFGSAIIFRYNFNSKLEPAKGI---VGSDPYLAPELLTQLYYDPSA 446

Query: 424 SDSWAMGVILYALLEDRLPF 443
           +D W++ V+ Y +   R P+
Sbjct: 447 ADVWSIAVMFYCMSLRRFPW 466

>Kwal_27.11542
          Length = 791

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 78/165 (47%), Gaps = 36/165 (21%)

Query: 304 MIMSYCAGGDLFELAS---QNTLPEWLLRRIFAELTLGVKYLHENL--IVHRDLKLENVL 358
           ++M YC+ G L +  +   QN L E  + +I +++T G+  +H  L  ++HRD+K+ENVL
Sbjct: 107 LLMEYCSAGGLIDFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVL 166

Query: 359 IKFPLDDILAMHEQRELLLDQHIVELADFG-LCRRIEPDEMCTT---------RCGSEDY 408
           I                  D    ++ DFG +C  I P +             +  +  Y
Sbjct: 167 IS-----------------DDKTFKVCDFGSVCGVIRPPKNAQEFSYVQNDILKNTTAQY 209

Query: 409 VSPEIL---MGVPYDGRLSDSWAMGVILYALLEDRLPFDPLPTAA 450
            SPE++    G P + + SD WA+GV LY L     PF+ +  AA
Sbjct: 210 RSPEMIDLYRGHPINEK-SDIWALGVFLYKLCYYTTPFEKVGDAA 253

>Kwal_0.155
          Length = 587

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 102/226 (45%), Gaps = 32/226 (14%)

Query: 304 MIMSYCAGGDLF-ELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKF- 361
           ++    AGG++F E+       E L R +  +L L VK++H   IVHRD+K EN+L +  
Sbjct: 250 IVQELLAGGEIFGEIVRLTYFSEDLSRHVIRQLALAVKHMHAMGIVHRDIKPENLLFEHV 309

Query: 362 -------PL----DDILAMHEQ-----RELLLDQHIVELADFGLCRRIEPDEMCTTRCGS 405
                  P+    DD  A  ++              V+LADFGL ++I       T CG+
Sbjct: 310 DYEPSPSPVLRKSDDPKAKQDEGIFRPGIGGGGIGTVKLADFGLSKQIYSTN-TKTPCGT 368

Query: 406 EDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPFDPLPTAAPGKRQRRSSTAHRIS 465
             Y +PE++    Y  ++ D W +G +LY +L    PF           ++      +IS
Sbjct: 369 VGYTAPEVVKDERYSMQV-DMWGIGCVLYTVLCGFPPF---------YDEKIDVLTEKIS 418

Query: 466 RFEWRWIK--MAESEYPAKEIVENCL-TRKNIRCNIEKIYENPYVN 508
           R E+ +++    E    AK  V   L    + R  I++   +P++N
Sbjct: 419 RGEFTFLRPWWDEISDGAKNAVRRLLEVDPSKRYTIDEFLADPWLN 464

>CAGL0F03311g complement(327599..330736) similar to sp|P38691
           Saccharomyces cerevisiae YHR082c KSP1 ser/thr protein
           kinase, start by similarity
          Length = 1045

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 72/151 (47%), Gaps = 29/151 (19%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWL--LRRIFAELTLGVKYLHENLIVHRDLKLENVLIKF 361
           +IM YC+GGDL+E    + +P+    +  I  ++   ++++H   I HRD+K EN+LI  
Sbjct: 150 IIMEYCSGGDLYEAIKDDLVPKKTKEITHILTQILDAIEFVHNKQIYHRDIKPENILIT- 208

Query: 362 PLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTR-CGSEDYVSPEILMGV--- 417
                         L+D  I +L D+GL      DE    R  GSE Y+ PE+       
Sbjct: 209 -------------SLIDWKI-KLTDWGLA---TTDEKSYDRNVGSERYMPPELFESNLDI 251

Query: 418 -----PYDGRLSDSWAMGVILYALLEDRLPF 443
                PYD    D W++G++   ++  + PF
Sbjct: 252 DERKEPYDCSKVDLWSIGIVFLNVVFYKNPF 282

>AEL083W [2423] [Homologous to ScYBR028C - SH]
           complement(470964..472574) [1611 bp, 536 aa]
          Length = 536

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 74/151 (49%), Gaps = 29/151 (19%)

Query: 304 MIMSYCAGGDLF-ELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           +++ Y  GG+LF  L  Q TL E  +    AE++  +K+LH   IV+RDLK EN L    
Sbjct: 241 LVLQYIPGGELFYHLKEQGTLDEVTVSFYAAEISCALKFLHSKGIVYRDLKPENCL---- 296

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRR----------IEPDEMCTTRCGSEDYVSPE 412
           LDD              H+V L DFGL +R           E  E   +  G+ +Y +PE
Sbjct: 297 LDD------------KGHLV-LTDFGLSKRGVNQADSPLGGEQVEELYSIIGTPEYCAPE 343

Query: 413 ILMGVPYDGRLSDSWAMGVILYALLEDRLPF 443
           IL G PY     D +++G + Y +L  + PF
Sbjct: 344 ILCGQPYTQN-CDWYSLGSLTYDMLIGKPPF 373

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 72/144 (50%), Gaps = 21/144 (14%)

Query: 304 MIMSYCAGGDLFELASQNT-LPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           +I+ YCA G L  L S+N  + E   +    +   G+ YLHE  ++HRD+K  N+L+   
Sbjct: 94  IILEYCAKGSLKNLISRNRPMSEHEAKPYVRQTLNGLNYLHEQGVIHRDIKAANILLD-- 151

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
                           +++V+LADFG+  ++    M  T  GS ++++PEI+ G      
Sbjct: 152 ---------------SENVVKLADFGVSTKVNNTAM--TLAGSLNWMAPEII-GNRGAST 193

Query: 423 LSDSWAMGVILYALLEDRLPFDPL 446
           LSD W++G  +  LL    PF  L
Sbjct: 194 LSDIWSLGATVVELLTGNPPFHNL 217

>CAGL0B03509g complement(349638..351431) similar to sp|P38623
           Saccharomyces cerevisiae YLR248w RCK2
           Ca/calmodulin-dependent or sp|P38622 Saccharomyces
           cerevisiae YGL158w RCK1, start by similarity
          Length = 597

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 104/228 (45%), Gaps = 36/228 (15%)

Query: 304 MIMSYCAGGDLF-ELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIK-- 360
           +I     GG++F E+     L E L R +  ++ L V+++H   IVHRD+K EN+L K  
Sbjct: 258 LIQELLDGGEIFNEIVRLTYLSEDLSRHVIKQVALAVRHMHSLGIVHRDIKPENLLFKSI 317

Query: 361 ---------FPLDDILAMHEQRELLL------DQHIVELADFGLCRRIEPDEMCTTRCGS 405
                    F   D  A      + +         IV+LADFGL ++I   +   T CG+
Sbjct: 318 EYIPSKKRTFRKSDDPATKADEGVFIPTIGGGGIGIVKLADFGLSKQI-FQKNTKTPCGT 376

Query: 406 EDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPFDPLPTAAPGKRQRRSSTAHRIS 465
             Y +PE++    Y  ++ D W +G +LY +L    PF           ++      +IS
Sbjct: 377 IGYTAPEVVKDEKYSMQV-DMWGIGCVLYTMLCGFPPF---------YDEKIDVLTEKIS 426

Query: 466 RFEWRWIK--MAESEYPAKEIVENCLT---RKNIRCNIEKIYENPYVN 508
           R E+ +++    E    AK  V+  L    RK  R  I++   +P++N
Sbjct: 427 RGEYTFLEPWWDEISPGAKHCVKKLLEVDPRK--RYTIDEFLADPWLN 472

>YOL016C (CMK2) [4800] chr15 complement(294777..296120)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type II [1344 bp, 447 aa]
          Length = 447

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 80/165 (48%), Gaps = 17/165 (10%)

Query: 281 LTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGV 339
           L  L+ P  +S +D         ++     GG+LF+ + S+    E     I  ++   V
Sbjct: 100 LQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIIVQILGAV 159

Query: 340 KYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDE-M 398
           +Y+H   +VHRDLK ENVL        +   E   L+       +ADFG+ ++++ +E +
Sbjct: 160 EYMHSKNVVHRDLKPENVL-------YVDKSENSPLV-------IADFGIAKQLKGEEDL 205

Query: 399 CTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPF 443
                GS  YV+PE+L    + G+  D W++GVI Y LL    PF
Sbjct: 206 IYKAAGSLGYVAPEVLTQDGH-GKPCDIWSIGVITYTLLCGYSPF 249

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 72/141 (51%), Gaps = 19/141 (13%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPL 363
           ++M Y  GG L ++ +   L E  +  +  E   G+++LH   ++HRD+K +N+L+    
Sbjct: 692 IVMEYMEGGSLTDVVTHCLLSEGQIGAVCRETLKGLQFLHSKGVLHRDIKSDNILLSL-- 749

Query: 364 DDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMC-TTRCGSEDYVSPEILMGVPYDGR 422
                          +  ++L DFG C +I  + +  TT  G+  +++PE++    Y  +
Sbjct: 750 ---------------KGNIKLTDFGFCAQINENNLKRTTMVGTPYWMAPEVVSRKEYGPK 794

Query: 423 LSDSWAMGVILYALLEDRLPF 443
           + D W++G+++  ++E   P+
Sbjct: 795 V-DIWSLGIMIIEMIEGEPPY 814

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 75/150 (50%), Gaps = 29/150 (19%)

Query: 304 MIMSYCAGGDLFEL--------ASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLE 355
           ++M Y  GG L ++        AS++ + E  +  I  E   G+K+LH+  I+HRD+K +
Sbjct: 589 VVMEYMEGGSLTDVIENSIGSDASESPMTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSD 648

Query: 356 NVLIKFPLDDILAMHEQRELLLDQH-IVELADFGLCRRI-EPDEMCTTRCGSEDYVSPEI 413
           NV                  LLD H  V++ DFG C ++ +      T  G+  +++PE+
Sbjct: 649 NV------------------LLDTHGRVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEV 690

Query: 414 LMGVPYDGRLSDSWAMGVILYALLEDRLPF 443
           +    YD ++ D W++G++   +LE   P+
Sbjct: 691 VKQREYDEKV-DVWSLGIMTIEMLEGEPPY 719

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 63/279 (22%), Positives = 106/279 (37%), Gaps = 77/279 (27%)

Query: 191  ALQWRKVRQIGVGNFSDVYLYESVNQTATHLQK---VAVKHVKYPEALVQSSSPKXXXXX 247
            +++W+K   IG G F  VY       +A +L+    +AVK +K  +              
Sbjct: 1031 SMRWQKRSFIGGGTFGQVY-------SAINLENGEILAVKEIKIHDTTTMKK-------- 1075

Query: 248  XXXXXXXXXXXXXXXALSGIWHPCIIHLHAINDLTFLNSPRPLSSRDLTRGLPPCDMIMS 307
                            L  + HP I+  + +              RD        ++ M 
Sbjct: 1076 -----IFPLIKEEMTVLEMLNHPNIVQYYGVE-----------VHRD------KVNIFME 1113

Query: 308  YCAGGDLFELASQNTLPEWLLRRIFA-ELTLGVKYLHENLIVHRDLKLENVLIKFPLDDI 366
            YC GG L  L     + + ++ +++  EL  G+ YLH++ +VHRD+K EN+L+ F     
Sbjct: 1114 YCEGGSLASLLDHGRIEDEMVTQVYTFELLEGLAYLHQSGVVHRDIKPENILLDF----- 1168

Query: 367  LAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTR-----------------CGSEDYV 409
                          I++  DFG  R +      T R                  G+  Y+
Sbjct: 1169 ------------NGIIKYVDFGTARTVVGSRTRTVRNAAVQDFGVETKSLNEMMGTPMYM 1216

Query: 410  SPEILMGVPYDGRLS--DSWAMGVILYALLEDRLPFDPL 446
            +PE + G    G+L   D WA+G ++  +   R P+  L
Sbjct: 1217 APETISGSAVKGKLGADDVWALGCVVLEMATGRRPWSNL 1255

>Kwal_26.7861
          Length = 955

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 74/141 (52%), Gaps = 19/141 (13%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPL 363
           ++M Y  GG L ++ +   L E  +  +  E   G+++LH   ++HRD+K +NVL     
Sbjct: 739 VVMEYMEGGSLTDVVTHCILTEGQIGAVSRETLKGLQFLHSKGVIHRDIKSDNVL----- 793

Query: 364 DDILAMHEQRELLLDQHIVELADFGLCRRI-EPDEMCTTRCGSEDYVSPEILMGVPYDGR 422
              L+M  +         ++L DFG C +I E +   TT  G+  +++PE++    Y  +
Sbjct: 794 ---LSMSGE---------IKLTDFGFCAQINEINLKRTTMVGTPYWMAPEVVSRKEYGPK 841

Query: 423 LSDSWAMGVILYALLEDRLPF 443
           + D W++G+++  ++E   P+
Sbjct: 842 V-DIWSLGIMIIEMIEGEPPY 861

>Kwal_23.4276
          Length = 521

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 81/160 (50%), Gaps = 21/160 (13%)

Query: 304 MIMSYCAGGDLFE--LASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKF 361
           ++   C+ GDL+E  + + +      ++   A L   + +LHEN +VHRD+K ENVL + 
Sbjct: 118 LVTQLCSHGDLYEKIIEAGSLDISKQVKSYTACLLSALDFLHENKVVHRDVKAENVLFRC 177

Query: 362 PLDDILAMHEQRELLLDQ--HIVELADFGLCRRIEPDEMCTTRC-GSEDYVSPEILM--G 416
            + + L+   +R    D   H + LADFGL  R +  +     C G+  Y++PE++   G
Sbjct: 178 RVSE-LSEFSRRGSHYDHTSHDLILADFGLATRCDSKDDERRECVGTISYIAPEVVRCSG 236

Query: 417 V------------PYDGRLSDSWAMGVILYALLEDRLPFD 444
           +            PY G   D WA+GV+ Y ++   +PFD
Sbjct: 237 IARLAPSQAKLIKPY-GASIDIWALGVLAYFMMTGYMPFD 275

>YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine
           protein kinase and positive regulator of early, middle,
           and late meiotic genes, may act as a meiosis-specific
           regulator of the anaphase promoting complex [1938 bp,
           645 aa]
          Length = 645

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 56/105 (53%)

Query: 328 LRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADF 387
           L+ I +++  G+K++HE+   HRDLK EN+LI          +  +    D ++++LADF
Sbjct: 170 LKSILSQILAGLKHIHEHNFFHRDLKPENILITPSTQYFEKEYMNQIGYQDNYVIKLADF 229

Query: 388 GLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVI 432
           GL R +E     T    +  Y SPEIL+   Y  +  D WA G +
Sbjct: 230 GLARHVENKNPYTAYVSTRWYRSPEILLRSGYYSKPLDIWAFGCV 274

>Scas_618.8
          Length = 427

 Score = 65.9 bits (159), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 70/142 (49%), Gaps = 17/142 (11%)

Query: 304 MIMSYCAGGDLFE-LASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           ++     GG+LF+ +  +    E    +I  ++   V+Y+H   IVHRDLK EN+L    
Sbjct: 103 IVTQLATGGELFDRIIKKGRFSEDDAVKILIQILSAVEYIHSRDIVHRDLKPENLL---- 158

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTR-CGSEDYVSPEILMGVPYDG 421
               L   E  EL+       +ADFG+ + ++  E    +  GS  YV+PE+L  V   G
Sbjct: 159 ---YLTEKEDSELV-------IADFGIAKELKKGEQLIFKAAGSLGYVAPEVLT-VDGHG 207

Query: 422 RLSDSWAMGVILYALLEDRLPF 443
           +  D W++GVI Y LL     F
Sbjct: 208 KPCDIWSIGVITYTLLSGYAAF 229

>Scas_716.73
          Length = 416

 Score = 65.9 bits (159), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 84/183 (45%), Gaps = 44/183 (24%)

Query: 304 MIMSYCAGGDL-----FELASQNTLPEWLLRRIFAELTLGVKYLH--------------- 343
           + M YC+ GDL     F  +    +PE ++  I A+L + +   H               
Sbjct: 87  LYMEYCSRGDLSQMIKFYKSRNKYIPEKIIWGILAQLLMALYKCHYGVELSPLVTIYDRM 146

Query: 344 ------ENLIVHRDLKLENVLI--------------KFPLDDILAMHEQRELLLD--QHI 381
                 +N+++HRDLK  N+ +              K   D+ +    ++ + +D  Q +
Sbjct: 147 KPPTKGKNIVIHRDLKPGNIFLSNDNNATNNDDDAEKEYNDNNVNEPNRQNIKMDYSQVV 206

Query: 382 VELADFGLCRRIEPD-EMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDR 440
           V+L DFGL + +E   +  TT  G+  Y+SPE+LM  PY   LSD W++G ++Y +    
Sbjct: 207 VKLGDFGLAKSLETSIQFATTYVGTPYYMSPEVLMDQPYSP-LSDIWSLGCVVYEMCSLH 265

Query: 441 LPF 443
            PF
Sbjct: 266 PPF 268

>YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine
           protein kinase with similarity to Ste20p and Cla4p [1968
           bp, 655 aa]
          Length = 655

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 76/157 (48%), Gaps = 32/157 (20%)

Query: 304 MIMSYCAGGDLFEL----ASQNT------LPEWLLRRIFAELTLGVKYLHENLIVHRDLK 353
           +IM Y  GG L ++    A  NT      L E  +  I  E   G+K+LH   I+HRD+K
Sbjct: 450 VIMEYMEGGCLTDILDAVARSNTGEHSSPLNENQMAYIVKETCQGLKFLHNKKIIHRDIK 509

Query: 354 LENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRI-EPDEMCTTRCGSEDYVSPE 412
            +N+L+                   Q +V++ DFG C  + E      T  G+  +++PE
Sbjct: 510 SDNILLN-----------------SQGLVKITDFGFCVELTEKRSKRATMVGTPYWMAPE 552

Query: 413 ILMGVPYDGRLSDSWAMGVILYALLEDRLPF---DPL 446
           I+    YD ++ D W++G++L  ++E   P+   DPL
Sbjct: 553 IVNQKGYDEKV-DVWSLGIMLIEMIEGEPPYLNEDPL 588

>Scas_685.24
          Length = 515

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 80/162 (49%), Gaps = 30/162 (18%)

Query: 304 MIMSYCAGG---DLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIK 360
           ++M YC GG   DL +    N LPE  +  I  E+  G++YLHE   +HRD+K  N+   
Sbjct: 95  IVMEYCGGGSCSDLLKYYFNNGLPEKKVAYITREILKGLQYLHEQKKIHRDIKAANI--- 151

Query: 361 FPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEI----LMG 416
                         LL ++  V+L DFG+  +++      T  G+  +++PE+    + G
Sbjct: 152 --------------LLTEEGHVKLGDFGVSGQLKSTLRRGTIVGTPYWMAPEVASQNIEG 197

Query: 417 VPYDGRLSDSWAMGVILYALLEDRLP---FDPLPTAAPGKRQ 455
             YD ++ D W++G+ ++ LL+   P    DP+   A   R+
Sbjct: 198 --YDEKI-DIWSLGITVFELLKGVPPLVKLDPIRVLANLSRK 236

>KLLA0C03938g complement(358851..360632) some similarities with
           sgd|S0002183 Saccharomyces cerevisiae YDL025c,
           hypothetical start
          Length = 593

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 78/167 (46%), Gaps = 23/167 (13%)

Query: 282 TFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKY 341
           +FL+    + + D+ +      ++M YC   D F L   + + +  +   F ++  GV Y
Sbjct: 323 SFLHHQNVIETLDMLQEGEHFLVVMEYCQY-DFFTLVMSDLMGKHEIACYFKQICNGVAY 381

Query: 342 LHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFG---LCRRIEPDEM 398
           LH   + HRDLKL+N ++                   Q I++L DFG   +      D++
Sbjct: 382 LHSQGLAHRDLKLDNCVVN-----------------AQGILKLIDFGSATIFHYKYEDKI 424

Query: 399 CTTR--CGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPF 443
              +   GS+ Y++PE+L+   YD R  D W++ V+ Y +   R P+
Sbjct: 425 VKAKGIVGSDPYLAPELLVSQYYDPRPVDVWSIAVMFYCMTLRRFPW 471

>AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH]
           (1005431..1006945) [1515 bp, 504 aa]
          Length = 504

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 66/142 (46%), Gaps = 23/142 (16%)

Query: 305 IMSYCAGGDLFELASQNTLPEWL-LRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPL 363
           +M YC+GGDLF L       E++     F ++  GV Y+H+  + HRDLK EN+      
Sbjct: 303 VMEYCSGGDLFSLIVTAGKLEYMEADCFFKQMIRGVVYMHDMGVCHRDLKPENL------ 356

Query: 364 DDILAMHEQRELLLDQHIVELADF--GLCRRI--EPD-EMCTTRCGSEDYVSPEILMGVP 418
                      +L    ++++ DF  G C R+  E D  +    CGS  Y++PE      
Sbjct: 357 -----------ILTANGVLKITDFGNGECFRMAWEKDIHLSGGVCGSSPYIAPEEYSMEE 405

Query: 419 YDGRLSDSWAMGVILYALLEDR 440
           +D R  D WA G I  A+   R
Sbjct: 406 FDPRPVDIWACGTIYMAMRTGR 427

>Kwal_26.7552
          Length = 461

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 63/137 (45%), Gaps = 20/137 (14%)

Query: 304 MIMSYCAGGDLFEL--ASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKF 361
           MI  Y A  DL  L    Q TL     + +F  L  G+ YLH+N I+HRD+K  N+LI  
Sbjct: 206 MIFEY-ADNDLSGLLMNEQITLSNANCKHLFKSLLEGIHYLHDNGILHRDIKGSNILID- 263

Query: 362 PLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDG 421
                           ++  +++ DFGL R++  D   T R  +  Y  PE+LMG    G
Sbjct: 264 ----------------NKGQLKITDFGLARKMRDDSDYTNRVITLWYRPPELLMGSTNYG 307

Query: 422 RLSDSWAMGVILYALLE 438
              D W  G +L  L +
Sbjct: 308 TAVDMWGCGCLLVELFK 324

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 62/268 (23%), Positives = 117/268 (43%), Gaps = 63/268 (23%)

Query: 191  ALQWRKVRQIGVGNFSDVYLYESVNQTATHLQKVAVKHVKYPE-ALVQSSSPKXXXXXXX 249
            +++W+K   IG G+F  VY   +VN     +  +AVK +K+ +   ++   P        
Sbjct: 1188 SIKWQKRSFIGGGSFGSVY--SAVNLDTGDI--LAVKEIKFNDRKTIKQVFPSIRDEMT- 1242

Query: 250  XXXXXXXXXXXXXALSGIWHPCIIHLHAINDLTFLNSPRPLSSRDLTRGLPPCDMIMSYC 309
                          L  + HP ++  + +              RD        ++ M YC
Sbjct: 1243 -------------VLEMLNHPNVVQYYGVE-----------VHRD------RVNIFMEYC 1272

Query: 310  AGGDLFELASQNTLPEWLLRRIFA-ELTLGVKYLHENLIVHRDLKLENVL---------I 359
             GG L  L +   + + ++ ++++ ++  G+ YLHE+ + HRD+K EN+L         +
Sbjct: 1273 EGGSLASLLAHGRIEDEMVTQVYSLQMLEGLAYLHESGVDHRDIKPENILLDFNGIIKYV 1332

Query: 360  KFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPY 419
             F    +LA +  ++L L+QH            +E ++M     G+  Y+SPE + G  Y
Sbjct: 1333 DFGAAKVLASNGSKKLNLEQH------------MEGEKM----IGTPMYMSPEAISGTGY 1376

Query: 420  DGRLSDS-WAMGVILYALLEDRLPFDPL 446
                SD  W++G ++  ++  R P+  L
Sbjct: 1377 GKFGSDDIWSLGCVILEMVTGRRPWANL 1404

>KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183
           Saccharomyces cerevisiae YDL025c, hypothetical start
          Length = 292

 Score = 64.3 bits (155), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 64/125 (51%), Gaps = 18/125 (14%)

Query: 317 LASQNTLPEWLLRRI-FAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQREL 375
           L   + LP +  R + F ++  G+ YLH + IVHRDLKLEN+++   L +I         
Sbjct: 100 LMKMSMLPTFEERALWFCQICEGIAYLHSHNIVHRDLKLENIMVDESLCNI--------- 150

Query: 376 LLDQHIVELADFGLCRRIEPD-EMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILY 434
                  ++ DFG    + P+ E C    GSE  ++PE+   + Y+G   D W++G++++
Sbjct: 151 -------KIIDFGSAVDVGPNKEACHGIRGSEQLMAPEVFQRLKYEGTPVDMWSLGIMMF 203

Query: 435 ALLED 439
               +
Sbjct: 204 EFFNN 208

>Scas_717.69
          Length = 674

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 73/142 (51%), Gaps = 20/142 (14%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWLLRRIF-AELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           ++++   GG+LF    +    E    R + AEL   ++ LH   +++RDLK EN+L+ + 
Sbjct: 420 LVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDY- 478

Query: 363 LDDILAMHEQRELLLDQHIVELADFGLCR-RIEPDEMCTTRCGSEDYVSPEILMGVPYDG 421
                           Q  + L DFGLC+  ++  +   T CG+ +Y++PE+L+   Y  
Sbjct: 479 ----------------QGHIALCDFGLCKLNMKDQDKTDTFCGTPEYLAPELLLNQGY-S 521

Query: 422 RLSDSWAMGVILYALLEDRLPF 443
           ++ D W +G++LY +L    P+
Sbjct: 522 KVVDWWTLGILLYEMLTGLPPY 543

>KLLA0E11979g complement(1060048..1061892) some similarities with
           sp|P25333 Saccharomyces cerevisiae YCR008w SAT4
           serine/threonine-specific protein kinase, hypothetical
           start
          Length = 614

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 64/142 (45%), Gaps = 23/142 (16%)

Query: 305 IMSYCAGGDLFELASQNTLPEWLLRRIF-AELTLGVKYLHENLIVHRDLKLENVLIKFPL 363
           +M YC+GGDLF L       E+     F  +L  GV Y+H   + HRDLK EN+L     
Sbjct: 413 VMEYCSGGDLFTLIIAAGKLEYQEADCFLKQLITGVVYMHNMGVCHRDLKPENLL----- 467

Query: 364 DDILAMHEQRELLLDQHIVELADFG--LCRRIEPDE---MCTTRCGSEDYVSPEILMGVP 418
                       L     +++ DFG   C R+  ++   +    CGS  Y++PE      
Sbjct: 468 ------------LTHDGTLKITDFGNSECFRMAWEKEIHLSGGVCGSGPYIAPEEYTQEE 515

Query: 419 YDGRLSDSWAMGVILYALLEDR 440
           +D R  D WA GVI  A+   R
Sbjct: 516 FDPRAVDIWACGVIYMAMRTGR 537

>YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine protein
           kinase required for cytokinesis [2529 bp, 842 aa]
          Length = 842

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 76/155 (49%), Gaps = 30/155 (19%)

Query: 304 MIMSYCAGGDLFEL--------ASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLE 355
           ++M +  GG L ++         S + L E  +  I  E   G+K+LH+  I+HRD+K +
Sbjct: 638 VVMEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSD 697

Query: 356 NVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRI-EPDEMCTTRCGSEDYVSPEIL 414
           NVL+     D  A             V++ DFG C R+ +      T  G+  +++PE++
Sbjct: 698 NVLL-----DTRAR------------VKITDFGFCARLTDKRSKRATMVGTPYWMAPEVV 740

Query: 415 MGVPYDGRLSDSWAMGVILYALLEDRLPF---DPL 446
               YD ++ D W++G++   +LE   P+   DPL
Sbjct: 741 KQREYDEKI-DVWSLGIMTIEMLEGEPPYLNEDPL 774

>Kwal_23.6325
          Length = 1542

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 79/179 (44%), Gaps = 34/179 (18%)

Query: 281  LTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFELASQNTLPEWLLRRIFA-ELTLGV 339
            L  LN P  +    +       ++ M YC GG L +L     + + ++ +I+A ++  G+
Sbjct: 1302 LEMLNHPNVVQYYGVEVHRDKVNLFMEYCEGGSLAQLLEHGRIEDEMVTQIYALQMLEGL 1361

Query: 340  KYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMC 399
             YLH++ +VHRD+K EN+L+ F                   +++  DFG  R +  +   
Sbjct: 1362 AYLHQSSVVHRDIKPENILLDF-----------------NGVIKYVDFGAARSLAANGTK 1404

Query: 400  TTRCGSED-------------YVSPEILMGVPYDGRL--SDSWAMGVILYALLEDRLPF 443
                G+E              Y+SPE + G    G+    D W++G ++  ++  R P+
Sbjct: 1405 APNVGAEGKADGVNSMMGTPMYMSPESITGAK-KGKFGSGDIWSLGCVILEMVTGRRPW 1462

>Scas_711.15
          Length = 727

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 59/110 (53%), Gaps = 10/110 (9%)

Query: 328 LRRIFAELTLGVKYLHENLIVHRDLKLENVLI---KFPLDDILAMHEQRELLL--DQHIV 382
           L+ I A++  G+K++H++   HRD+K EN+L+   K   D      E+ EL    D ++V
Sbjct: 170 LKSILAQILAGIKHIHDHNFFHRDIKPENILVSPNKRYFD-----KERLELGFYPDNYVV 224

Query: 383 ELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVI 432
           +LADFGL R +E     T    +  Y SPEIL+   Y     D WA G +
Sbjct: 225 KLADFGLARHVENKNTYTAYVSTRWYRSPEILLRNGYYSTPLDIWAFGCV 274

>AEL179W [2327] [Homologous to NOHBY] complement(302948..303817)
           [870 bp, 289 aa]
          Length = 289

 Score = 63.9 bits (154), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 59/112 (52%), Gaps = 17/112 (15%)

Query: 329 RRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFG 388
           R +  +L  GV YLH + +VHRDLKL+N++                L  D H ++L DFG
Sbjct: 111 RCLLGQLVEGVAYLHSSGVVHRDLKLDNMM----------------LAPDCHTLKLIDFG 154

Query: 389 LCRRIEPDEM-CTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLED 439
              +++  +  C    G+E  ++PE L  + Y+G   D W++G+I+Y L  D
Sbjct: 155 HAVKLQAGKTKCYGIGGTEPLIAPEALNQLSYEGYPVDMWSIGIIMYMLFND 206

>KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces
           cerevisiae YAR018c KIN3 ser/thr protein kinase,
           hypothetical start
          Length = 394

 Score = 64.7 bits (156), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 77/168 (45%), Gaps = 31/168 (18%)

Query: 304 MIMSYCAGGDLFELA-----SQNTLPEWLLRRIFAELTLGVKYLHEN------------- 345
           + M YC+ GDL ++       +  +PE  + RI  ++ + +   H               
Sbjct: 86  LYMEYCSKGDLSQMIRYYKHQRKYVPEEYVWRIMVQILMALFKCHYGRDLSKLQTIYDAM 145

Query: 346 ---------LIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPD 396
                    +++HRDLK  N+ +    D+        ++   + I++L DFGL + ++  
Sbjct: 146 EEPLKSKGYVVIHRDLKPGNIFLTGYDDEF--NQNASDVDYSKVIIKLGDFGLAKSLQAS 203

Query: 397 -EMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPF 443
            E  TT  G+  Y+SPE+L   PY   LSD W++G ILY L    +PF
Sbjct: 204 IEFATTYVGTPYYMSPEVLRDQPYSP-LSDIWSLGCILYELCSLHVPF 250

>YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threonine
           protein kinase potentially involved in pheromone
           response [2100 bp, 699 aa]
          Length = 699

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 70/148 (47%), Gaps = 31/148 (20%)

Query: 305 IMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLD 364
           I+ YC   DLF L     +    +  +F +L  GVKYLH+  + HRDLKL+N ++     
Sbjct: 439 ILEYCEY-DLFSLVMSEKMHYEEICCLFKQLINGVKYLHDIGLSHRDLKLDNCVVT---- 493

Query: 365 DILAMHEQRELLLDQHIVELADFGLC---------RRIEPDEMCTTRCGSEDYVSPEILM 415
                         + I++L DFG           + IE + +     GS+ Y+SPE+  
Sbjct: 494 -------------RRGILKLIDFGASSVFHYPLSSQMIEANGIV----GSDPYLSPEVFY 536

Query: 416 GVPYDGRLSDSWAMGVILYALLEDRLPF 443
              YD R  D W++G+I + ++  R P+
Sbjct: 537 FNEYDPRALDVWSVGIIFFCMITRRFPW 564

>CAGL0M03729g complement(420316..422901) similar to sp|P48562
           Saccharomyces cerevisiae YNL298w CLA4, start by
           similarity
          Length = 861

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 77/155 (49%), Gaps = 30/155 (19%)

Query: 304 MIMSYCAGGDLFEL--------ASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLE 355
           ++M Y  GG L ++        ++ + L E  +  I  E   G+K+LH+  I+HRD+K +
Sbjct: 657 VVMEYMEGGSLTDIIENSPTNGSAYSPLSEPQIAYIVRETCKGLKFLHDKNIIHRDIKSD 716

Query: 356 NVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRI-EPDEMCTTRCGSEDYVSPEIL 414
           NVL+     D  A             V++ DFG C ++ +      T  G+  +++PE++
Sbjct: 717 NVLL-----DTKAR------------VKITDFGFCAKLTDQRSKRATMVGTPYWMAPEVV 759

Query: 415 MGVPYDGRLSDSWAMGVILYALLEDRLPF---DPL 446
               YD ++ D W++G++   +LE   P+   DPL
Sbjct: 760 KQKEYDAKV-DVWSLGIMAIEMLEGEPPYLNEDPL 793

>KLLA0E17127g complement(1515721..1518279) similar to sp|P38691
           Saccharomyces cerevisiae YHR082c KSP1 ser/thr protein
           kinase, start by similarity
          Length = 852

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 70/151 (46%), Gaps = 31/151 (20%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWL--LRRIFAELTLGVKYLHENLIVHRDLKLENVLIKF 361
           +IM YC+GGDL+E    + +P     +  I  ++   V+Y+H   I HRD+K EN+LI  
Sbjct: 140 IIMEYCSGGDLYEAIKDDMVPRKTKNVTNIINQILDAVEYVHSRGIYHRDIKPENILIAG 199

Query: 362 PLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTR-CGSEDYVSPEILMGV--- 417
             +                 ++L D+GL      D+    R  GSE Y++PE+       
Sbjct: 200 NWN-----------------IKLTDWGLATT---DKTSMERNVGSERYMAPELFESNLDR 239

Query: 418 -----PYDGRLSDSWAMGVILYALLEDRLPF 443
                 YD    D WA+G+++  ++  + PF
Sbjct: 240 EERTDAYDCAKVDIWAIGIVMLNIVFHKNPF 270

>YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine
           protein kinase with similarity to Cmk1p, Cmk2p, and
           Cmk3p [1539 bp, 512 aa]
          Length = 512

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 77/148 (52%), Gaps = 10/148 (6%)

Query: 304 MIMSYCAGGDLFELASQNT-LPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIK-- 360
           ++     GG++F+   Q T   E L R +  ++ + +K++H   IVHRD+K EN+L +  
Sbjct: 211 LVTELVTGGEIFDRIVQLTCFSEDLARHVITQVAIAIKHMHYMGIVHRDVKPENLLFEPI 270

Query: 361 --FPLDDILAMHEQ---RELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILM 415
             + LD  +   ++           +V+L DFGL +++  +    T CG+ +YV+ E+  
Sbjct: 271 PFYGLDGDMQKEDEFTLGVGGGGIGLVKLMDFGLAKKLR-NNTAKTPCGTIEYVASEVFT 329

Query: 416 GVPYDGRLSDSWAMGVILYALLEDRLPF 443
              Y  ++ D W++G +L+ LL    PF
Sbjct: 330 SKRYSMKV-DMWSIGCVLFTLLCGYPPF 356

>Sklu_2099.2 , Contig c2099 975-2237 reverse complement
          Length = 420

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 62/122 (50%), Gaps = 19/122 (15%)

Query: 332 FAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCR 391
           F ++ L +++LH   IVHRDLKLEN+++ +                 +  V++ DFG   
Sbjct: 240 FKQICLAIQFLHGEGIVHRDLKLENIMVDY-----------------EGCVKIIDFGSAV 282

Query: 392 RI-EPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLED-RLPFDPLPTA 449
            +   D  C    GSE  ++PE+L  + Y+G   D W++G+++Y +  + + P  P   A
Sbjct: 283 ILASQDAKCHGMGGSEPLMAPEVLAQLSYEGLPVDIWSLGILMYQMFNNSQKPRFPWKAA 342

Query: 450 AP 451
            P
Sbjct: 343 KP 344

>Kwal_33.13112
          Length = 505

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 83/173 (47%), Gaps = 31/173 (17%)

Query: 304 MIMSYCAGG---DLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIK 360
           ++M +C GG   DL +   ++ LPE  +  I  E+  G++YLH    +HRD+K  N+   
Sbjct: 109 IVMEFCGGGSCADLLKHLPEHRLPENKVAYIIREVLYGLEYLHSQRKIHRDVKAANI--- 165

Query: 361 FPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILM-GVPY 419
                         LL D+  V+L DFG+  +I       T  G+  +++PEI+     Y
Sbjct: 166 --------------LLTDEGEVKLGDFGVSGQIMATLKRNTFVGTPYWMAPEIIARDNGY 211

Query: 420 DGRLSDSWAMGVILYALLEDRLP---FDPL------PTAAPGKRQRRSSTAHR 463
           D + +D W++G+    LL  + P   +DP+      P   P + Q R +++ R
Sbjct: 212 DEK-ADIWSLGITAMELLTGQPPYAKYDPMKVLMNIPLRKPPRLQGRFTSSAR 263

>CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces
           cerevisiae YJL106w IME2 ser/thr protein kinase,
           hypothetical start
          Length = 751

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 56/105 (53%)

Query: 328 LRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADF 387
           L+ I A++  G++++H+    HRDLK EN+LI        +   ++    D ++V+LADF
Sbjct: 184 LKSILAQVLAGLRHIHDQNFFHRDLKPENILITPSTRYFDSSWLEKGNYPDNYVVKLADF 243

Query: 388 GLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVI 432
           GL R +E     T    +  Y SPEIL+   Y  +  D WA G +
Sbjct: 244 GLARHVENKNPYTAYVSTRWYRSPEILLRSGYYSKPLDIWAFGCV 288

>KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces
           cerevisiae YNL298w CLA4 ser/thr protein kinase, start by
           similarity
          Length = 879

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 73/149 (48%), Gaps = 27/149 (18%)

Query: 304 MIMSYCAGGDLFEL--------ASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLE 355
           ++M Y  GG L ++        + Q+ L E  +  I  E   G+K+LH+  I+HRD+K +
Sbjct: 675 VVMEYMEGGSLTDIIENSPTGSSGQSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSD 734

Query: 356 NVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRI-EPDEMCTTRCGSEDYVSPEIL 414
           NV                 LL  +  V++ DFG C ++ +      T  G+  +++PE++
Sbjct: 735 NV-----------------LLDTRGRVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVV 777

Query: 415 MGVPYDGRLSDSWAMGVILYALLEDRLPF 443
               YD ++ D W++G++   +LE   P+
Sbjct: 778 KQREYDEKV-DVWSLGIMTIEMLESEPPY 805

>CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 521

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 73/155 (47%), Gaps = 26/155 (16%)

Query: 304 MIMSYCAGG---DLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIK 360
           + M YC GG   DL +    + LPE   R I  E+  G+ YLH    +HRD+K  N+   
Sbjct: 78  IAMEYCGGGSVGDLLKYHYTSGLPEHKTRFITREILKGLSYLHSQRKIHRDIKAANI--- 134

Query: 361 FPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILM--GVP 418
                         LL D+  V+L+DFG+  ++       T  G+  +++PEI+      
Sbjct: 135 --------------LLTDEGKVKLSDFGVSGKLLSSFRRDTFVGTPYWMAPEIVAHDSEG 180

Query: 419 YDGRLSDSWAMGVILYALLEDRLP---FDPLPTAA 450
           YD R +D W++G+ +  +L    P   +DP+   A
Sbjct: 181 YDER-ADIWSLGITVIEMLRGSPPLSKYDPMKVIA 214

>Scas_573.10
          Length = 569

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 105/229 (45%), Gaps = 38/229 (16%)

Query: 304 MIMSYCAGGDLF-ELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
           ++     GG++F E+       E L R +  +L L V++LH   +VHRD+K EN+L + P
Sbjct: 224 IVQELIHGGEIFGEIVKYTYFSEDLSRHVIKQLALAVQHLHSLGVVHRDIKPENLLFE-P 282

Query: 363 LDDILAMHEQRELLLD------------------QHIVELADFGLCRRIEPDEMCTTRCG 404
           ++ I +   +     D                    +V+LADFGL ++I       T CG
Sbjct: 283 IEFIPSKEPKLRKSDDPSTKSDEGLFVPGVGGGGIGVVKLADFGLSKQIFATN-TKTPCG 341

Query: 405 SEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPFDPLPTAAPGKRQRRSSTAHRI 464
           +  Y +PE++    Y  ++ D W +G +LY +L    PF           ++      +I
Sbjct: 342 TVGYTAPEVVKDEHYSMKV-DMWGVGCVLYTMLCGFPPF---------YDEKIDVLTEKI 391

Query: 465 SRFEWRWIKMAESEYPAKEIVENCLTR-----KNIRCNIEKIYENPYVN 508
           SR E+ +++    E  A    +N + R      N R +I++  E+P++N
Sbjct: 392 SRGEYTFLRPWWDEISAG--AKNAVIRLLEVDPNKRYDIDEFLEDPWLN 438

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 72/141 (51%), Gaps = 19/141 (13%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPL 363
           ++M Y  GG L ++ +   L E  +  +  E+  G+++LH   ++HRD+K +NVL+    
Sbjct: 639 VVMEYMEGGCLTDVVTYCVLTEGQIGAVCREVLQGLEFLHSKGVLHRDIKSDNVLLSMNG 698

Query: 364 DDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMC-TTRCGSEDYVSPEILMGVPYDGR 422
           D                 ++L DFG C ++    +  TT  G+  +++PEI+    Y  +
Sbjct: 699 D-----------------IKLTDFGFCAQVNDTVIKRTTMVGTPYWMAPEIVSRKEYGPK 741

Query: 423 LSDSWAMGVILYALLEDRLPF 443
           + D W++G+++  ++E   P+
Sbjct: 742 V-DIWSLGIMIIEMIEGEPPY 761

>Kwal_27.9773
          Length = 406

 Score = 64.3 bits (155), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 86/186 (46%), Gaps = 38/186 (20%)

Query: 306 MSYCAGGDLFELAS-----QNTLPEWLLRRIFAELTLGVKYLH----------------- 343
           M YC+ GDL ++ S     +  +PE L+  +  ++ + +   H                 
Sbjct: 95  MEYCSNGDLSQMISHFKKERKYIPERLVWSVMVQVLVALYRCHYGSDLAPLETIYDRMKP 154

Query: 344 ----ENLIVHRDLKLENVLI---KFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPD 396
                N+++HRDLK  N+ +   + P D  +A+   +     +  V+L DFGL + +   
Sbjct: 155 PVKGSNVVIHRDLKPGNIFLSTERVP-DARVAL---QAFDYSKISVKLGDFGLAKSLGAS 210

Query: 397 -EMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPFDPLPTAAPGKRQ 455
            E  TT  G+  Y+SPE+LM  PY   LSD W++G ++Y +   R PF         + Q
Sbjct: 211 VEFATTYVGTPYYMSPEVLMDQPYSP-LSDIWSLGCVIYEMCTLRPPFQ---AKTYTELQ 266

Query: 456 RRSSTA 461
           RR  TA
Sbjct: 267 RRIKTA 272

>Scas_584.11
          Length = 1074

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 70/150 (46%), Gaps = 28/150 (18%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWL--LRRIFAELTLGVKYLHENLIVHRDLKLENVLIKF 361
           +IM YC+GGDL+E    + +P+    +  IF+++   ++++H   I HRD+K EN+LI  
Sbjct: 132 IIMEYCSGGDLYEAIKDDLVPKKTKTITHIFSQIMDAIEFVHGKSIYHRDIKPENILI-- 189

Query: 362 PLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGV---- 417
                          +D   ++L D+GL    E         GSE Y++PE+        
Sbjct: 190 -------------TGIDW-TIKLTDWGLATTHE--TSFDRSVGSERYMAPELFESNLDIE 233

Query: 418 ----PYDGRLSDSWAMGVILYALLEDRLPF 443
                Y     D WAMG++   ++  + PF
Sbjct: 234 ERKEAYKCDKVDLWAMGIVFLNIVFQKNPF 263

>YKL139W (CTK1) [3128] chr11 (182963..184549) C-terminal domain
           (CTD) kinase alpha subunit, cyclin-dependent protein
           kinase that phosphorylates C-terminal domain of RNA
           polymerase II large subunit Rpo21p [1587 bp, 528 aa]
          Length = 528

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 55/115 (47%), Gaps = 17/115 (14%)

Query: 329 RRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFG 388
           + +F +L LG++YLH+N I+HRD+K  N+LI                  +Q  +++ DFG
Sbjct: 284 KHLFKQLLLGMEYLHDNKILHRDVKGSNILID-----------------NQGNLKITDFG 326

Query: 389 LCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPF 443
           L R++      T R  +  Y  PE+L+G    G   D W  G +L  L      F
Sbjct: 327 LARKMNSRADYTNRVITLWYRPPELLLGTTNYGTEVDMWGCGCLLVELFNKTAIF 381

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 78/173 (45%), Gaps = 29/173 (16%)

Query: 304 MIMSYCAGGDLFEL-ASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
            +M    GG+L +L   Q    E   R    +L   V+Y+H   ++HRDLK ENVL+   
Sbjct: 88  FVMDLAPGGELLQLLRRQRVFSEAWARHYMCQLVDTVEYIHSMGVIHRDLKPENVLLD-- 145

Query: 363 LDDILAMHEQRELLLD---QHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILM-GVP 418
                   E R ++ D    + V  +D G     + D+  T+  G+ +YVSPE+L+    
Sbjct: 146 -------KEGRLMIADFGAAYTVGQSDAG----SDGDKPATSFVGTAEYVSPELLLENKS 194

Query: 419 YDGRLSDSWAMGVILYALLEDRLPFDPLPTAAPGKRQRRSSTAHRISRFEWRW 471
           Y    SD WA+G +LY  L+   PF         + Q    T  +I   ++ W
Sbjct: 195 YYS--SDVWALGCMLYQFLQGTPPF---------RGQNEMETFEQIVNLDYTW 236

>Scas_700.35
          Length = 439

 Score = 64.3 bits (155), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 66/128 (51%), Gaps = 19/128 (14%)

Query: 317 LASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELL 376
           L+    + E +L +I   +  G+ YLHE  I+HRD+K +N+L          ++E+ E  
Sbjct: 244 LSRGGRIGEKILGKIAESVLRGLSYLHERKIIHRDIKPQNIL----------LNEEGE-- 291

Query: 377 LDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYAL 436
                V+L DFG+      + + TT  G+  Y++PE + G PY     D W++G+ +  +
Sbjct: 292 -----VKLCDFGVSGE-AVNSLATTFTGTSFYMAPERIQGHPYS-VTCDVWSLGLTILEV 344

Query: 437 LEDRLPFD 444
            + R PFD
Sbjct: 345 AQGRFPFD 352

>Kwal_56.22788
          Length = 515

 Score = 64.3 bits (155), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 118/281 (41%), Gaps = 60/281 (21%)

Query: 183 FALHDTSHALQWRKVRQIGVGNFSDVYLYESVNQTATHLQKVAVKHVKYPEALVQSSSPK 242
           F  H T     +  VR +G G +  V L +  + +  +    A+K +K  E L+   S +
Sbjct: 114 FDKHGTRTLEDFAPVRVLGRGAYGKVLLVKDSHTSRLY----AMKQLKKAEILIHDGSSE 169

Query: 243 XXXXXXXXXXXXXXXXXXXXALSGIWHPCIIHL-HAINDLTFLNSPRPLSSRDLTRGLPP 301
                                LS + HP I+ L ++ +D   L                 
Sbjct: 170 EGQPDSNLEKRLERTFAERTILSQLEHPNIVKLFYSFHDHHKLY---------------- 213

Query: 302 CDMIMSYCAGGDLF-ELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIK 360
             +I+ +  GG+LF  L  Q TL E  +    AE++  +++LH+  +V+RDLK EN L+ 
Sbjct: 214 --LILQFIPGGELFYHLKEQGTLDEDTVAFYAAEISCALRFLHKRGVVYRDLKPENCLL- 270

Query: 361 FPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDE----------------MCTTRC- 403
                     ++R      H+V L DFGL +    D+                +CT    
Sbjct: 271 ----------DER-----GHLV-LTDFGLSKVSASDDSADGGDVNTNGHEGESVCTLHSI 314

Query: 404 -GSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPF 443
            G+ +Y +PEIL G PY  +  D +++G +++ +L  + P+
Sbjct: 315 IGTPEYCAPEILEGKPYT-QNCDWYSLGCLIFDMLIGKPPY 354

>Scas_598.6
          Length = 790

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 76/155 (49%), Gaps = 30/155 (19%)

Query: 304 MIMSYCAGGDLFEL--------ASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLE 355
           ++M +  GG L ++        +S + L E  +  I  E   G+K+LH+  I+HRD+K +
Sbjct: 586 VVMEFMEGGSLTDIIENSPATGSSSSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSD 645

Query: 356 NVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRI-EPDEMCTTRCGSEDYVSPEIL 414
           NV                 LL +   V++ DFG C ++ +      T  G+  +++PE++
Sbjct: 646 NV-----------------LLDNNARVKITDFGFCAKLTDQRSKRATMVGTPYWMAPEVV 688

Query: 415 MGVPYDGRLSDSWAMGVILYALLEDRLPF---DPL 446
               YD ++ D W++G++   +LE   P+   DPL
Sbjct: 689 KQREYDEKV-DVWSLGIMTIEMLESEPPYLNEDPL 722

>KLLA0F02838g 264329..266596 some similarities with sp|P32581
           Saccharomyces cerevisiae YJL106w IME2 ser/thr protein
           kinase, hypothetical start
          Length = 755

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 57/109 (52%)

Query: 328 LRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADF 387
           LR I  ++  G+K++H++   HRD+K EN+LI            + +   D ++V+LAD+
Sbjct: 169 LRSILFQILAGIKHIHDHDFFHRDIKPENILISPSHRYFSKKWLEDDNYSDNYVVKLADY 228

Query: 388 GLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYAL 436
           GL R +      TT   +  Y SPEIL+   Y  +  D WA G ++  L
Sbjct: 229 GLARHVNNRSPYTTYVSTRWYRSPEILLRKGYYSKPLDIWAYGCVVVEL 277

>Kwal_56.22693
          Length = 984

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 68/151 (45%), Gaps = 30/151 (19%)

Query: 304 MIMSYCAGGDLFELASQ-NTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
            ++ Y   GD   +  +  +L +       A++   + YLH   IVHRD+K EN+     
Sbjct: 234 FLLEYAPNGDFLSVIKKFGSLSQECAVYYSAQILDAIDYLHHKGIVHRDIKPENI----- 288

Query: 363 LDDILAMHEQRELLLDQHI-VELADFGLCRRIEPDEMCTT---------RCGSEDYVSPE 412
                        LLD+ + V+L DFG  R +E DE   T           G+ +YVSPE
Sbjct: 289 -------------LLDKDMKVKLTDFGTARILEKDETTQTFNLLERSKSFVGTAEYVSPE 335

Query: 413 ILMGVPYDGRLSDSWAMGVILYALLEDRLPF 443
           +L     D +  D WA G IL+ ++  + PF
Sbjct: 336 LLNDNYVDYKC-DIWAFGCILFQMIAGKPPF 365

>YBR028C (YBR028C) [220] chr2 complement(294387..295964)
           Serine/threonine protein kinase with similarity to
           Ypk2p/Ykr2p and Ypk1p [1578 bp, 525 aa]
          Length = 525

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 73/300 (24%), Positives = 120/300 (40%), Gaps = 71/300 (23%)

Query: 169 QHIIEPEAQETLTGFALHDTSHALQWRKVRQIGVGNFSDVYLYESVNQTATHLQKVAVKH 228
           Q II     E      LHD      ++ VR +G G +  V L + VN +  +    A+K 
Sbjct: 109 QDIISSNIGENELSRNLHD------FKPVRVLGQGAYGKVLLVKDVNTSKLY----AMKQ 158

Query: 229 VKYPEALVQSSSPKXXXXXXXXXXXXXXXXXXXXA------------LSGIWHPCIIHL- 275
           ++  E L+  ++                      +            LS I HP I+ L 
Sbjct: 159 LRKAEILISQTATDSKREDEDKNDGNNNDNDDGLSKRLERTFAERSILSEIEHPNIVKLF 218

Query: 276 HAINDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLF-ELASQNTLPEWLLRRIFAE 334
           ++ +D + L                   +++ Y  GG+LF  L    TL E  +    AE
Sbjct: 219 YSFHDNSKLY------------------LLLQYIPGGELFYHLKEHGTLDETTVSFYAAE 260

Query: 335 LTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIE 394
           ++  +++LH   +V+RDLK EN L+            QR      H+V L DFGL ++  
Sbjct: 261 ISCALRFLHTKGVVYRDLKPENCLL-----------NQR-----GHLV-LTDFGLSKKSA 303

Query: 395 PDEMCTTR-----------CGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPF 443
            D                  G+ +Y +PEIL+G  Y  +  D +++G +LY +L  + P+
Sbjct: 304 NDSAVDEEDPENVNALYSIIGTPEYCAPEILLGKAY-SQNCDWYSLGCLLYDMLVGKPPY 362

>CAGL0K06479g 636296..639271 some similarities with tr|Q03306
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 991

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 97/224 (43%), Gaps = 29/224 (12%)

Query: 304 MIMSYCAGGDLFELASQ-NTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIK-- 360
            ++ Y +GG+L  L  +  T  +   +   A+L   ++++H   ++HRDLK ENVL+   
Sbjct: 90  FVLDYASGGELLSLLHKMGTFTDSWAKHFAAQLVDTLEFMHARGVIHRDLKPENVLLSKE 149

Query: 361 --FPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRC----GSEDYVSPEIL 414
               + D  A   Q       +    A+ G+ +   P     T C    G+ +YVSPE+L
Sbjct: 150 GILMITDFGAAATQNNFSDKDNTRSNANEGIPKDDVPSSGDKTECSSFVGTAEYVSPELL 209

Query: 415 MGVPYD--GRLSDSWAMGVILYALLEDRLPFDPLPTAAPGKRQRRSSTAHRISRFEWRWI 472
           +   Y+     SD WA+G ++Y  ++   PF         + +    T  +I   ++ W 
Sbjct: 210 L---YNKCSFGSDIWALGCMVYQFIQGFPPF---------RGENELKTFEKIVSLDYSWN 257

Query: 473 KMAESEYPAKEIVENCLTRKNI------RCNIEKIYENPYVNEV 510
              ++ +    I    L R+ +      R  I++I  +P+   V
Sbjct: 258 PERQTNFGTINIQVVNLVRRMLTIDTTQRATIDQIKRDPWFANV 301

>Kwal_33.13681
          Length = 715

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 73/140 (52%), Gaps = 25/140 (17%)

Query: 304 MIMSYCAGGDL-----FELASQNT-LPEWLLRRIFAELTLGVKYLHENL-IVHRDLKLEN 356
           ++  YC  GDL      ++ S+NT L +W + +I  EL+L ++++H++  I H DLK  N
Sbjct: 457 VMTEYCENGDLDTFLKKQIISKNTRLEDWRIWKIIVELSLALRFVHDSCQIAHLDLKPAN 516

Query: 357 VLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMG 416
           VLI F                 +  ++LADFG+  ++          G  +Y++PEI+  
Sbjct: 517 VLITF-----------------EGNLKLADFGMAAKLPVGHTGIENEGDREYIAPEIISE 559

Query: 417 VPYDGRLSDSWAMGVILYAL 436
             YD R +D +++G+++  +
Sbjct: 560 CVYDFR-ADIFSLGLMIVEI 578

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 80/176 (45%), Gaps = 32/176 (18%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWLLRRI-----FAELTLGVKYLHENLIVHRDLKLENVL 358
            ++ YCA GDL++      + E    RI       +L   + Y H   + HRD+K ENVL
Sbjct: 86  FVLEYCAYGDLYDFI--KAIRERPTMRINFHSFLFQLCSAISYCHSKDVSHRDIKPENVL 143

Query: 359 IKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRC-GSEDYVSPEILMGV 417
           +                  D+  V+L DFGL    +   +    C G+E Y++PE  +  
Sbjct: 144 MD-----------------DRGQVKLTDFGLS---QIGSVSKDYCIGTEKYLAPETFLRE 183

Query: 418 PYDGRLSDSWAMGVILYALLEDRLPFDPLPTAAPGKRQRRSSTAHRISRFEWRWIK 473
            ++   +D W++G+ ++ L+    PF+   + AP    +RS+   R  R   R+++
Sbjct: 184 YHNTFATDYWSLGITIFCLMFGSCPFESASSDAP----KRSANFQRFIRDPHRFVE 235

>Kwal_33.14192
          Length = 577

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 67/145 (46%), Gaps = 23/145 (15%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPL 363
           ++M YC   D F L   + + +  +   F ++  GV YLH   + HRDLKL+N ++    
Sbjct: 297 VVMEYCPY-DFFNLVMSDLMSKNEISCYFKQICNGVDYLHRMGLAHRDLKLDNCVV---- 351

Query: 364 DDILAMHEQRELLLDQHIVELADFGLCRRIE-PDEMCTTRC----GSEDYVSPEILMGVP 418
                          Q I++L DFG     + P E    R     GS+ Y++PE+L    
Sbjct: 352 -------------TKQGILKLIDFGSAVVFQYPYEKEILRAKGIVGSDPYLAPELLSHPS 398

Query: 419 YDGRLSDSWAMGVILYALLEDRLPF 443
           YD R  D W++ ++ Y +   R P+
Sbjct: 399 YDPRPVDVWSIAIMFYCITLKRFPW 423

>Kwal_23.3471
          Length = 260

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/157 (33%), Positives = 76/157 (48%), Gaps = 29/157 (18%)

Query: 291 SSRDLTRGLPPCDMIMSYCAGGDLFELASQNTLPEWLLRRIFAELTL-GVKYLHENLIVH 349
           S+ +L     P D+ M       LF   +Q  +  WLL      +TL GV + H N I+H
Sbjct: 29  SNLNLVLEFLPADLEMIIKDNSILF---TQADIKSWLL------MTLRGVHHCHRNFILH 79

Query: 350 RDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRI-EPDEMCTTRCGSEDY 408
           RDLK  N+L        LA   Q         ++LADFGL R +  P +M T+   +  Y
Sbjct: 80  RDLKPNNLL--------LAPDGQ---------LKLADFGLARNMGSPQDMLTSNVVTRWY 122

Query: 409 VSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPFDP 445
            +PE+L G  +     D W++GVI +A L  R+P+ P
Sbjct: 123 RAPELLFGAKHYTGAIDMWSVGVI-FAELMLRIPYLP 158

>YAR018C (KIN3) [73] chr1 complement(170393..171700)
           Serine/threonine protein kinase [1308 bp, 435 aa]
          Length = 435

 Score = 62.8 bits (151), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 83/189 (43%), Gaps = 50/189 (26%)

Query: 304 MIMSYCAGGDLFEL-----ASQNTLPEWLLRRIFAELTLGVKYLH--------------- 343
           + M YC+ GDL ++          +PE ++  I A+L   +   H               
Sbjct: 101 LYMEYCSRGDLSQMIKHYKQEHKYIPEKIVWGILAQLLTALYKCHYGVELPTLTTIYDRM 160

Query: 344 ------ENLIVHRDLKLENVLIKFP-----LDDILAMHEQRE-----------------L 375
                 +N+++HRDLK  N+ + +      +++ +  HE+                   +
Sbjct: 161 KPPVKGKNIVIHRDLKPGNIFLSYDDSDYNINEQVDGHEEVNSNYYRDHRVNSGKRGSPM 220

Query: 376 LLDQHIVELADFGLCRRIEPD-EMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILY 434
              Q +V+L DFGL + +E   +  TT  G+  Y+SPE+LM  PY   LSD W++G +++
Sbjct: 221 DYSQVVVKLGDFGLAKSLETSIQFATTYVGTPYYMSPEVLMDQPYSP-LSDIWSLGCVIF 279

Query: 435 ALLEDRLPF 443
            +     PF
Sbjct: 280 EMCSLHPPF 288

>Scas_675.2
          Length = 527

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 73/148 (49%), Gaps = 25/148 (16%)

Query: 304 MIMSYCAGGDLFELASQNT-LPEWLLRRIFAELTLGVKYLHENL-IVHRDLKLENVLIKF 361
           MIM    GGDLF+    +  +   + +  F +L   + YLHE   + HRD+K EN+L   
Sbjct: 93  MIMEMADGGDLFDKIEPDVGVDSEVAQFYFQQLVRAISYLHEECGVAHRDIKPENIL--- 149

Query: 362 PLDDILAMHEQRELLLDQH-IVELADFGLC----RRIEPDEMCTTRCGSEDYVSPEILMG 416
                          LD++  ++LADFGL     R+     + T + GS  Y++PEIL  
Sbjct: 150 ---------------LDKNGNLKLADFGLSSQYRRKDGTLRISTDQRGSPPYMAPEILHS 194

Query: 417 VPYDGRLSDSWAMGVILYALLEDRLPFD 444
             Y    +D W++G++L+ LL    P++
Sbjct: 195 RGYYAHSTDIWSIGILLFVLLTGETPWE 222

>YNL020C (ARK1) [4567] chr14 complement(595621..597537)
           Serine/threonine protein kinase associated with cortical
           actin cytoskeleton [1917 bp, 638 aa]
          Length = 638

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 78/159 (49%), Gaps = 36/159 (22%)

Query: 304 MIMSYCAGGDLFELAS---QNTLPEWLLRRIFAELTLGVKYLH--ENLIVHRDLKLENVL 358
           ++M YC  G L +  +   QN L E+ + +I +++T GV  +H  +  ++HRD+K+ENVL
Sbjct: 107 VLMEYCERGGLIDFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVL 166

Query: 359 IKFPLDDILAMHEQRELLLDQHIVELADFG-LCRRIEPD---------EMCTTRCGSEDY 408
           I        A +E +          L DFG +C  I P          +    +  +  Y
Sbjct: 167 IS-------ANNEYK----------LCDFGSVCGIIRPPRNSQELSYVQQDILKNTTAQY 209

Query: 409 VSPEIL---MGVPYDGRLSDSWAMGVILYALLEDRLPFD 444
            SPE++    G+P D + SD WA+G+ LY L     PF+
Sbjct: 210 RSPEMIDTFRGLPIDEK-SDIWALGIFLYKLCYYTTPFE 247

>Sklu_1722.2 YJL187C, Contig c1722 1158-3587 reverse complement
          Length = 809

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 73/137 (53%), Gaps = 25/137 (18%)

Query: 304 MIMSYCAGGDLF-----ELASQNT-LPEWLLRRIFAELTLGVKYLHENL-IVHRDLKLEN 356
           ++  YC  G L      ++ ++NT L +W + +I  EL+L ++++H++  +VH DLK  N
Sbjct: 554 VMTEYCENGSLDGFLREQVIAKNTRLEDWRVWKIIVELSLALRFIHDSCRVVHLDLKPAN 613

Query: 357 VLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMG 416
           VLI F                 +  ++LADFG+  ++   E      G  +Y++PEI+  
Sbjct: 614 VLITF-----------------EGTLKLADFGMAAKLPISEEGFENEGDREYIAPEIIAD 656

Query: 417 VPYDGRLSDSWAMGVIL 433
             YD R +D +++G+++
Sbjct: 657 GVYDFR-ADIFSLGLMI 672

>KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces
           cerevisiae YNL183c NPR1 ser/thr protein kinase, start by
           similarity
          Length = 774

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 65/144 (45%), Gaps = 23/144 (15%)

Query: 305 IMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLD 364
           +M YC   DLF +   N +    +   F ++  GV+YLH   + HRD+KL+N +I     
Sbjct: 501 VMEYC-DYDLFAIVMSNKMSYEEICCCFKQILTGVEYLHSIGLAHRDMKLDNCVIN---- 555

Query: 365 DILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCT-----TRCGSEDYVSPEILMGVPY 419
                        +Q IV+L DFG           T        GS+ Y++PE+ +   Y
Sbjct: 556 -------------NQGIVKLIDFGAAEVFSYPHSKTLIESSGIVGSDPYLAPEVCIFTKY 602

Query: 420 DGRLSDSWAMGVILYALLEDRLPF 443
           D R  D W++ ++   ++  + P+
Sbjct: 603 DPRPVDIWSVAILFACMVLKKFPW 626

>Scas_720.94
          Length = 1683

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 65/312 (20%), Positives = 115/312 (36%), Gaps = 80/312 (25%)

Query: 164  HHVGSQHIIEPEAQETLTGFALHDTSHALQWRKVRQIGVGNFSDVYLYESVNQTATHLQK 223
            H +G       +  + L+  A   ++ +++W+K   IG G F  VY   +VN     +  
Sbjct: 1331 HQIGKVLDDTDKGNKYLSSLASSISNLSIRWQKRNFIGGGTFGTVY--SAVNLDNGEI-- 1386

Query: 224  VAVKHVKYPEALVQSSSPKXXXXXXXXXXXXXXXXXXXXALSGIWHPCIIHLHAINDLTF 283
            +AVK +K     +Q S                        L  + HP I+  + +     
Sbjct: 1387 LAVKEIK-----IQDSK--------TMKKIFPLVKEEMTVLEMLNHPNIVQYYGVE---- 1429

Query: 284  LNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFELASQNTLPEWLLRRIFA-ELTLGVKYL 342
                     RD        ++ M YC GG +  L     + + ++ +++  EL  G+ YL
Sbjct: 1430 -------VHRD------KVNIFMEYCEGGSMASLLEHGRIEDEMVTQVYTLELLEGLAYL 1476

Query: 343  HENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTR 402
            H+  +VHRD+K EN+L+ F                   I++  DFG  R+I  +    T 
Sbjct: 1477 HQAGVVHRDIKPENILLDF-----------------NGIIKYVDFGAARKIAKNGTKVTN 1519

Query: 403  CGSED--------------------------YVSPEILMGVPYDGRLS--DSWAMGVILY 434
              S+                           Y++PE + G     +    D W+ G ++ 
Sbjct: 1520 INSKSKDDDEPDEKDTEGGANSVHDMLGTPMYMAPESITGYKNKTKFGSDDIWSFGCVVL 1579

Query: 435  ALLEDRLPFDPL 446
             ++  R P+  L
Sbjct: 1580 EMITGRRPWANL 1591

>KLLA0B07579g 659591..661759 weakly similar to sp|P32944
           Saccharomyces cerevisiae YJL187c SWE1 ser/tyr
           dual-specifity protein kinase, start by similarity
          Length = 722

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 72/140 (51%), Gaps = 25/140 (17%)

Query: 304 MIMSYCAGGDL------FELASQNTLPEWLLRRIFAELTLGVKYLHENL-IVHRDLKLEN 356
           ++  +C  G+L        +A Q  L +W + +I  E+ L ++++H++  IVH DLK  N
Sbjct: 477 IMTEFCENGNLDAFIQEHVIAKQQRLEDWRIWKIIVEICLALRFIHDSCSIVHLDLKPAN 536

Query: 357 VLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEILMG 416
           VLI F                 +  ++LADFG+  ++  ++      G  +Y++PEI+  
Sbjct: 537 VLITF-----------------EGNLKLADFGMATKLPIEDKSFENEGDREYIAPEIIRD 579

Query: 417 VPYDGRLSDSWAMGVILYAL 436
             YD R +D +++G+++  +
Sbjct: 580 GIYDFR-ADIFSLGLMMIEI 598

>Scas_718.90
          Length = 647

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 67/145 (46%), Gaps = 23/145 (15%)

Query: 304 MIMSYCAGGDLFELASQNTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPL 363
           ++M Y A  D F L   + +    +   F +L  GV YLH+  I HRDLKL+N ++    
Sbjct: 390 VVMEY-APYDFFNLVMADLMTTKEVSCYFKQLCNGVNYLHDMGIAHRDLKLDNCVVSH-- 446

Query: 364 DDILAMHEQRELLLDQHIVELADFGLCRRIE-PDEMCTTRC----GSEDYVSPEILMGVP 418
                            I++L DFG     + P E    +     GS+ Y++PE+L    
Sbjct: 447 ---------------NGILKLIDFGSAVIFQYPYENKIVKAQGIVGSDPYLAPELLNTST 491

Query: 419 YDGRLSDSWAMGVILYALLEDRLPF 443
           YD R  D W++ +I Y ++  R P+
Sbjct: 492 YDPRPVDVWSIAIIYYCMILRRFPW 516

>CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces
           cerevisiae YGR052w, hypothetical start
          Length = 355

 Score = 61.6 bits (148), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 67/150 (44%), Gaps = 29/150 (19%)

Query: 304 MIMSYCAGGDLF---ELASQN------TLPEWLLRRIFAELTLGVKYLHENLIVHRDLKL 354
           ++  YC  GD +   EL+ +       ++ +   +++  +L+  +KY H   I HRD+K 
Sbjct: 83  LVQEYCECGDFYDFLELSKKKGDLNAPSIIKLNFQKVVLQLSYAIKYAHSMGIAHRDIKP 142

Query: 355 ENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEIL 414
           EN+LI +  D                 ++LAD+G    I          G+++Y  PE  
Sbjct: 143 ENILINYHGD-----------------IKLADWG--HAISASSSNDNNIGTDNYRGPETF 183

Query: 415 MG-VPYDGRLSDSWAMGVILYALLEDRLPF 443
              V Y+   SD W+MGV L  LL    PF
Sbjct: 184 SAKVSYNTYRSDYWSMGVTLLYLLFSHCPF 213

>ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C
           (MKK2) - SH] complement(557738..559312) [1575 bp, 524
           aa]
          Length = 524

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 62/126 (49%), Gaps = 19/126 (15%)

Query: 325 EWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFPLDDILAMHEQRELLLDQHIVEL 384
           E +L +I   +  G+ YLH+  I+HRD+K +N+L+                  +   V+L
Sbjct: 338 EKVLGKIAESVLRGLSYLHQRKIIHRDIKPQNILLN-----------------EAGQVKL 380

Query: 385 ADFGLCRRIEPDEMCTTRCGSEDYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPFD 444
            DFG+      + + TT  G+  Y++PE + G PY    SD W++G+ L  + +   PFD
Sbjct: 381 CDFGVSGEAV-NSLATTFTGTSYYMAPERIQGQPYS-VTSDVWSLGLTLLEVAQAHFPFD 438

Query: 445 PLPTAA 450
               AA
Sbjct: 439 SGKFAA 444

>AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH]
           (1043479..1044750) [1272 bp, 423 aa]
          Length = 423

 Score = 61.6 bits (148), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 56/212 (26%), Positives = 92/212 (43%), Gaps = 43/212 (20%)

Query: 264 LSGIWHPCIIHLHAINDLTFLNSPRPLSSRDLTRGLPPCDMIMSYCAGGDLFEL-----A 318
           L+G+ H  I+  +  +      S R  +S D   G     + M YC+ GDL ++      
Sbjct: 78  LAGLRHENIVEFYNWDH----ASSRTGNSVDYGNG-EVLYLYMEYCSCGDLSQMIKHYKG 132

Query: 319 SQNTLPEWLLRRIFAELTLGVKYLHENL--------------------------IVHRDL 352
            +  +PE  + RI  +L L +   H +                           ++HRDL
Sbjct: 133 MRKYVPERDIWRIAVQLLLALYKCHTSCDLPQLDTIYDKISKSAIESEAGKVTSVIHRDL 192

Query: 353 KLENVLIKFPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPD-EMCTTRCGSEDYVSP 411
           K  N+ +         +  +  +   +  V+L DFGL + ++   E  TT  G+  Y+SP
Sbjct: 193 KPGNIFLTGD-----GVGGRGSVDYSKVEVKLGDFGLAKSLQSAIEFATTYVGTPYYMSP 247

Query: 412 EILMGVPYDGRLSDSWAMGVILYALLEDRLPF 443
           E+LM  PY   LSD W++G ++Y L   R+PF
Sbjct: 248 EVLMDQPYSP-LSDIWSLGCVIYELCALRVPF 278

>Scas_671.16
          Length = 723

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 75/159 (47%), Gaps = 36/159 (22%)

Query: 304 MIMSYCAGGDLFELAS---QNTLPEWLLRRIFAELTLGVKYLH--ENLIVHRDLKLENVL 358
           ++M YC GG L +  +   QN L E  +  I ++   GV  +H  +  ++HRD+K+ENVL
Sbjct: 107 LLMEYCKGGGLIDFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVL 166

Query: 359 IKFPLDDILAMHEQRELLLDQHIVELADFG-LCRRI----EPDEMC-----TTRCGSEDY 408
           I        A  E           ++ DFG +C  I     P E+        +  +  Y
Sbjct: 167 IS-------AKGE----------FKICDFGSVCSYIRPPRNPQELAYVQHDVLKNTTAQY 209

Query: 409 VSPEIL---MGVPYDGRLSDSWAMGVILYALLEDRLPFD 444
            +PE+L    G+P + + SD WA+GV LY L     PF+
Sbjct: 210 RAPEMLDLYRGLPINEK-SDIWALGVFLYKLCYYTTPFE 247

>Kwal_26.7276
          Length = 646

 Score = 62.0 bits (149), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 67/139 (48%), Gaps = 17/139 (12%)

Query: 305 IMSYCAGGDLFELASQN-----TLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLI 359
           I+  C   +L++L         +LP   L+ I  +L  G++++H +   HRDLK EN+LI
Sbjct: 159 IVMECMEQNLYQLMRARRKRVFSLPS--LKSILTQLITGIRHIHSHNFFHRDLKPENILI 216

Query: 360 K-----FPLDDILAMHEQRELLLDQHIVELADFGLCRRIEPDEMCTTRCGSEDYVSPEIL 414
                 F  D IL  +       D ++V++AD+GL R +      T    +  Y SPEIL
Sbjct: 217 SPSNHYFSKDWILNGNYS-----DNYVVKIADYGLARHVTNKSPYTAYVSTRWYRSPEIL 271

Query: 415 MGVPYDGRLSDSWAMGVIL 433
           +      R  D WA G ++
Sbjct: 272 LRKGSYSRPLDIWAFGCVV 290

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 61/227 (26%), Positives = 98/227 (43%), Gaps = 53/227 (23%)

Query: 304 MIMSYCAGGDLFELASQ-NTLPEWLLRRIFAELTLGVKYLHENLIVHRDLKLENVLIKFP 362
            ++ Y   GD   L  +  +L E   R   +++   V  LH   I+HRD+K EN+     
Sbjct: 201 FLLEYAPHGDFLGLIKKYGSLNETCARYYASQIIDAVDSLHNIGIIHRDIKPENI----- 255

Query: 363 LDDILAMHEQRELLLDQHI-VELADFGLCRRIEPDEMCTTR---------------CGSE 406
                        LLD+++ V+L DFG   +I P+E   T                 G+ 
Sbjct: 256 -------------LLDKNMKVKLTDFGTA-KILPEEPSNTADGKPYFDLYAKSKSFVGTA 301

Query: 407 DYVSPEILMGVPYDGRLSDSWAMGVILYALLEDRLPFDPLPTAAPGKRQRRSSTAHRISR 466
           +YVSPE+L     D R  D WA G ILY +L  + PF         K      T  ++ +
Sbjct: 302 EYVSPELLNDNYTDSRC-DIWAFGCILYQMLAGKPPF---------KAANEYLTFQKVMK 351

Query: 467 FEWRWIKMAESEYP--AKEIVENCLTRK-NIRCNIEKIYENPYVNEV 510
            ++ +     + +P   K++V+  L R  N R  I++I  + + +EV
Sbjct: 352 IQYAFT----AGFPQIVKDLVKKLLVRDPNDRLTIKQIKAHLFFHEV 394

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,688,895
Number of extensions: 623586
Number of successful extensions: 2902
Number of sequences better than 10.0: 622
Number of HSP's gapped: 2160
Number of HSP's successfully gapped: 657
Length of query: 511
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 405
Effective length of database: 12,926,601
Effective search space: 5235273405
Effective search space used: 5235273405
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)