Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.765574371735230.0
Sklu_2430.996668114020.0
YMR102C83469712461e-160
Scas_721.12885165510731e-134
ABL024W73459410401e-131
CAGL0K03377g97853710241e-126
KLLA0B12804g85267510001e-123
YKL121W8525989791e-120
Scas_717.689084649291e-112
CAGL0K11638g5926295391e-59
KLLA0E23529g8262162062e-16
AEL246C8152182017e-16
Sklu_2431.127492211873e-14
CAGL0M05335g8062331713e-12
Kwal_27.120537552241695e-12
Scas_721.328222321695e-12
Kwal_23.64297503051623e-11
YBR198C (TAF5)7982071597e-11
AGL234W6292941571e-10
YCR084C (TUP1)7132931482e-09
Scas_629.126712151463e-09
CAGL0E00561g8362961436e-09
KLLA0F10263g6822961401e-08
Sklu_2318.17112881401e-08
CAGL0H08932g902721401e-08
Scas_624.1112051181383e-08
KLLA0B01958g890601331e-07
YDL145C (COP1)12011181331e-07
ADL082C5692651302e-07
YGL137W (SEC27)889721293e-07
Scas_630.66212161274e-07
ADR077C12041181276e-07
CAGL0M04279g9401711266e-07
Kwal_56.2452612101181268e-07
Scas_704.40608801258e-07
AFL118W8322071259e-07
KLLA0F04884g1212591251e-06
Sklu_2160.37602011231e-06
KLLA0F27511g6231061194e-06
CAGL0C03608g6432421194e-06
CAGL0I03718g1201591194e-06
CAGL0L00781g6731071185e-06
Scas_713.509831781178e-06
YLR129W (DIP2)9431811178e-06
YIL046W (MET30)640801169e-06
AGL196C9351731123e-05
Kwal_23.5769627801113e-05
AER114W633911114e-05
Scas_720.83d915901105e-05
Kwal_23.53514742621061e-04
Kwal_23.50357441161062e-04
KLLA0E12287g3261961032e-04
Scas_720.95515571024e-04
KLLA0E11297g5121371015e-04
Kwal_23.6240913731016e-04
YCR057C (PWP2)923731016e-04
YOR212W (STE4)4232451007e-04
YCR072C51556998e-04
CAGL0E02805g840196990.001
KLLA0D02530g707144980.001
Kwal_23.632451459980.001
CAGL0K09284g91175980.002
Sklu_2173.251556960.002
Scas_512.3534176960.002
CAGL0M08646g337189950.002
Scas_719.5262862960.002
Kwal_27.12586509162950.002
Kwal_27.11585823144960.003
Sklu_2382.2126179950.003
Sklu_1926.5509131940.003
AEL269C455163940.004
YBL008W (HIR1)840191940.004
YLR429W (CRN1)65162940.004
Kwal_55.21559351176930.004
KLLA0C08976g91175940.004
ADR090W123394940.004
YKL213C (DOA1)715187930.005
CAGL0M02277g427163920.005
KLLA0D04840g303205910.005
Scas_605.18424262920.006
AFR199C334101910.006
KLLA0D16390g936172930.006
Scas_660.851084920.006
CAGL0J03476g51757920.007
Kwal_26.773650786920.007
Sklu_1963.2314261900.008
KLLA0C08547g51556910.008
Scas_658.1442213910.009
CAGL0L02629g79574910.009
AER263C51356910.009
Kwal_56.23920937172910.010
Kwal_0.212303198890.010
CAGL0G04345g711100900.012
Kwal_56.24478129687900.012
KLLA0E04741g45975890.013
Scas_707.22730111890.015
CAGL0D02090g277201870.015
Scas_442.2*795210880.019
KLLA0E21263g429110870.022
CAGL0J04818g65462880.022
Scas_603.5589165870.024
CAGL0D05588g47779870.024
KLLA0F05159g123192880.025
Kwal_33.1513647379870.026
KLLA0A04928g861166870.027
Scas_720.4575526870.029
AAL157C47979860.030
Sklu_2442.2303205850.030
CAGL0K12188g53535860.030
CAGL0B01529g36977860.030
YDR267C330184850.032
YGL003C (CDH1)56689860.034
Kwal_56.2389536764850.035
AAR057W92275860.036
Scas_721.115*318110850.036
Scas_592.4*318110850.037
Kwal_56.24163729169860.038
Scas_711.1169570860.039
ACR091W32890840.044
Scas_700.27*433174850.045
Scas_659.947577840.050
YLL011W (SOF1)48977840.052
KLLA0E24508g327159830.054
Sklu_1880.347175830.066
Scas_601.238939830.073
KLLA0F15598g47878830.076
KLLA0B02827g94272830.088
AER448W714271830.091
CAGL0G09845g500185820.093
AGL190W37061820.094
CAGL0C01441g1005184820.11
Sklu_2406.11426174810.11
Scas_718.6*54676820.11
YMR116C (ASC1)319182810.11
KLLA0E03982g37267810.12
Scas_571.460157810.15
YFL009W (CDC4)77974810.15
YPL151C (PRP46)45169800.17
AGR168W825237800.17
AGL024W75676800.18
Kwal_55.2145050379800.18
CAGL0M06193g316246790.18
Scas_702.16816267800.19
Scas_631.1747475790.19
YJL112W (MDV1)71433800.20
AER255C467193790.21
YDR142C (PEX7)37565780.26
YGR200C (ELP2)78865790.27
CAGL0H03729g303174770.30
Scas_581.362655780.31
ACR166W388100770.32
AAR102C591110780.34
Kwal_14.884395109770.38
AAL009C303165750.51
KLLA0E21879g33391750.52
Kwal_33.13515398127750.55
CAGL0C02937g46763750.58
Scas_695.15327161750.59
ADL322C50182750.60
Scas_615.1134988750.63
YNL035C38947750.64
YNL006W (LST8)303201740.73
ABL044C51857750.74
YBR175W (SWD3)31599730.83
KLLA0F13772g52082740.87
Sklu_2435.1357575740.89
YDR364C (CDC40)45543740.90
Kwal_26.7570218108720.93
YMR093W (UTP15)51378740.94
YGL190C (CDC55)526203740.96
AEL314W71558740.98
ACR097W467176731.0
YLR409C (UTP21)93992741.1
CAGL0C00737g81692731.1
Sklu_2420.2441173731.1
ACR137W425159721.3
Scas_675.1887638731.4
Kwal_27.12239316143711.5
Kwal_23.411893972721.6
ACL116W804114721.8
Scas_692.2548844711.9
Scas_595.3*555139712.1
Sklu_1710.124085702.1
CAGL0M09845g93672712.3
ADL218C40341702.5
KLLA0B11077g567110702.6
Kwal_33.15591714104702.7
KLLA0E05181g132561702.8
KLLA0F11231g43445702.8
Sklu_2317.336865692.8
KLLA0F06754g344124693.0
YAR003W (SWD1)42657693.1
Scas_627.9500203693.1
KLLA0D07546g64728693.6
AFL007C55175694.0
Kwal_27.1155040747684.1
YDR030C (RAD28)50639684.2
KLLA0F08811g636129684.2
CAGL0M08624g33755684.4
CAGL0L06952g347103674.8
Scas_712.3439927675.4
YBR097W (VPS15)1454164685.5
AGR180W80682676.4
Sklu_2423.194478677.3
Scas_693.3637560668.1
Kwal_26.8628422140658.6
KLLA0F09053g452200659.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.7655
         (732 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.7655                                                         1361   0.0  
Sklu_2430.9 YMR102C, Contig c2430 15497-18397                         544   0.0  
YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protei...   484   e-160
Scas_721.128                                                          417   e-134
ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH] com...   405   e-131
CAGL0K03377g complement(306529..309465) similar to sp|Q03177 Sac...   399   e-126
KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177 Saccha...   389   e-123
YKL121W (YKL121W) [3144] chr11 (213788..216346) Protein containi...   381   e-120
Scas_717.68                                                           362   e-112
CAGL0K11638g complement(1123343..1125121) weakly similar to sp|Q...   212   1e-59
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    84   2e-16
AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH] (172849..1...    82   7e-16
Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement      77   3e-14
CAGL0M05335g complement(569132..571552) similar to sp|P38129 Sac...    70   3e-12
Kwal_27.12053                                                          70   5e-12
Scas_721.32                                                            70   5e-12
Kwal_23.6429                                                           67   3e-11
YBR198C (TAF5) [381] chr2 complement(616084..618480) Component o...    66   7e-11
AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH] complement(...    65   1e-10
YCR084C (TUP1) [608] chr3 complement(260307..262448) General rep...    62   2e-09
Scas_629.12                                                            61   3e-09
CAGL0E00561g 49750..52260 some similarities with sp|P16649 Sacch...    60   6e-09
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    59   1e-08
Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement          59   1e-08
CAGL0H08932g join(871668..871685,872089..874779) highly similar ...    59   1e-08
Scas_624.11                                                            58   3e-08
KLLA0B01958g join(170646..170663,170896..173550) similar to sp|P...    56   1e-07
YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer (C...    56   1e-07
ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH] (538948..5...    55   2e-07
YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741) Coat...    54   3e-07
Scas_630.6                                                             54   4e-07
ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH] (843171..84...    54   6e-07
CAGL0M04279g 469040..471862 highly similar to sp|Q12220 Saccharo...    53   6e-07
Kwal_56.24526                                                          53   8e-07
Scas_704.40                                                            53   8e-07
AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH] complement...    53   9e-07
KLLA0F04884g complement(478044..481682) similar to sp|P53622 Sac...    53   1e-06
Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement         52   1e-06
KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces...    50   4e-06
CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces c...    50   4e-06
CAGL0I03718g complement(317565..321170) highly similar to sp|P53...    50   4e-06
CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces cer...    50   5e-06
Scas_713.50                                                            50   8e-06
YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 sno...    50   8e-06
YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that ...    49   9e-06
AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH] (328838..33...    48   3e-05
Kwal_23.5769                                                           47   3e-05
AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH] complement(...    47   4e-05
Scas_720.83d                                                           47   5e-05
Kwal_23.5351                                                           45   1e-04
Kwal_23.5035                                                           45   2e-04
KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to ...    44   2e-04
Scas_720.95                                                            44   4e-04
KLLA0E11297g complement(994770..996308) similar to sp|P38262 Sac...    44   5e-04
Kwal_23.6240                                                           44   6e-04
YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential p...    44   6e-04
YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the...    43   7e-04
YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein ...    43   8e-04
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    43   0.001
KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777....    42   0.001
Kwal_23.6324                                                           42   0.001
CAGL0K09284g 914937..917672 highly similar to sp|P25635 Saccharo...    42   0.002
Sklu_2173.2 YCR072C, Contig c2173 2732-4279                            42   0.002
Scas_512.3                                                             42   0.002
CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces c...    41   0.002
Scas_719.52                                                            42   0.002
Kwal_27.12586                                                          41   0.002
Kwal_27.11585                                                          42   0.003
Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement         41   0.003
Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement         41   0.003
AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH] (134760..13...    41   0.004
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    41   0.004
YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-bind...    41   0.004
Kwal_55.21559                                                          40   0.004
KLLA0C08976g 784536..787271 highly similar to sgd|S0000653 Sacch...    41   0.004
ADR090W [1831] [Homologous to ScYDL195W (SEC31) - SH] complement...    41   0.004
YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein req...    40   0.005
CAGL0M02277g complement(271836..273119) highly similar to sp|Q12...    40   0.005
KLLA0D04840g 413362..414273 highly similar to sp|P41318 Saccharo...    40   0.005
Scas_605.18                                                            40   0.006
AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH] (799876..80...    40   0.006
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    40   0.006
Scas_660.8                                                             40   0.006
CAGL0J03476g 331933..333486 highly similar to sp|P25382 Saccharo...    40   0.007
Kwal_26.7736                                                           40   0.007
Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement         39   0.008
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...    40   0.008
Scas_658.1                                                             40   0.009
CAGL0L02629g complement(307323..309710) similar to sp|P07834 Sac...    40   0.009
AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)...    40   0.009
Kwal_56.23920                                                          40   0.010
Kwal_0.212                                                             39   0.010
CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces c...    39   0.012
Kwal_56.24478                                                          39   0.012
KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces c...    39   0.013
Scas_707.22                                                            39   0.015
CAGL0D02090g join(214357..214893,215564..215860) highly similar ...    38   0.015
Scas_442.2*                                                            39   0.019
KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces...    38   0.022
CAGL0J04818g 455846..457810 highly similar to sp|Q06440 Saccharo...    39   0.022
Scas_603.5                                                             38   0.024
CAGL0D05588g 533235..534668 highly similar to sp|P33750 Saccharo...    38   0.024
KLLA0F05159g 506007..509702 similar to sp|P38968 Saccharomyces c...    39   0.025
Kwal_33.15136                                                          38   0.026
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    38   0.027
Scas_720.45                                                            38   0.029
AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516...    38   0.030
Sklu_2442.2 YNL006W, Contig c2442 3831-4742                            37   0.030
CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces...    38   0.030
CAGL0B01529g 137174..138283 highly similar to sp|P39108 Saccharo...    38   0.030
YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Prote...    37   0.032
YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of...    38   0.034
Kwal_56.23895                                                          37   0.035
AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH] complement(4...    38   0.036
Scas_721.115*                                                          37   0.036
Scas_592.4*                                                            37   0.037
Kwal_56.24163                                                          38   0.038
Scas_711.11                                                            38   0.039
ACR091W [1138] [Homologous to ScYDR267C - SH] complement(520609....    37   0.044
Scas_700.27*                                                           37   0.045
Scas_659.9                                                             37   0.050
YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component o...    37   0.052
KLLA0E24508g complement(2175775..2176758) similar to sp|P38123 S...    37   0.054
Sklu_1880.3 YDR364C, Contig c1880 4293-5708                            37   0.066
Scas_601.2                                                             37   0.073
KLLA0F15598g 1439610..1441046 highly similar to sp|P33750 Saccha...    37   0.076
KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces c...    37   0.088
AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH] complement(...    37   0.091
CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces c...    36   0.093
AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH] complement(...    36   0.094
CAGL0C01441g complement(156930..159947) similar to tr|Q08924 Sac...    36   0.11 
Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement      36   0.11 
Scas_718.6*                                                            36   0.11 
YMR116C (ASC1) [4073] chr13 complement(499455..499877,500151..50...    36   0.11 
KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces c...    36   0.12 
Scas_571.4                                                             36   0.15 
YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and co...    36   0.15 
YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative...    35   0.17 
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    35   0.17 
AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -...    35   0.18 
Kwal_55.21450                                                          35   0.18 
CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces c...    35   0.18 
Scas_702.16                                                            35   0.19 
Scas_631.17                                                            35   0.19 
YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in...    35   0.20 
AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH] (1107932.....    35   0.21 
YDR142C (PEX7) [987] chr4 complement(740467..741594) Peroxisomal...    35   0.26 
YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa sub...    35   0.27 
CAGL0H03729g 342948..343859 highly similar to sp|P41318 Saccharo...    34   0.30 
Scas_581.3                                                             35   0.31 
ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH] complement...    34   0.32 
AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH] (526057..527...    35   0.34 
Kwal_14.884                                                            34   0.38 
AAL009C [178] [Homologous to ScYNL006W (LST8) - SH] (325785..326...    33   0.51 
KLLA0E21879g complement(1944865..1945866) similar to sgd|S000267...    33   0.52 
Kwal_33.13515                                                          33   0.55 
CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces c...    33   0.58 
Scas_695.15                                                            33   0.59 
ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH] (128830..13...    33   0.60 
Scas_615.11                                                            33   0.63 
YNL035C (YNL035C) [4552] chr14 complement(568520..569689) Protei...    33   0.64 
YNL006W (LST8) [4579] chr14 (620066..620977) Protein required fo...    33   0.73 
ABL044C [548] [Homologous to ScYMR093W - SH] (312378..313934) [1...    33   0.74 
YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and...    33   0.83 
KLLA0F13772g 1276532..1278094 highly similar to sp|Q04305 Saccha...    33   0.87 
Sklu_2435.13 YPR137W, Contig c2435 18346-20073                         33   0.89 
YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein...    33   0.90 
Kwal_26.7570                                                           32   0.93 
YMR093W (UTP15) [4051] chr13 (454014..455555) Protein component ...    33   0.94 
YGL190C (CDC55) [1803] chr7 complement(145813..147393) Protein s...    33   0.96 
AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C (...    33   0.98 
ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH] complement(...    33   1.0  
YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member o...    33   1.1  
CAGL0C00737g complement(75028..77478) similar to tr|Q05946 Sacch...    33   1.1  
Sklu_2420.2 YPL151C, Contig c2420 3924-5249                            33   1.1  
ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH] complement...    32   1.3  
Scas_675.18                                                            33   1.4  
Kwal_27.12239                                                          32   1.5  
Kwal_23.4118                                                           32   1.6  
ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH] complement(1...    32   1.8  
Scas_692.25                                                            32   1.9  
Scas_595.3*                                                            32   2.1  
Sklu_1710.1 YDR267C, Contig c1710 17-739                               32   2.1  
CAGL0M09845g 975007..977817 highly similar to sp|Q06078 Saccharo...    32   2.3  
ADL218C [1523] [Homologous to ScYNL035C - SH] (319676..320887) [...    32   2.5  
KLLA0B11077g complement(970761..972464) similar to sgd|S0006341 ...    32   2.6  
Kwal_33.15591                                                          32   2.7  
KLLA0E05181g 460483..464460 highly similar to sp|Q06706 Saccharo...    32   2.8  
KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417 S...    32   2.8  
Sklu_2317.3 YDR142C, Contig c2317 5804-6910                            31   2.8  
KLLA0F06754g complement(650475..651509) similar to sp|P53011 Sac...    31   3.0  
YAR003W (SWD1) [68] chr1 (155009..156289) Component of SET1 and ...    31   3.1  
Scas_627.9                                                             31   3.1  
KLLA0D07546g complement(647984..649927) some similarities with s...    31   3.6  
AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH] (424004..42...    31   4.0  
Kwal_27.11550                                                          31   4.1  
YDR030C (RAD28) [881] chr4 complement(501749..503269) Protein in...    31   4.2  
KLLA0F08811g complement(819834..821744) some similarities with s...    31   4.2  
CAGL0M08624g complement(859796..860809) highly similar to sp|P04...    31   4.4  
CAGL0L06952g complement(780793..781836) highly similar to sp|P40...    30   4.8  
Scas_712.34                                                            30   5.4  
YBR097W (VPS15) [288] chr2 (436908..441272) Serine/threonine pro...    31   5.5  
AGR180W [4491] [Homologous to ScYLR222C - SH] complement(1090647...    30   6.4  
Sklu_2423.1 YLR409C, Contig c2423 869-3703                             30   7.3  
Scas_693.36                                                            30   8.1  
Kwal_26.8628                                                           30   8.6  
KLLA0F09053g 842591..843949 similar to sp|Q00362 Saccharomyces c...    30   9.1  

>Kwal_26.7655
          Length = 743

 Score = 1361 bits (3523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 661/717 (92%), Positives = 661/717 (92%)

Query: 1   MQFGKPDLELACSSSENLSLEKPLSEHSMDDFSESSQSNGGEMEVTIRKSTDASNLEAIT 60
           MQFGKPDLELACSSSENLSLEKPLSEHSMDDFSESSQSNGGEMEVTIRKSTDASNLEAIT
Sbjct: 1   MQFGKPDLELACSSSENLSLEKPLSEHSMDDFSESSQSNGGEMEVTIRKSTDASNLEAIT 60

Query: 61  TPMAPVSFATTKPSINVQDFSEKPRNAKQGKKEREQAHSRLNDHIDLTLNNVFGRINREQ 120
           TPMAPVSFATTKPSINVQDFSEKPRNAKQGKKEREQAHSRLNDHIDLTLNNVFGRINREQ
Sbjct: 61  TPMAPVSFATTKPSINVQDFSEKPRNAKQGKKEREQAHSRLNDHIDLTLNNVFGRINREQ 120

Query: 121 FHQYLKEPKYLKVFNRQPRVKQFRRLFLAQELRLHASDXXXXXXXXXXXXXENSDRAVWA 180
           FHQYLKEPKYLKVFNRQPRVKQFRRLFLAQELRLHASD             ENSDRAVWA
Sbjct: 121 FHQYLKEPKYLKVFNRQPRVKQFRRLFLAQELRLHASDLTSSSSTTLSTLSENSDRAVWA 180

Query: 181 TKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVGRSV 240
           TKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVGRSV
Sbjct: 181 TKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVGRSV 240

Query: 241 KEEPEQPIGPASMDLYAPVFHPLPFRIYQEHTQDILDLDWSKNGFILTTSMDKTARLWHC 300
           KEEPEQPIGPASMDLYAPVFHPLPFRIYQEHTQDILDLDWSKNGFILTTSMDKTARLWHC
Sbjct: 241 KEEPEQPIGPASMDLYAPVFHPLPFRIYQEHTQDILDLDWSKNGFILTTSMDKTARLWHC 300

Query: 301 DRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAI 360
           DRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAI
Sbjct: 301 DRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAI 360

Query: 361 DTSPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVLEKPNGTTKKVPESGPKITGIEFFK 420
           DTSPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVLEKPNGTTKKVPESGPKITGIEFFK
Sbjct: 361 DTSPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVLEKPNGTTKKVPESGPKITGIEFFK 420

Query: 421 SAPDNDLRIMVTSNDSRIRIFRIKGQSLLEVLKGFENTHSQISAHLILPPSKKIFVLAPS 480
           SAPDNDLRIMVTSNDSRIRIFRIKGQSLLEVLKGFENTHSQISAHLILPPSKKIFVLAPS
Sbjct: 421 SAPDNDLRIMVTSNDSRIRIFRIKGQSLLEVLKGFENTHSQISAHLILPPSKKIFVLAPS 480

Query: 481 ENQWVYCWRVESSAGVSNSDDSQNNGTHRRGSIRGLLQRSLSIGSSQSPERQEYKNGXXX 540
           ENQWVYCWRVESSAGVSNSDDSQNNGTHRRGSIRGLLQRSLSIGSSQSPERQEYKNG   
Sbjct: 481 ENQWVYCWRVESSAGVSNSDDSQNNGTHRRGSIRGLLQRSLSIGSSQSPERQEYKNGSHS 540

Query: 541 XXXXXXXXTAKSKGDQYIKNQHYIAFHAHRCXXXXXXXXXXXXXXXLALSDDFICELTMA 600
                   TAKSKGDQYIKNQHYIAFHAHRC               LALSDDFICELTMA
Sbjct: 541 HSLHLPSPTAKSKGDQYIKNQHYIAFHAHRCTVTTTAVAPVNTNKTLALSDDFICELTMA 600

Query: 601 LSETDEDVAFLKQQRRKSLIHSKKGSQKDRDLMERRFPSMIDAIGTIVVSTDNSGIIRVF 660
           LSETDEDVAFLKQQRRKSLIHSKKGSQKDRDLMERRFPSMIDAIGTIVVSTDNSGIIRVF
Sbjct: 601 LSETDEDVAFLKQQRRKSLIHSKKGSQKDRDLMERRFPSMIDAIGTIVVSTDNSGIIRVF 660

Query: 661 RSDISTNVRKKVLKCLKEXXXXXXXXXXXXXXXXXVHASLLGSTVKAATSTFVKSRN 717
           RSDISTNVRKKVLKCLKE                 VHASLLGSTVKAATSTFVKSRN
Sbjct: 661 RSDISTNVRKKVLKCLKESSTPPMSGSSSDSNGPNVHASLLGSTVKAATSTFVKSRN 717

>Sklu_2430.9 YMR102C, Contig c2430 15497-18397
          Length = 966

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/681 (44%), Positives = 400/681 (58%), Gaps = 77/681 (11%)

Query: 112 VFGRINREQFHQYLKEPKYLKVFNRQPRVKQFRRLFLAQELRL----------------- 154
             G INR+QF QYLKEP+Y+KVF ++  +KQFRR FLAQEL++                 
Sbjct: 198 TLGSINRKQFEQYLKEPEYIKVFKKRKGLKQFRRFFLAQELKIGTSPVNSNVGTNNVDGI 257

Query: 155 -----HASDXXXXXXXXXXXXXENSDRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPL 209
                 AS               ++ ++VW+ KFS+DG+++ATGGKD  LR+WKVIASP 
Sbjct: 258 PHVASSASIATLSSSSPTGSSSSSAGKSVWSMKFSKDGRFLATGGKDRILRIWKVIASPT 317

Query: 210 ERNDLSSATAKP-------QAKRISMR--VPPSPTVGRSVKEEPEQP-------IGPASM 253
           ER +L S+T KP         K IS    VP S        + PE             S+
Sbjct: 318 ERLELDSSTMKPSKTVCMLNGKLISYSRDVPQSGFARTENGDNPEDDSLDTNGMFPDESL 377

Query: 254 DLYAPVFHPLPFRIYQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFTHPD 313
           +LYAPVFHPLP+R +  H QDILD+DWSKN F+LT SMDKT +LWHCDR + LK F HPD
Sbjct: 378 NLYAPVFHPLPYRSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPD 437

Query: 314 FVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTSPRDGKYTAAG 373
           FVTC KFHPNDDRFFISGCLDH  RLWSILD+ VSF++ CGD+IT+++ SP D KYT  G
Sbjct: 438 FVTCVKFHPNDDRFFISGCLDHKARLWSILDDEVSFEFDCGDLITSLEVSPGDSKYTILG 497

Query: 374 TFNGHIIILYTRGLEMVSTFHVLEKPNG-----TTKKVPES------GPKITGIEFFKSA 422
           TFNG++I+L TRGLE V +FH+ +K +      TT+ +P S      GPK+TGIE F++ 
Sbjct: 498 TFNGYVIVLLTRGLEHVYSFHLSDKQDKKGKDVTTRDLPTSRTNTHHGPKVTGIECFRAV 557

Query: 423 PDNDLRIMVTSNDSRIRIFRIKGQSLLEVLKGFENTHSQISAHLIL-PPSKKIFVLAPSE 481
            D  L+++VTSNDS+IR+F +K   L EVLKGFEN  SQISAHLI    +K+ FV+APSE
Sbjct: 558 NDMTLKLLVTSNDSKIRVFNLKDNILQEVLKGFENESSQISAHLITGSKNKQQFVIAPSE 617

Query: 482 NQWVYCWRVESSAGVSNSDDSQNNGTH---RRGSIRGLLQRSLSIGSSQSPERQEY-KNG 537
           + W+YCW+++SS    + D     G +   R GS+RGLL R LSIGS+ S   + + K+ 
Sbjct: 618 DHWIYCWKLQSSLMTKDKDKEHAAGKNSLPRSGSLRGLLHRKLSIGSNHSDSNRSFSKSQ 677

Query: 538 XXXXXXXXXXXTAKSKGDQYIKNQHYIAFHAHRCXXXXXXXXXXXXXXXLALSDDFICEL 597
                         S+ +Q++KN  YIAFHAH                 L+LS+DFICEL
Sbjct: 678 KSHYHHLHLPHPHHSRENQHLKNNEYIAFHAHHHPLTTAIAAPPETARTLSLSNDFICEL 737

Query: 598 TMALSETDEDVAFLKQQRRKS---------LIHSKKGSQKDRDLME--RRFPSMIDAIGT 646
           TM   E  +DV  +    +K          +         D D+    RR P++ + IG 
Sbjct: 738 TMEFCEDYDDVRIVNTYNKKQKQKKKKDADIAQEDDACDNDGDVGTNPRRIPTVDEFIGA 797

Query: 647 IVVSTDNSGIIRVFRSDISTNVRKKVLKCLKEXXXXXXXXXXXXXX----------XXXV 696
           I+V++D++G+IRVFRSDISTN+RK+VL  L+E                           V
Sbjct: 798 ILVTSDDNGVIRVFRSDISTNIRKRVLAKLQEEDVKDATDKKNRNSVSISEVNDEIASAV 857

Query: 697 HA--SLLGSTVKAATSTFVKS 715
           HA  +L  +TVKAAT+ F KS
Sbjct: 858 HALGNLTTNTVKAATAGFNKS 878

>YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protein
           containing six WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to S. cerevisiae Ykl121p, which binds
           phosphatidylinositol [2505 bp, 834 aa]
          Length = 834

 Score =  484 bits (1246), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 288/697 (41%), Positives = 403/697 (57%), Gaps = 64/697 (9%)

Query: 31  DFSESSQSNGGEMEV-TIRKSTDAS------------NLEAITTPMAPVSFATTKPSINV 77
           +FS SS + G E E  + ++S D              NLE  +  + P+ F  TK + N 
Sbjct: 17  EFSNSSNTTGSEEESRSHQESFDGESSSGESKSKSKLNLE-YSADIEPLKFRMTKTN-NT 74

Query: 78  QDFSEKPRNAKQGK-----KEREQAHSRLNDHIDLTLNNVFGRINREQFHQYLKEPKYLK 132
            D  +   N          KE  Q  + LN ++ +     F  I+ EQF  YL+EPKY+K
Sbjct: 75  NDKLKYSNNGNATDSFMRLKEHLQRGNTLNSNLRVNEFYPFNSIDTEQFENYLREPKYIK 134

Query: 133 VFNRQPRVKQFRRLFLAQELRLHASDXXXXXXXXXXXXXENSDRAVWATKFSRDGKYMAT 192
           +  R+  +KQFRRLFLAQEL  +  +             E + +A+W+TKFSRDGK+MAT
Sbjct: 135 MLKRRKNLKQFRRLFLAQELMAYEGETVTSTSKSS----EPTSKAIWSTKFSRDGKFMAT 190

Query: 193 GGKDCTLRVWKVIASPLERNDL-SSATAKPQAKRISMRVPPSPTVGRSVKEEPEQPIGPA 251
           G KD  +R+WKVI SP+ER +L SSA +  +A+  SMR+    +   + KE+  Q +  A
Sbjct: 191 GSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQVSSLNNPKEK--QFLDSA 248

Query: 252 S---------MDLYAPVFHPLPFRIYQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDR 302
           +         ++LYAPVFHP P R+Y+EH QD+LD++WSKN FIL+ SMDKT +LWH DR
Sbjct: 249 TEKYEEKEKLLNLYAPVFHPTPLRLYKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDR 308

Query: 303 PKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDT 362
             +LK F HPDFVTC +FHP DDRFFISGCLDH  RLWSILD+ VSF+Y C D+IT++  
Sbjct: 309 KNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQDLITSVTL 368

Query: 363 SPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVLEKPNG----------TTKKVPESGPK 412
           SP +GKYT  GTFNG++ IL TRGL  VS+FHV ++             T  K+   GP+
Sbjct: 369 SPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDSKI-RHGPR 427

Query: 413 ITGIEFFKSAPDNDLRIMVTSNDSRIRIFRIKGQSLLEVLKGFENTHSQISAHLILPPSK 472
           +TG++ F+S  DN  R++VTSNDSRIRIF ++ + LLEVLKGF +  SQ  A L +   +
Sbjct: 428 VTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQLSIWHGQ 487

Query: 473 KIFVLAPSENQWVYCWRVESSAGVSNSDDSQN--NGTHRRGSIRGLLQRSLSIGSSQSPE 530
            I V+  S++ WVY WR++SS   ++ D+ +    G  R GS+R +  +S+S  SSQ+ E
Sbjct: 488 PI-VVNSSDDHWVYGWRLKSSDRENDQDEPKRKPKGLARSGSLRSIFSKSMSRSSSQNNE 546

Query: 531 RQEYKNGXXXXXXXXXXXTAKSKGDQYIKNQHYIAFHAHRCXXXXXXXXXXXXXXXLALS 590
            + + +                  D YIKN  YI+FHAH                 L+LS
Sbjct: 547 EKPHHH----LKLTNLLPLPHHSNDHYIKNTDYISFHAHNAPVTCVSIAPPETSKTLSLS 602

Query: 591 DDFICELTMALSETDEDVAFLKQQRRKSLI---------HSKKGSQKDRDLMERRFPSMI 641
           +D ICEL++   +T +    L +     ++         +SK GS  +        P ++
Sbjct: 603 NDVICELSLEFFQTSDSFDVLSRSNDDGIMSDVESSLGYNSKPGSISNASATS-AIPDVV 661

Query: 642 DAIGTIVVSTDNSGIIRVFRSDISTNVRKKVLKCLKE 678
           DAIGTI++STDN G IRVFR+D+ + +RK+VL  L+E
Sbjct: 662 DAIGTILISTDNVGTIRVFRADMPSVIRKRVLLKLEE 698

>Scas_721.128
          Length = 851

 Score =  417 bits (1073), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 253/655 (38%), Positives = 354/655 (54%), Gaps = 47/655 (7%)

Query: 55  NLEAITTPMAPVSFATTKPSINVQDFSEKPRNAKQGKKERE---QAHSRLNDHIDLTLNN 111
           NLE  +  + P+ F  T+      D  E P + K    + +   +  +RL    D + N 
Sbjct: 54  NLE-YSADLQPLKFKMTR----TPDLEEVPSHVKTASADVDSFYKVRNRLQKIADPSWN- 107

Query: 112 VFGRINREQFHQYLKEPKYLKVFNRQPRVKQFRRLFLAQELRLHASDXXXXXXXXXXXXX 171
            F  I++EQF  YLKEP+Y+KVF +   +++F+RLFLAQEL +  +              
Sbjct: 108 -FSSIDQEQFEIYLKEPEYIKVFKKHEDLEEFKRLFLAQELNVTTT----KENDPTAQNT 162

Query: 172 ENSDRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSAT-AKPQAKRISMRV 230
           + S++A+W  KFS DGKYMATG KD  + +WKVI+SP+ER +L  A  +   A   S+R+
Sbjct: 163 DASNKAIWTLKFSHDGKYMATGSKDGCVMLWKVISSPVERWELDRAEESNLVAMAKSIRI 222

Query: 231 PPSPTVGRSVKEEPEQP---IGPASMDLYAPVFHPLPFRIYQEHTQDILDLDWSKNGFIL 287
             +     +    P +P       S++LYAP+FHP P RIY+EH+ DILDLDWSKN F+L
Sbjct: 223 KQNLETNEAHLNAPSRPPTDTNLESLNLYAPIFHPNPVRIYKEHSHDILDLDWSKNNFLL 282

Query: 288 TTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSV 347
           T SMDK   LWH DR  +LK F HPDFVT  +FHP DDRFF+SGCLDH  R+WSIL+N V
Sbjct: 283 TASMDKLVSLWHPDRETSLKSFPHPDFVTSVRFHPKDDRFFVSGCLDHKCRMWSILENKV 342

Query: 348 SFDYYCGDIITAIDTSPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVLEK------PNG 401
            +++ C D+ITAI  SP  G++T  GTFNG+I IL T  L+ + TFHVL+K       N 
Sbjct: 343 VYEFDCQDLITAISISPGVGEFTIIGTFNGYITILSTFELKPLYTFHVLDKHMQGNSGND 402

Query: 402 TTKK-------VPESGPKITGIEFFKSAPDNDLRIMVTSNDSRIRIFRIKGQSLLEVLKG 454
           ++ K           GP++TG++ F     +DL+++V+S DSRIRIF ++   L+EV KG
Sbjct: 403 SSFKNLLGQNLKNHHGPRVTGLQLFLEKETDDLKLLVSSTDSRIRIFDLEKNKLIEVFKG 462

Query: 455 FENTHSQISAHLILPPSKKIFVLAPSENQWVYCWRVESSAGVSNSDDSQNNGTHR--RGS 512
           F +  SQ +A L     + I V+  S++ W Y W++ +    SN   +QN  + R  R S
Sbjct: 463 FRSGLSQHNAQLSNWGDQPI-VINSSKDHWFYAWKINT----SNPKTTQNFSSIRQERLS 517

Query: 513 IRGLLQRSLSIGSSQSPERQEYKNGXXXXXXXXXXXTAKS------KGDQYIKNQHYIAF 566
             G L   L+  S +     E                  S           +KN HY+AF
Sbjct: 518 TGGGLNDLLNKSSEKKETTHELSRTSTAGDSSTRHHFLPSLSRLLPHSSHVVKNSHYVAF 577

Query: 567 HAHRCXXXXXXXXXXXXXXXLALSDDFICELTMALSETDEDVA---FLKQQRRKSLIHSK 623
           HAH                 L+LS+DFICELT+ + E               R S+   K
Sbjct: 578 HAHHAPVSTATIAPQETAKTLSLSNDFICELTLQVMEDIRKTTTGSSDSSNGRSSVDKKK 637

Query: 624 KGSQKDRDLMERRFPSMIDAIGTIVVSTDNSGIIRVFRSDISTNVRKKVLKCLKE 678
             S+K    +    P  ++AIG I+V+TD  G IRVFR D+S   R +VLK L++
Sbjct: 638 NASEKSLPTVTSGIPDAVNAIGPILVTTDTRGTIRVFRVDMSNATRSRVLKKLQD 692

>ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH]
           complement(353684..355888) [2205 bp, 734 aa]
          Length = 734

 Score =  405 bits (1040), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 238/594 (40%), Positives = 326/594 (54%), Gaps = 63/594 (10%)

Query: 123 QYLKEPKYLKVFNRQPRVKQFRRLFLAQELR------LHASDXXXXXXXXXXXXXENSDR 176
           ++  EP+Y+KV  R+   + FRRLF+AQEL+      LHA+               +  R
Sbjct: 53  RFAAEPEYIKVLARKKGARCFRRLFVAQELQPPVDSPLHANHSSQSLGQAAPAG--DKAR 110

Query: 177 AVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATA--KPQAKRISM------ 228
           +VW  +FS+DGKY+A+GGK   L VWKVIASP+ER +L       K  +  +S+      
Sbjct: 111 SVWLLRFSKDGKYLASGGKGRQLCVWKVIASPMERWNLLPVYGGDKHHSNTLSLLNQQLL 170

Query: 229 -----RVPPSPTVGRSVKEEPEQPIGPASMDL---YAPVFHPLPFRIYQEHTQDILDLDW 280
                R    P  G   KE P         DL   YAPVFHP P R++ EH QDILD DW
Sbjct: 171 KYSGKRTEAVPAPGPERKEIP--------FDLEQQYAPVFHPDPHRVFGEHLQDILDCDW 222

Query: 281 SKNGFILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLW 340
           SKN F+LT SMDKT +LWH +R  +LK F HPDFVTC +FHP+DDRFF SGCLDHT+R W
Sbjct: 223 SKNSFLLTASMDKTVKLWHINRTTSLKTFVHPDFVTCVRFHPHDDRFFFSGCLDHTVRTW 282

Query: 341 SILDNSVSFDYYCGDIITAIDTSPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVLEKPN 400
           SIL+  V+  + CGD+I A+D SP DG +   GTFNG++ +L+T GL+++ +FH+L+KPN
Sbjct: 283 SILEGEVAEAFNCGDLIMALDVSP-DGNWLLIGTFNGYVHVLHTNGLKLLHSFHLLQKPN 341

Query: 401 GTTKKVPESGPKITGIEFFKSAPDNDLRIMVTSNDSRIRIFRIKGQSLLEVLKGFENTHS 460
            T  + P  GPKITG+EF +      L +++TSNDSR+R+F +    LLE+ +GF N  S
Sbjct: 342 ETENR-PRHGPKITGVEFIRHKAYPWLGLLITSNDSRVRLFDMSTTRLLEIFRGFSNESS 400

Query: 461 QISAHLILPPSKKIFVLAPSENQWVYCWRVESSAGVSNSDDSQNNGT---------HRRG 511
           +ISAH +     +  VL+ SEN W+Y W +     + +  D  N  T          ++ 
Sbjct: 401 RISAHHLEMEDGESVVLSASENHWLYTWMLHHEEYMYSHSDLDNARTVPSPIDGKDPKKH 460

Query: 512 SIRGLLQRSLSIGSSQSPERQEYKNGXXXXXXXXXXXTAKSKGDQYIKNQHYIAFHAHRC 571
           SIR + +RS+S  S    E     N             A+ KG   +KN  YI FHAH  
Sbjct: 461 SIRNIFRRSISFNSDILSE----SNPVARHHFPLFHHKAQHKGG-CVKNSEYITFHAHHN 515

Query: 572 XXXXXXXXXXXXXXXLALSDDFICELTMALSETDEDVAFLKQQRRKSLIHSKKGSQKDRD 631
                          L+LSDD ICEL M           L+  R KS+   + GS   R 
Sbjct: 516 PVTAATIAPKETTHVLSLSDDIICELNMKFGGEA-----LEHLRTKSI--REPGSPAGRS 568

Query: 632 LMERRFPSMIDA--------IGTIVVSTDNSGIIRVFRSDISTNVRKKVLKCLK 677
             +R   +  +         +GTI+VS   +G IRVFR+D+S++VR K L+ ++
Sbjct: 569 DHKRNHSAEKNYSQSTAKQNVGTIIVSAAATGQIRVFRTDVSSSVRAKALEAIR 622

>CAGL0K03377g complement(306529..309465) similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 978

 Score =  399 bits (1024), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 217/537 (40%), Positives = 321/537 (59%), Gaps = 50/537 (9%)

Query: 176 RAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPT 235
           +A+W+TKFS DGKYMATG +D  LR+WKV+++P+ER  L S+                 T
Sbjct: 305 KAIWSTKFSIDGKYMATGSRDGVLRLWKVLSTPVERWGLDSSIDSAHL-----------T 353

Query: 236 VGRSVKEEPEQ-------PIGPASM---------------DLYAPVFHPLPFRIYQEHTQ 273
             +S++ +  Q       P+G  +M               +LYAPVF P P R Y+EH  
Sbjct: 354 SAKSLRLQQNQHGSSHGGPLGSPAMRRDTFDNIDAKENSSNLYAPVFQPTPVRTYKEHLH 413

Query: 274 DILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCL 333
           D+LD+DWSKN F+++ SMDKTA+LWH  + ++LK F HPDFVTC KFHP DDRFFISGCL
Sbjct: 414 DVLDMDWSKNNFLISASMDKTAKLWHPSKMRSLKSFQHPDFVTCVKFHPTDDRFFISGCL 473

Query: 334 DHTLRLWSILDNSVSFDYYCGDIITAIDTSPRDGKYTAAGTFNGHIIILYTRGLEMVSTF 393
           D   RLWSILD+ VSF++ C D++T++  +P DG YT  GTFNG+I +L T+GLE +++F
Sbjct: 474 DQKCRLWSILDDEVSFEFNCRDLVTSLTLTPGDGTYTIVGTFNGYIHVLQTKGLEHITSF 533

Query: 394 HVLEK-----------PNGTTKKVPESGPKITGIEFFKSAPDNDLRIMVTSNDSRIRIFR 442
           HV  K           P+  +K     GP++TG++ F S  DN LR++VTS+DSRIR+F 
Sbjct: 534 HVTAKKTHENTHEVLCPSNDSKV--RHGPRVTGLQCFNSLIDNSLRLVVTSSDSRIRVFD 591

Query: 443 IKGQSLLEVLKGFENTHSQISAHLILPPSKKIFVLAPSENQWVYCWRVESSAGVSNSDDS 502
           +  + L+E+L+GF+   SQ  A + +  ++ I V+  S++ WVY WR++SS  V  +  +
Sbjct: 592 LTRRKLIEILRGFQCGSSQHKAQISVYRNQPI-VINSSDDHWVYGWRLKSSDPVEINKKA 650

Query: 503 QNNGTHRRGSIRGLLQRSLSIGSSQSPE-RQEYKNGXXXXXXXXXXXTAKSKGDQYIKNQ 561
           + +G  R GSIRGL  +S+S  SSQ  E RQ  +N            ++ S G   +KN 
Sbjct: 651 KKHGMSRSGSIRGLFSKSISRSSSQGSEDRQSLRNTLKLSSLLPIPHSSHSDG--VMKNS 708

Query: 562 HYIAFHAHRCXXXXXXXXXXXXXXXLALSDDFICELTMALSETDEDVAFLKQQRRKSLIH 621
            Y +FHAH                 L+LS+D ICEL++   E  ++V  +K +  +   H
Sbjct: 709 DYFSFHAHNAPVTTVTMAPEETSKTLSLSNDPICELSLEFFEPSDEVDIIKLKDTQKGGH 768

Query: 622 SKKGSQKDRDLMERRFPSMIDAIGTIVVSTDNSGIIRVFRSDISTNVRKKVLKCLKE 678
               + K         P+ ++ IG+I++STD++G+IRVFR+D+S ++R +VL+ L++
Sbjct: 769 DNIPATKTPVTTSLAKPTPVEVIGSILISTDSNGLIRVFRADMSKSIRARVLQKLQK 825

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (79%), Gaps = 1/44 (2%)

Query: 111 NVFGRINREQFHQYLKEPKYLKVFNRQPR-VKQFRRLFLAQELR 153
           N F  I+REQF  YLKEP+Y+++F ++ R  KQFRRLFLAQEL+
Sbjct: 186 NPFAFIDREQFETYLKEPRYIRIFKKRSRSSKQFRRLFLAQELK 229

>KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 852

 Score =  389 bits (1000), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 247/675 (36%), Positives = 334/675 (49%), Gaps = 127/675 (18%)

Query: 116 INREQFHQYLKEPKYLKVFNRQPRVKQFRRLFLAQELRLHAS---DXXXXXXXXXXXXXE 172
           +  E F ++LK  +++KV+ ++   KQFRRL LAQELR   +   D              
Sbjct: 64  VGNEDFKRHLKTGEHMKVYRKKKGFKQFRRLILAQELRPFGNEFQDSSSSNEKGTATEPM 123

Query: 173 NSDRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDL---------SSATAKPQ- 222
            +  AVW  +FS DGK+MAT GKD  LR+WKVI+SP ER +L         S+A A  Q 
Sbjct: 124 KNGGAVWCIRFSHDGKFMATAGKDEILRIWKVISSPAERLELNQHSISFLKSTANAISQL 183

Query: 223 ----------AKRISMRVPPSPTV------------GRSVKEEPEQPIG-------PASM 253
                         S+    S T             G S K  P++  G       P  +
Sbjct: 184 NGQLAQYGGDTDSASLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPYGL 243

Query: 254 -DLYAPVFHPLPFRIYQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFTHP 312
            D Y  VFHP P   + EHT DILD+DWSKN FILT SMDK+ +LWHC RP +LK F H 
Sbjct: 244 GDSYCGVFHPNPLVTFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARPTSLKTFVHS 303

Query: 313 DFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTSPRDGKYTAA 372
           DFVT  +FHP DDRFF+S CLD   RLWSIL+  V F+Y CGD+ITA+D S  DG YT  
Sbjct: 304 DFVTAVRFHPEDDRFFLSACLDQKCRLWSILEKQVIFEYDCGDLITAMDIS-YDGNYTIL 362

Query: 373 GTFNGHIIILYTRGLEMVSTFHVLEKPNG------TTKKV-------PESGPKITGIEFF 419
           GTFNG+I +L T+ LE++ +F+VL+K +       T++++        ++GPKITG+EF 
Sbjct: 363 GTFNGYIHVLITKSLELLFSFNVLDKDSELKKCHRTSRRLKKQSSDKAKNGPKITGLEFI 422

Query: 420 K--------SAPDNDLRIMVTSNDSRIRIFRIKGQSLLEVLKGFENTHSQISAHLILPPS 471
           +        S+ D     +V+SNDSRIRI+ +  Q  + V+KG  N HSQI+AH  +  S
Sbjct: 423 QKDARNYKISSKDVSDWFLVSSNDSRIRIYTLN-QEFVSVMKGHSNEHSQITAHSTVTRS 481

Query: 472 KKIFVLAPSENQWVYCWRVESSAGVSNSDDSQNNGTHRRGSIRGLLQRSLSIGSSQSPER 531
            K +V++ SE+ W+YCW++      S    S+++ + R  S           GS +S  R
Sbjct: 482 GKAYVVSGSEDHWIYCWKLSDEVVKSTETSSKDSKSTRSRS-----------GSLRSFCR 530

Query: 532 QEYKNGXXXXXXXXXXXTAKSKGDQYIKNQHYIAFHAHRCXXXXXXXXXXXXXXXLALSD 591
           +   +               +K  Q   N +YI FHAH                 L+LS+
Sbjct: 531 RRNNDSVASETLDAVLSRGYTKNHQVSSNSNYIGFHAHHHPITCATAVPMQVTKVLSLSN 590

Query: 592 DFICELTMALSETDEDVAF------LKQQRRKSLIHSKKGSQKD---------------- 629
           D ICELTM   ET +D          + ++  + I S  G + D                
Sbjct: 591 DLICELTMQFWETTDDFTMESASKNARAKKNGNAISSNDGQKTDCRRKISIDKTIPNVKG 650

Query: 630 ----------------------------RDLMERRFPSMIDAIGTIVVSTDNSGIIRVFR 661
                                               PS+I+ IG IVVS D +G+IRVFR
Sbjct: 651 KSGVSGAQSNNVPNIQISDGDNRTTNAVNGTTAANPPSLIEFIGGIVVSADTTGVIRVFR 710

Query: 662 SDISTNVRKKVLKCL 676
           SDIS+NVRKKVL  L
Sbjct: 711 SDISSNVRKKVLNRL 725

>YKL121W (YKL121W) [3144] chr11 (213788..216346) Protein containing
           three WD domains (WD-40 repeat), which may mediate
           protein-protein interactions, has moderate similarity to
           uncharacterized S. cerevisiae Ymr102p [2559 bp, 852 aa]
          Length = 852

 Score =  381 bits (979), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 221/598 (36%), Positives = 337/598 (56%), Gaps = 42/598 (7%)

Query: 113 FGRINREQFHQYLKEPKYLKVFNRQPRVKQFRRLFLAQELRLHASDXXXXXXXXXXXXXE 172
           F   +R+ F  YL+EP Y+K+F ++  ++QF R+FLAQEL++   D              
Sbjct: 110 FDLFDRKYFENYLEEPTYIKIFKKKEGLEQFDRMFLAQELKI--PDVYKSTTYQGEPAVA 167

Query: 173 NSD---RAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDL-----SSATAKPQAK 224
           NS+    ++    FS DGKYM  G KD +L +WKVI SP++R+++     S + ++  + 
Sbjct: 168 NSELFKNSICCCTFSHDGKYMVIGCKDGSLHLWKVINSPVKRSEMGRSEKSVSASRANSL 227

Query: 225 RISMRVPPSPTVGRSVKEEPEQPI----GPA-SMDLYAPVFHPLPFRIYQEHTQDILDLD 279
           +I   +    +   S+     +P     GP+  + LYAPVF+   FR++ EH  DILD +
Sbjct: 228 KIQRHLASISSHNGSISSNDLKPSDQFEGPSKQLHLYAPVFYSDVFRVFMEHALDILDAN 287

Query: 280 WSKNGFILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRL 339
           WSKNGF++T SMDKTA+LWH +R  +LK F HPDFVT A F PNDDRF I+GCLDH  RL
Sbjct: 288 WSKNGFLITASMDKTAKLWHPERKYSLKTFVHPDFVTSAIFFPNDDRFIITGCLDHRCRL 347

Query: 340 WSILDNSVSFDYYCGDIITAIDTSPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVLEKP 399
           WSILDN VS+ + C D+IT++  SP  G+YT  GTFNG+I +L T GL+ VS+FHV +K 
Sbjct: 348 WSILDNEVSYAFDCKDLITSLTLSPPGGEYTIIGTFNGYIYVLLTHGLKFVSSFHVSDKS 407

Query: 400 N-GTTKKV--PES-------GPKITGIEFFKSAPDNDLRIMVTSNDSRIRIFRIKGQSLL 449
             GTTK    P S       GP+ITG++ F S  D +LR++VT+NDS+I+IF +  +  L
Sbjct: 408 TQGTTKNSFHPSSEYGKVQHGPRITGLQCFFSKVDKNLRLIVTTNDSKIQIFDLNEKKPL 467

Query: 450 EVLKGFENTHSQISAHLILPPSKKIFVLAPSENQWVYCWRVESSAGVSNSDDSQNNGTHR 509
           E+ KGF++  S+     ++  ++ + V   S++ W Y W+++S    + S +      HR
Sbjct: 468 ELFKGFQSGSSRHRGQFLMMKNEPV-VFTGSDDHWFYTWKMQS---FNLSAEMNCTAPHR 523

Query: 510 RG------SIRGLLQRSLSIGSSQSPERQEYKNGXXXXXXXXXXXTA---KSKGDQYIKN 560
           +       S++GLL R +S  S+      E  N                 ++ G Q IKN
Sbjct: 524 KKRLSGSMSLKGLL-RIVSNKSTNDECLTETSNQSSSHTFTNSSKNVLQTQTVGSQAIKN 582

Query: 561 QHYIAFHAHRCXXXXXXXXXXXXXXXLALSDDFICELTMALSETDEDVAFLKQQRRKSLI 620
            HYI+FHAH                 L+LS+D I ELT   S+  +++     + +++  
Sbjct: 583 NHYISFHAHNSPVTCASIAPDVAIKNLSLSNDLIFELT---SQYFKEMGQNYSESKETCD 639

Query: 621 HSKKGSQKDRDLMERRFPSMIDAIGTIVVSTDNSGIIRVFRSDISTNVRKKVLKCLKE 678
           +       +         ++++ +GTI+++TD+ G+IRVFR+DI   +RKK+++   E
Sbjct: 640 NKPNHPVTETGGFSSNLSNVVNNVGTILITTDSQGLIRVFRTDILPEIRKKIIEKFHE 697

>Scas_717.68
          Length = 908

 Score =  362 bits (929), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 196/464 (42%), Positives = 278/464 (59%), Gaps = 36/464 (7%)

Query: 242 EEPEQPIGPAS-MDLYAPVFHPLPFRIYQEHTQDILDLDWSKNGFILTTSMDKTARLWHC 300
           E+ +Q I   + ++LYAPVF+P  F+I++EHT D+LDLDWSKN F++T+SMD+T +LWH 
Sbjct: 297 EKLDQKISSTNELNLYAPVFNPSCFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHL 356

Query: 301 DRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAI 360
           +R  +LK F H DFVTC +FHP DDRFFISGCLDH +RLWSIL+N ++F++ C D+IT++
Sbjct: 357 ERQTSLKTFQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENEITFEFDCQDLITSL 416

Query: 361 DTSPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVLEKP----NGTTKKVPESGPKITGI 416
             SP DGKYT  GTFNG++ +L T+GLE VS+FHV++K     N  + K+   GP++TG+
Sbjct: 417 TLSPGDGKYTIVGTFNGYVHVLLTKGLEQVSSFHVVDKNTQERNTASTKI-HHGPRVTGL 475

Query: 417 EFFKSAPDNDLRIMVTSNDSRIRIFRIKGQSLLEVLKGFENTHSQISAHLILPPSKKIFV 476
           E FK  PDN LRI+VTS+DSRIRIF ++ + LLE LKGF++  SQ  A L     +++ V
Sbjct: 476 ECFKYEPDNSLRIVVTSSDSRIRIFDLEKKKLLEYLKGFQSGASQHKACLATVKGQQV-V 534

Query: 477 LAPSENQWVYCWRVESSAGVSNSDDSQN-------------NGTH---RRGSIRGLLQRS 520
           L+ S++ WV+ W+++SS  ++ S+ + N             + +H   R GS R L  +S
Sbjct: 535 LSSSDDHWVHGWKLKSSTSLTESEKNNNIDQTAATTTTTKKSNSHSISRSGSFRSLFSKS 594

Query: 521 LSIGSSQSPERQEYKNGXXXXXXXXXXXTAKSKGDQYIKNQHYIAFHAHRCXXXXXXXXX 580
                  S +    +NG                G   IKN   I+FHAH           
Sbjct: 595 -------SKKDNIDENGKHSHLKLTSLIPHCHNGSTVIKNSDGISFHAHHAPVTTAIVAP 647

Query: 581 XXXXXXLALSDDFICELTMALSETDEDVAFLKQQRRKSLI---HSKKGSQKDRDLMERRF 637
                 L+LS+DFI EL+   +    D          S+     S K   +         
Sbjct: 648 SGTAKTLSLSNDFIYELSSEFAMESRDFEMNTNSDTHSVTTSGSSDKSKIRSHSSSATLV 707

Query: 638 P---SMIDAIGTIVVSTDNSGIIRVFRSDISTNVRKKVLKCLKE 678
           P   S +D IG+I+V+TDN+GIIRVFR+DIS+ +RKKVL  L++
Sbjct: 708 PPSISAVDLIGSIIVTTDNTGIIRVFRADISSTIRKKVLCTLQQ 751

 Score = 99.4 bits (246), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 49/130 (37%), Positives = 72/130 (55%), Gaps = 15/130 (11%)

Query: 112 VFGRINREQFHQYLKEPKYLKVFNRQPRVKQFRRLFLAQELRLHASDXXXXXXXXXXXXX 171
           +F  I+++QF +YL EP Y+K+  R+  +K FRRLFLAQEL+    +             
Sbjct: 97  LFNSIDQDQFEKYLMEPTYIKILKRRKNLKMFRRLFLAQELKAFDDENKINAFTNQINGL 156

Query: 172 EN---------------SDRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSS 216
           ++               +DRA+W TKFS DGK+MA+ GK   +RVWKV+ SP+ER +L S
Sbjct: 157 QSPPLTPTSSSSNLNALADRAIWITKFSLDGKFMASAGKSGIIRVWKVLNSPIERWELGS 216

Query: 217 ATAKPQAKRI 226
           +     A  +
Sbjct: 217 SVDSNNATLV 226

>CAGL0K11638g complement(1123343..1125121) weakly similar to
           sp|Q03177 Saccharomyces cerevisiae YMR102c, hypothetical
           start
          Length = 592

 Score =  212 bits (539), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 174/629 (27%), Positives = 264/629 (41%), Gaps = 152/629 (24%)

Query: 116 INREQFHQYLKEPKYLKVFNRQPR--VKQFRRLFLAQELRLHASDXXXXXXXXXXXXXEN 173
            + +QF +YL  P Y+K+  +Q    +  F+RLFLAQEL+L  S                
Sbjct: 37  FDHDQFEKYLVRPDYVKLLKKQADCDILPFKRLFLAQELQLGGS---------------- 80

Query: 174 SDRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPS 233
              +V  ++FS+DG     G KD +L V KV+ +  E+  +S A  +   KR        
Sbjct: 81  ---SVTVSRFSKDGTLFCVGCKDGSLMVLKVLQTKSEKLGISDAECEETGKRKIQ----- 132

Query: 234 PTVGRSVKEEPEQPIGPASMDLYAPVFHPLPF-------RIYQEHTQDILDLDWSKNGFI 286
                                 YAP+F+ L         ++++E    +LDL WS N F+
Sbjct: 133 ----------------------YAPIFNELDIVSLNSDEKVHRE----VLDLSWSVNHFL 166

Query: 287 LTTSMDKTARLWH-CDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDN 345
           L +S+D    LW   D  + +  F HPD VT AKF   DDRFFISGCLDH +R WS+ DN
Sbjct: 167 LVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCVRFWSVTDN 226

Query: 346 SVSFDYYCGDIITAIDTSPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVLE--KPNGTT 403
            V + + C + I  +  SP    +T  GTF G+I +  T GL+++  FH++     +G  
Sbjct: 227 RVEYSFNCEEPINVVTVSPGMSHFTVVGTFGGYIYVFSTMGLKLIDKFHIINGRSIDGNL 286

Query: 404 KKVPESGPKITGIEFFKS-------APDNDL---RIMVTSNDSRIRIFRIK--GQSLLEV 451
           +   +   KITGIE+  +         DN+    RI+VTS D RIR+F++   G   LE 
Sbjct: 287 RNGADK-IKITGIEWIVTDNRLDEIQEDNEYSTARIVVTSGDERIRVFKLTEGGYHNLE- 344

Query: 452 LKGFENTHSQISAHLILPPSKKIFVLAPSENQWVYCWRVE-------------------- 491
           LKGF     +  A L +   K  F+   SE+QW Y WR+                     
Sbjct: 345 LKGFHCEQFRHRAQLCIWDDKP-FIYCSSEDQWFYVWRLNYQDLMLTRATNEILYASTTH 403

Query: 492 ------------------------SSAGVSNSDDSQNNGTHRRGSIRGLLQRSLSIGSSQ 527
                                   S+   ++ +   N+   R G      Q+S++  S +
Sbjct: 404 RRRRTERILGHTKEVTSSVLDMFFSTYAAADVEMGSNDKGMRHGQ-----QQSMTF-SHE 457

Query: 528 SPERQEYKNGXXXXXXXXXXXTAKSKGDQYIKNQHYIAFHAHRCXXXXXXXXXXXXXXXL 587
           S   Q    G             + + +  +++ H  +FHAH                 +
Sbjct: 458 STVTQTMPIGQPTGSTTKSTIEEQREENYILRHSHTFSFHAHDHPITTVNIAPIGTIAAV 517

Query: 588 ALSDDFICELTMALSETDEDVAFLKQQRRKSLIHSKKGSQKDRDLMERRFPSMIDAIGTI 647
             S+DFI E T                      +S     +D ++         D IG I
Sbjct: 518 TQSNDFIYEFTCRC-------------------YSNNVELRDVEM------DSCDIIGPI 552

Query: 648 VVSTDNSGIIRVFRSDISTNVRKKVLKCL 676
           VV+TD+ G +RVFR+D+S   R+ ++  L
Sbjct: 553 VVTTDSVGKLRVFRTDLSDIARETLINVL 581

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 84.0 bits (206), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 66/216 (30%), Positives = 109/216 (50%), Gaps = 13/216 (6%)

Query: 173 NSDRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPP 232
           N++  +   +FS D +  A G +D T++VW +  SPL+   +  + AK Q+   ++    
Sbjct: 496 NTNGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQ--SILPSKAKDQSNSATLVGHS 553

Query: 233 SPTVGRSVKEEPE-QPIGPASMDLYAPVFHPLPFRI---YQEHTQDILDLDWSKNG-FIL 287
            P    SV   P+ + +  AS D    ++    F     Y+ H   +  + +S  G + +
Sbjct: 554 GPVY--SVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFI 611

Query: 288 TTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI-LDN 345
           T S D+TARLW CD    L++F+ H + V C+ FHPN    F +G  D T R+W I   +
Sbjct: 612 TASHDQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVF-TGSSDKTCRMWDIQTGD 670

Query: 346 SVSFDYYCGDIITAIDTSPRDGKYTAAGTFNGHIII 381
           SV         +TA++ SP DG++   G+ +G II+
Sbjct: 671 SVRLFLGHTSPVTALEVSP-DGRWLTTGSEDGTIIV 705

>AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH]
           (172849..175296) [2448 bp, 815 aa]
          Length = 815

 Score = 82.0 bits (201), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 102/218 (46%), Gaps = 17/218 (7%)

Query: 173 NSDRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPP 232
           N++R +   +FS D + +A G +D  +++W +  +PLE    S A        +     P
Sbjct: 485 NTNREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLIGHSGP 544

Query: 233 SPTVGRS------VKEEPEQPIGPASMDLYAPVFHPLPFRIYQEHTQDILDLDWSKNG-F 285
             +V  S      V    ++ +   S+D Y  +        Y+ H   + D+ +S  G +
Sbjct: 545 VYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVS------YKGHNHPVWDVKFSPLGHY 598

Query: 286 ILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI-L 343
             T S D+TARLW CD    L++F  H + V C  FHPN   + ++G  D T R+W I  
Sbjct: 599 FATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHPN-GTYVLTGSSDKTCRMWDIQT 657

Query: 344 DNSVSFDYYCGDIITAIDTSPRDGKYTAAGTFNGHIII 381
            +SV         + ++  SP DG++   G+ +G II+
Sbjct: 658 GDSVRLFLGHTASVVSVAVSP-DGRWLTTGSEDGVIIV 694

>Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement
          Length = 749

 Score = 76.6 bits (187), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/221 (28%), Positives = 102/221 (46%), Gaps = 23/221 (10%)

Query: 173 NSDRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPL-------ERNDLSSATAKPQAKR 225
           N++R +   +FS D    A G +D  +++W +  +PL       +R  +++ T    +  
Sbjct: 419 NTNRDMTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLIGHSGT 478

Query: 226 I-SMRVPPSPTVGRSVKEEPEQPIGPASMDLYAPVFHPLPFRIYQEHTQDILDLDWSKNG 284
           + S    P      S  E+  + +   SMD Y+ +        Y+ H   + D+ +S  G
Sbjct: 479 VYSTSFSPDNKYLLSASED--KTVRLWSMDTYSSLVS------YKGHNHPVWDVSFSPLG 530

Query: 285 -FILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI 342
            +  T S D+TARLW CD    L++F  H + V C  FHPN    F +G  D T R+W I
Sbjct: 531 HYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVF-TGSTDKTCRMWDI 589

Query: 343 LDNSVSFDYYCGDIITAIDT--SPRDGKYTAAGTFNGHIII 381
                S   + G     I T  SP DG++ + G+ +G I +
Sbjct: 590 -GTGDSVRLFLGHTAPVISTAVSP-DGRWLSTGSEDGIINV 628

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/264 (21%), Positives = 96/264 (36%), Gaps = 72/264 (27%)

Query: 178 VWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVG 237
           V++T FS D KY+ +  +D T+R+W +       +  SS  +          V  SP +G
Sbjct: 479 VYSTSFSPDNKYLLSASEDKTVRLWSM-------DTYSSLVSYKGHNHPVWDVSFSP-LG 530

Query: 238 RSVKEEPEQPIGPASMDLYAPVF---HPLPFRIYQEHTQDILDLDWSKNG-FILTTSMDK 293
                        AS D  A ++   H  P RI+  H  D+  + +  NG ++ T S DK
Sbjct: 531 HY--------FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDK 582

Query: 294 TARLWHCDRPKALKVFT-HPDFVTCAKFHPN----------------------------- 323
           T R+W      ++++F  H   V      P+                             
Sbjct: 583 TCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRG 642

Query: 324 -------------DDRFFISGCLDHTLRLWSILDNSVS--------FDYYCGDIITAIDT 362
                        +    +SG  DH++R+W +  ++          F  Y GD  T+++ 
Sbjct: 643 HGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLKRSTAEPNTEPEQPFTSYFGDATTSVNN 702

Query: 363 SPRD-GKYTAAGTFNGHIIILYTR 385
             +D G+       N  I   YT+
Sbjct: 703 DIKDYGRRRTIVPTNDLIASFYTK 726

 Score = 33.1 bits (74), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 31/72 (43%), Gaps = 29/72 (40%)

Query: 177 AVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTV 236
           AV++  +S++G  + +GG D ++RVW          DL  +TA+P               
Sbjct: 647 AVYSLSYSKEGTVLVSGGADHSVRVW----------DLKRSTAEPNT------------- 683

Query: 237 GRSVKEEPEQPI 248
                 EPEQP 
Sbjct: 684 ------EPEQPF 689

>CAGL0M05335g complement(569132..571552) similar to sp|P38129
           Saccharomyces cerevisiae YBR198c Transcription
           initiation factor TFIID 90, hypothetical start
          Length = 806

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 104/233 (44%), Gaps = 33/233 (14%)

Query: 173 NSDRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPP 232
           N++R + + +FS D +  A G +D  +++W +  S L     SS+    Q  R S     
Sbjct: 471 NTNRDMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSS----QFDRFSQDNTC 526

Query: 233 SPTVGRS---------------VKEEPEQPIGPASMDLYAPVFHPLPFRIYQEHTQDILD 277
           S  VG S               V    ++ +   SMD +  + +      Y+ H   + D
Sbjct: 527 STLVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVN------YKGHNHPVWD 580

Query: 278 LDWSKNG-FILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDH 335
           + +S  G +  + S D+TARLW CD    L++F  H + V    FHPN    F +G  D 
Sbjct: 581 VKFSPLGHYFASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVF-TGSSDK 639

Query: 336 TLRLWSILDNSVSFDYYCGDIITAIDT--SPRDGKYTAAGTFNGHIIILYTRG 386
           T R+W +     S   + G     + T  SP DG++ A G+ +G +I L+  G
Sbjct: 640 TCRMWDV-STGDSVRLFLGHTAPVLSTQVSP-DGRWLATGSEDG-VICLWDIG 689

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/245 (22%), Positives = 91/245 (37%), Gaps = 73/245 (29%)

Query: 178 VWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVG 237
           V++T FS D  Y+ +G +D T+++W           + + TA    K  +  V       
Sbjct: 536 VYSTSFSPDNMYLVSGSEDKTVKLWS----------MDTHTALVNYKGHNHPV------- 578

Query: 238 RSVKEEP-EQPIGPASMDLYAPVF---HPLPFRIYQEHTQDILDLDWSKNG-FILTTSMD 292
             VK  P       AS D  A ++   H  P RI+  HT D+  + +  NG ++ T S D
Sbjct: 579 WDVKFSPLGHYFASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSD 638

Query: 293 KTARLWHCDRPKALKVF-THPDFVTCAKFHPN---------------------------- 323
           KT R+W      ++++F  H   V   +  P+                            
Sbjct: 639 KTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMR 698

Query: 324 --------------DDRFFISGCLDHTLRLWSILDNSVS--------FDYYCGDIITAID 361
                         +    ISG  DH++R+W +   +          F+ + GDI  +I+
Sbjct: 699 GHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVKHGTTEQGPEPEQPFNAHVGDITASIN 758

Query: 362 TSPRD 366
              +D
Sbjct: 759 QDIKD 763

>Kwal_27.12053
          Length = 755

 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 63/224 (28%), Positives = 103/224 (45%), Gaps = 29/224 (12%)

Query: 173 NSDRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMR--V 230
           N++  + + +FS D +  A G +D  +++W +   PL +N L S     Q +R +    V
Sbjct: 425 NTNSEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPL-KNKLPSK----QGERTNNETLV 479

Query: 231 PPSPTVGRS---------VKEEPEQPIGPASMDLYAPVFHPLPFRIYQEHTQDILDLDWS 281
             S TV  +         +    ++ +   S D Y  + +      Y+ H   I D+ +S
Sbjct: 480 GHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVN------YKGHNHPIWDVAFS 533

Query: 282 KNG-FILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRL 339
             G +  T S D+TARLW CD    L++F  H + V    FHPN    F +G  D T R+
Sbjct: 534 PLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVF-TGSSDKTCRM 592

Query: 340 WSILDNSVSFDYYCGDI--ITAIDTSPRDGKYTAAGTFNGHIII 381
           W I     S   + G    +T+   SP DG++ + G+ +G I +
Sbjct: 593 WDITSGD-SVRLFLGHTAPVTSTAVSP-DGRWLSTGSEDGVINV 634

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 50/243 (20%), Positives = 88/243 (36%), Gaps = 79/243 (32%)

Query: 178 VWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVG 237
           V++T FS D +Y+ +  +D T+R+W            S+ T            P      
Sbjct: 485 VYSTSFSPDNRYLLSASEDKTVRLW------------STDTYTSLVNYKGHNHP------ 526

Query: 238 RSVKEEPEQPIG----PASMDLYAPVF---HPLPFRIYQEHTQDILDLDWSKNG-FILTT 289
             + +    P+G     AS D  A ++   H  P RI+  H  D+  + +  NG ++ T 
Sbjct: 527 --IWDVAFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTG 584

Query: 290 SMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPN------------------------- 323
           S DKT R+W      ++++F  H   VT     P+                         
Sbjct: 585 SSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRLK 644

Query: 324 -----------------DDRFFISGCLDHTLRLWSILDNSVS--------FDYYCGDIIT 358
                            +    ISG  DH++R+W +  ++          F  Y GD+ +
Sbjct: 645 QMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDVKKSTAEPGSEPEQPFTGYSGDVTS 704

Query: 359 AID 361
           +++
Sbjct: 705 SVN 707

 Score = 33.9 bits (76), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 37/83 (44%), Gaps = 29/83 (34%)

Query: 177 AVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTV 236
           AV++  +S++G  + +GG D ++RVW          D+  +TA+P +             
Sbjct: 653 AVYSLSYSKEGHVLISGGADHSVRVW----------DVKKSTAEPGS------------- 689

Query: 237 GRSVKEEPEQPIGPASMDLYAPV 259
                 EPEQP    S D+ + V
Sbjct: 690 ------EPEQPFTGYSGDVTSSV 706

>Scas_721.32
          Length = 822

 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 103/232 (44%), Gaps = 29/232 (12%)

Query: 173 NSDRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLER--------------NDLSSAT 218
           N++  + + +FS D + +A G +D  +++W +  S L++              ND +S T
Sbjct: 485 NTNGGMTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMNDNTSTT 544

Query: 219 AKPQAKRISMRVPPSPTVGRSVKEEPEQPIGPASMDLYAPVFHPLPFRIYQEHTQDILDL 278
               +  +      SP     +    ++ +   S D Y  +        Y+ H   + D+
Sbjct: 545 LIGHSGAV-YSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVS------YKGHNHPVWDV 597

Query: 279 DWSKNG-FILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHT 336
            +S  G +  T S D+TARLW CD    L++F  H   V C  FHPN    F +G  D T
Sbjct: 598 QFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVF-TGSSDKT 656

Query: 337 LRLWSILDNSVSFDYYCGDIITAIDT--SPRDGKYTAAGTFNGHIIILYTRG 386
            R+W I     S   + G     + T  SP DG++ A G+ +G II L+  G
Sbjct: 657 CRMWDI-STGDSVRLFLGHTAPVLCTAVSP-DGRWLATGSEDG-IINLWDIG 705

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/249 (20%), Positives = 92/249 (36%), Gaps = 79/249 (31%)

Query: 177 AVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTV 236
           AV++T FS D +Y+ +G +D T+R+W               +       +S +    P  
Sbjct: 551 AVYSTSFSPDNRYLLSGSEDKTVRLW---------------STDTYTSLVSYKGHNHP-- 593

Query: 237 GRSVKEEPEQPIG----PASMDLYAPVF---HPLPFRIYQEHTQDILDLDWSKNG-FILT 288
              V +    P+G     AS D  A ++   H  P RI+  H  D+  + +  NG ++ T
Sbjct: 594 ---VWDVQFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFT 650

Query: 289 TSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPN------------------------ 323
            S DKT R+W      ++++F  H   V C    P+                        
Sbjct: 651 GSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLWDIGTAKRL 710

Query: 324 ------------------DDRFFISGCLDHTLRLWSILDNSVS--------FDYYCGDII 357
                             +    +SG  DH++R+W +  ++          F  Y G++ 
Sbjct: 711 KVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDLKKSTAEPGPEPEEQFVGYIGNLT 770

Query: 358 TAIDTSPRD 366
            +I+   +D
Sbjct: 771 ASINQDIKD 779

>Kwal_23.6429
          Length = 750

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 80/305 (26%), Positives = 124/305 (40%), Gaps = 30/305 (9%)

Query: 178 VWATKFSRDGKYMATGGKDCTLRVWKVIASPL---ERNDLSSATAKPQAKRISMRVPPSP 234
           V   +FS DG+++ATG    T +V+KV    L      D SSA +   A   S     SP
Sbjct: 403 VCCVRFSHDGEFLATGCNKTT-QVYKVSTGELIARLSEDASSAPSGADASATSENAKASP 461

Query: 235 TVG---------RSVKEEPEQP-IGPASMDLYAPVFHPLPFRI---YQEHTQDILDLDWS 281
            V          RSV   P+   +   + D    ++     RI    Q H QDI  LD+ 
Sbjct: 462 AVATSASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYF 521

Query: 282 KNG-FILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLW 340
            +G  +++ S D+T R+W     +     +  D VT     P D +   +G LD T+R+W
Sbjct: 522 PSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIW 581

Query: 341 SILDNSVSFDYYCGDIITAIDTSPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVLEKPN 400
              D+   F     D    + T  +D  Y+   T +GH ++  +  L+       L   N
Sbjct: 582 ---DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVV--SGSLDRSVKLWNLRSAN 636

Query: 401 GTTKK----VPESGPKITGIEFF---KSAPDNDLRIMVTSNDSRIRIFRIKGQSLLEVLK 453
           G T +       S    TG + F    +   ND  I+  S D  +  +     + L +L+
Sbjct: 637 GGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQ 696

Query: 454 GFENT 458
           G  N+
Sbjct: 697 GHRNS 701

>YBR198C (TAF5) [381] chr2 complement(616084..618480) Component of
           the TAF(II) complex (TBP-associated protein complex) and
           SAGA complex (Spt-Ada-Gcn5-acetyltransferase), required
           for activated transcription by RNA polymerase II, member
           of WD (WD-40) repeat family [2397 bp, 798 aa]
          Length = 798

 Score = 65.9 bits (159), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 84/207 (40%), Gaps = 60/207 (28%)

Query: 178 VWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVG 237
           V++T FS D KY+ +G +D T+R+W                                   
Sbjct: 528 VYSTSFSPDNKYLLSGSEDKTVRLW----------------------------------- 552

Query: 238 RSVKEEPEQPIGPASMDLYAPVFHPLPFRIYQEHTQDILDLDWSKNG-FILTTSMDKTAR 296
                         SMD +  +        Y+ H   + D+ +S  G +  T S D+TAR
Sbjct: 553 --------------SMDTHTALVS------YKGHNHPVWDVSFSPLGHYFATASHDQTAR 592

Query: 297 LWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI-LDNSVSFDYYCG 354
           LW CD    L++F  H + V C  FHPN    F +G  D T R+W +   +SV       
Sbjct: 593 LWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVF-TGSSDKTCRMWDVSTGDSVRLFLGHT 651

Query: 355 DIITAIDTSPRDGKYTAAGTFNGHIII 381
             + +I   P DG++ + G+ +G I +
Sbjct: 652 APVISIAVCP-DGRWLSTGSEDGIINV 677

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 16/61 (26%)

Query: 177 AVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTV 236
           A+++  +S++G  + +GG D T+RVW          DL  AT +P A+      P  P +
Sbjct: 696 AIYSLSYSKEGNVLISGGADHTVRVW----------DLKKATTEPSAE------PDEPFI 739

Query: 237 G 237
           G
Sbjct: 740 G 740

>AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH]
           complement(257969..259858) [1890 bp, 629 aa]
          Length = 629

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 69/294 (23%), Positives = 113/294 (38%), Gaps = 77/294 (26%)

Query: 173 NSDRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPP 232
           +SD  + +  FS DGKY+ATG +D  +R+W          DL++       K+I M +  
Sbjct: 350 SSDLYIRSVCFSPDGKYLATGAEDKLIRIW----------DLTT-------KKILMTL-- 390

Query: 233 SPTVGRSVKEEPEQPIGPASMDLYAPVFHPLPFRIYQEHTQDILDLDWSKNG-FILTTSM 291
                                               Q H QDI  LD+   G  +++ S 
Sbjct: 391 ------------------------------------QGHEQDIYSLDYFPAGDKLVSGSG 414

Query: 292 DKTARLWHCDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI--------L 343
           D+T R+W     +     +  D VT     P D ++  +G LD T+R+W          L
Sbjct: 415 DRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERL 474

Query: 344 DNSVSFDYYCGDIITAIDTSPRDGKYTAAGTFNGHIIILYTRGL---------EMVSTFH 394
           D+         D + ++    RDG+   +G+ +  + +   RGL         E+  T H
Sbjct: 475 DSENELSTGHKDSVYSV-VFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGH 533

Query: 395 ---VLEKPNGTTKKVPESGPKITGIEFFKSAPDNDLRIMVTSNDSRIRIFRIKG 445
              VL        +   SG K  G+ F+ +A  N L ++    +S I +  + G
Sbjct: 534 KDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSVISVAVVNG 587

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 84/204 (41%), Gaps = 30/204 (14%)

Query: 178 VWATKFSRDGKYMATGGKDCTLRVWKVIASPL--ERNDLSSATAKPQAKRISMRVPPSPT 235
           V   +FS DG+Y+ATG    T +V+KV    L    +D S A    +A        P+  
Sbjct: 279 VCCVRFSNDGEYLATGCNKTT-QVYKVSTGELLARLSDDSVAGVNNEAS-----TGPANN 332

Query: 236 VGRSVKEEPEQPIGPASM-DLYAPVFHPLPFRIYQEHTQDILDLDWSKNG-FILTTSMDK 293
                  E    I PAS  DLY                  I  + +S +G ++ T + DK
Sbjct: 333 GTADNGGENSATIQPASSSDLY------------------IRSVCFSPDGKYLATGAEDK 374

Query: 294 TARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYY 352
             R+W     K L     H   +    + P  D+  +SG  D T+R+W +     S    
Sbjct: 375 LIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKL-VSGSGDRTVRIWDLRTGQCSLTLS 433

Query: 353 CGDIITAIDTSPRDGKYTAAGTFN 376
             D +T +  SP DGKY AAG+ +
Sbjct: 434 IEDGVTTVAVSPGDGKYIAAGSLD 457

>YCR084C (TUP1) [608] chr3 complement(260307..262448) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by regulated,
           sequence-specific DNA-binding proteins, exists in a
           complex with Ssn6p that is converted to a
           transcriptional activator in a Hog1p-dependent manner
           [2142 bp, 713 aa]
          Length = 713

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/293 (23%), Positives = 115/293 (39%), Gaps = 68/293 (23%)

Query: 174 SDRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPS 233
           SD  + +  FS DGK++ATG +D  +R+W +                 + ++I M     
Sbjct: 442 SDLYIRSVCFSPDGKFLATGAEDRLIRIWDI-----------------ENRKIVM----- 479

Query: 234 PTVGRSVKEEPEQPIGPASMDLYAPVFHPLPFRIYQEHTQDILDLDWSKNG-FILTTSMD 292
                                            I Q H QDI  LD+  +G  +++ S D
Sbjct: 480 ---------------------------------ILQGHEQDIYSLDYFPSGDKLVSGSGD 506

Query: 293 KTARLWHCDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYY 352
           +T R+W     +     +  D VT     P D ++  +G LD  +R+W   D+   F   
Sbjct: 507 RTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVW---DSETGFLVE 563

Query: 353 CGDIITAIDTSPRDGKYTAAGTFNGHIIILYTRGLE-MVSTFHVLEKPNGTTKKVPESGP 411
             D      T  +D  Y+   T +G  ++  +  L+  V  +++    N +  K P SG 
Sbjct: 564 RLDSENESGTGHKDSVYSVVFTRDGQSVV--SGSLDRSVKLWNLQNANNKSDSKTPNSGT 621

Query: 412 -KITGI---EFFKSAP--DNDLRIMVTSNDSRIRIFRIKGQSLLEVLKGFENT 458
            ++T I   +F  S     ND  I+  S D  +  +  K  + L +L+G  N+
Sbjct: 622 CEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNS 674

>Scas_629.12
          Length = 671

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/215 (25%), Positives = 95/215 (44%), Gaps = 10/215 (4%)

Query: 173 NSDRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPL-ERNDLSSATAKPQAKRISMRVP 231
           N    V   KFS DG+++ATG    T ++++V    L  +    S T+   +   S   P
Sbjct: 326 NHSSVVCCVKFSNDGQFLATGCNKTT-QIYRVSDGELIAKLSDDSVTSPDTSSATSGSTP 384

Query: 232 PSPTVGRSVKEEPE-QPIGPASMDLYAPVFHPLPFRI---YQEHTQDILDLDWSKNGF-I 286
            +    RSV   P+ + +   + D    ++     +I    + H QD+  LD+  NG  +
Sbjct: 385 STDLYIRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKL 444

Query: 287 LTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNS 346
           ++ S D+T R+W     +     +    VT     PND +F  +G LD  +R+W   D++
Sbjct: 445 VSGSGDRTVRIWDLRTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVW---DST 501

Query: 347 VSFDYYCGDIITAIDTSPRDGKYTAAGTFNGHIII 381
             F     D    + T  RD  Y+   T +G+ ++
Sbjct: 502 TGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVV 536

>CAGL0E00561g 49750..52260 some similarities with sp|P16649
           Saccharomyces cerevisiae YCR084c TUP1, hypothetical
           start
          Length = 836

 Score = 59.7 bits (143), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 66/296 (22%), Positives = 116/296 (39%), Gaps = 74/296 (25%)

Query: 174 SDRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPS 233
           +D  + +  FS DGK++ATG +D  +R+W +                 + K+I M     
Sbjct: 554 TDLYIRSVCFSPDGKFLATGAEDKLIRIWDI-----------------EQKKIVM----- 591

Query: 234 PTVGRSVKEEPEQPIGPASMDLYAPVFHPLPFRIYQEHTQDILDLDWSKNG-FILTTSMD 292
                                            + + H QDI  LD+  +G  +++ S D
Sbjct: 592 ---------------------------------VLKGHEQDIYSLDYFPSGDKLVSGSGD 618

Query: 293 KTARLWHCDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYY 352
           +T R+W     +     +  D VT     P D +F  +G LD  +R+W   D+   F   
Sbjct: 619 RTVRIWDLKTGQCTLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVW---DSDTGFLVE 675

Query: 353 CGDIITAIDTSPRDGKYTAAGTFNGHIII-------LYTRGLEMVSTFHVLEKPNGTTKK 405
             D    + T  +D  Y+   T +G+ ++       +    L  V+  +   KP   T +
Sbjct: 676 RLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCE 735

Query: 406 VPESGPKITGIEFFKSAP--DNDLRIMVTSNDSRIRIF-RIKGQSLLEVLKGFENT 458
           V  +G K    +F  S    ++D  I+  S D  +  + ++ G  LL +L+G  N+
Sbjct: 736 VTYTGHK----DFVLSVATTEDDEYILSGSKDRGVLFWDKVSGNPLL-MLQGHRNS 786

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 65/296 (21%), Positives = 108/296 (36%), Gaps = 77/296 (26%)

Query: 174 SDRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPS 233
           SD  + +  FS DGK++ATG +D  +R+W +                 + K+I M +   
Sbjct: 405 SDLYIRSVCFSPDGKFLATGAEDKLIRIWDL-----------------ETKKIVMTL--- 444

Query: 234 PTVGRSVKEEPEQPIGPASMDLYAPVFHPLPFRIYQEHTQDILDLDWSKNGF-ILTTSMD 292
                                              + H QDI  LD+  +G  +++ S D
Sbjct: 445 -----------------------------------KGHEQDIYSLDYFPSGNKLVSGSGD 469

Query: 293 KTARLWHCDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI--------LD 344
           +T R+W           +  D VT     P + +F  +G LD T+R+W          LD
Sbjct: 470 RTVRIWDLTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLD 529

Query: 345 NSVSFDYYCGDIITAIDTSPRDGKYTAAGTFNGHIIILYTRGL---------EMVSTFH- 394
           +         D + ++    RDGK   +G+ +  + +    GL         E+  T H 
Sbjct: 530 SENELGTGHRDSVYSV-VFTRDGKGVVSGSLDRSVKLWNLNGLSGQKSHAECEVTYTGHK 588

Query: 395 --VLEKPNGTTKKVPESGPKITGIEFFKSAPDNDLRIMVTSNDSRIRIFRIKGQSL 448
             VL        +   SG K  G+ F+ +   N L ++    +S I +    G  L
Sbjct: 589 DFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVTVANGHPL 644

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 88/208 (42%), Gaps = 29/208 (13%)

Query: 178 VWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVG 237
           V   +FS DG+++ATG    T +V+KV    L       + ++PQ +  +  V    +  
Sbjct: 324 VCCVRFSSDGEFLATGCNKTT-QVYKVSTGELVARLSDDSASQPQPQPQNQTVTAETSTS 382

Query: 238 RSVKEEPEQPIG-------PASMDLYAPVFHPLPFRIYQEHTQDILDLDWSKNG-FILTT 289
            S     E   G        AS DLY                  I  + +S +G F+ T 
Sbjct: 383 NSNGSSAEDGTGNQNSAASTASSDLY------------------IRSVCFSPDGKFLATG 424

Query: 290 SMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVS 348
           + DK  R+W  +  K +     H   +    + P+ ++  +SG  D T+R+W +   + S
Sbjct: 425 AEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKL-VSGSGDRTVRIWDLTTGTCS 483

Query: 349 FDYYCGDIITAIDTSPRDGKYTAAGTFN 376
                 D +T +  SP +GK+ AAG+ +
Sbjct: 484 LTLSIEDGVTTVAVSPGEGKFIAAGSLD 511

>Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement
          Length = 711

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 84/288 (29%), Positives = 125/288 (43%), Gaps = 65/288 (22%)

Query: 264 PFRIYQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPN 323
           P  +   H  ++  L  SKN F++++S DKTA++WH +      +  H   V  AKF P 
Sbjct: 91  PVYMLIGHKGNVCSLS-SKNNFVISSSWDKTAKVWH-NGSAIYDLVGHSASVWDAKFLPE 148

Query: 324 DDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTSPRDGKYTAA----GT----- 374
            D FF++   D T++LW       +F     D+I  +D SP DG+  A+    GT     
Sbjct: 149 KD-FFLTASADCTIKLWHGNKLIKTFSGIHKDVIRHLDISP-DGETFASCSNDGTVKIND 206

Query: 375 FNGHIIILYTRGLEMVSTFHVLEKPNGTTKKVPE---------SG--------PKITGIE 417
            +G+I+  +T     V +   L  PNG      E         +G        P ++ I 
Sbjct: 207 MDGNILKTFTGHESFVYSVKFL--PNGDLVSCGEDRSVRVWSKTGAVKQVLRLPAVS-IW 263

Query: 418 FFKSAPDNDLRIMVTSNDSRIRIF-----RIKGQSLLEVL-KGFENT----------HSQ 461
                P+ D  I+V S+D+ +RIF     RI   S LE L K  EN+           S+
Sbjct: 264 DLDILPNGD--ILVGSSDNMVRIFTVEESRIASNSKLEELQKQVENSSINSQTMDFDESK 321

Query: 462 ISAH-LILPPSKK----IFVLAP---------SENQWVYCWRVESSAG 495
           +S + +IL P KK      V AP         S+ QW+    V  S+G
Sbjct: 322 LSPYEVILQPGKKEGQVAVVKAPSGAIEAHQFSQGQWMKVGDVVGSSG 369

>CAGL0H08932g join(871668..871685,872089..874779) highly similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
          Length = 902

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 43/72 (59%), Gaps = 2/72 (2%)

Query: 285 FILTTSMDKTARLWHCDRPKAL-KVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI 342
           +ILT S D T +LW+ +   +L + F  H  FV C  F+P D   F SGCLDH +++WS+
Sbjct: 111 YILTGSDDLTVKLWNWENDWSLEQTFKGHEHFVMCVAFNPKDPNVFASGCLDHKVKVWSL 170

Query: 343 LDNSVSFDYYCG 354
             ++ +F  + G
Sbjct: 171 GQSTPNFTLHTG 182

>Scas_624.11
          Length = 1205

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 55/118 (46%), Gaps = 21/118 (17%)

Query: 238 RSVKEEPEQPIGPASMDLYAPVFHPLPFRIYQEHTQDIL-----DLDWSKNGF------- 285
           RSV   P QPI  +  D Y         +++   T   L      LD+ +  F       
Sbjct: 57  RSVDFHPTQPIFVSGGDDYT-------IKVWSLETNKCLYTLNGHLDYIRTVFFHKELPW 109

Query: 286 ILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI 342
           I++ S D+T R+W+    K +   T H  FV CA+FHP DD   +S  LD T+R+W I
Sbjct: 110 IISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDD-LVVSASLDETIRVWDI 166

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 2/62 (3%)

Query: 285 FILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSIL 343
           ++L      T +LW       L  F  H   V    FHP     F+SG  D+T+++WS+ 
Sbjct: 25  WVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRSVDFHPTQP-IFVSGGDDYTIKVWSLE 83

Query: 344 DN 345
            N
Sbjct: 84  TN 85

>KLLA0B01958g join(170646..170663,170896..173550) similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
           coatomer complex beta chain (beta -cop) of secretory
           pathway vesicles, hypothetical start
          Length = 890

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (61%), Gaps = 2/60 (3%)

Query: 285 FILTTSMDKTARLWHCDRPKALK-VFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI 342
           F+LT S D T +LW+ ++    +  FT H  FV    F+P D   F SGCLDHT+++WSI
Sbjct: 111 FVLTGSDDLTIKLWNWEKNWGCQQTFTGHEHFVMSVAFNPKDPNQFASGCLDHTIKVWSI 170

>YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer
           (COPI) complex alpha chain (alpha-COP) of secretory
           pathway vesicles required for retrograde Golgi to
           endoplasmic reticulum transport, member of WD (WD-40)
           repeat family [3606 bp, 1201 aa]
          Length = 1201

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 55/118 (46%), Gaps = 21/118 (17%)

Query: 238 RSVKEEPEQPIGPASMDLYAPVFHPLPFRIYQEHTQDIL-----DLDWSKNGF------- 285
           R +   P QPI  ++ D Y         +++   T   L      LD+ +  F       
Sbjct: 57  RGLDFHPTQPIFVSAGDDYT-------IKVWSLDTNKCLYTLTGHLDYVRTVFFHRELPW 109

Query: 286 ILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI 342
           I++ S D+T R+W+    K +   T H  FV CA+FHP DD   +S  LD T+R+W I
Sbjct: 110 IISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDD-LIVSASLDETIRIWDI 166

>ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH]
           (538948..540657) [1710 bp, 569 aa]
          Length = 569

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/265 (23%), Positives = 99/265 (37%), Gaps = 55/265 (20%)

Query: 188 KYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVGRSVKEEPEQP 247
           K + TG  D T+ +W +    L R  LS  T   +A R                   +Q 
Sbjct: 270 KLLLTGSYDSTVAIWDLATGKLIRR-LSGHTDGVKALRFD-----------------DQK 311

Query: 248 IGPASMDLYAPVFHPLP---FRIYQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPK 304
           +   S+D    V++ +       Y+ H   +L +D S    I++ S DKT ++WH +   
Sbjct: 312 LITGSLDKTIRVWNYVTGACVSTYRGHQDSVLSVD-SFRKLIVSGSADKTVKVWHVESRT 370

Query: 305 ALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTSP 364
              +  H  +V C K HP     F SG  D T+R+W I  N                   
Sbjct: 371 CYTLRGHTGWVNCVKLHPKSFTCF-SGSDDMTIRMWDIRTN------------------- 410

Query: 365 RDGKYTAAGTFNGHI-----IILYTRGLEMVSTFHVLEKPNGTTKKVPESGPKITGIEFF 419
                T    F+GH+     +I  T G +++        P   T   P   P +    F 
Sbjct: 411 -----TCVRVFHGHVGQVQKVIPLTLGSDLIEDPKDAVVPPDAT--APAHDPSVQAANFD 463

Query: 420 KSAPDNDLRIMVTSNDSRIRIFRIK 444
            S P     ++  S D+ I+++ +K
Sbjct: 464 HSLP-YPTHLLSCSLDNTIKLWNVK 487

>YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741)
           Coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles, required for retrograde
           transport from Golgi to endoplasmic reticulum, member of
           the WD (WD-40) repeat family [2670 bp, 889 aa]
          Length = 889

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 42/72 (58%), Gaps = 2/72 (2%)

Query: 285 FILTTSMDKTARLWHCDRPKAL-KVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI 342
           ++L+ S D T +LW+ +   AL + F  H  FV C  F+P D   F SGCLD T+++WS+
Sbjct: 111 YVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSL 170

Query: 343 LDNSVSFDYYCG 354
             ++ +F    G
Sbjct: 171 GQSTPNFTLTTG 182

>Scas_630.6
          Length = 621

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 94/216 (43%), Gaps = 13/216 (6%)

Query: 175 DRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLE----RNDLSSATAKPQAKRISMRV 230
           D  V   KFS+DGKY+ATG    T +++ V    L      + +++A      +      
Sbjct: 279 DSVVCCVKFSQDGKYLATGCNRTT-QIFDVATGELYVKLLDDTVNTAIVTTTTENNETVT 337

Query: 231 PPSPTVGRSVKEEPE-QPIGPASMDLYAPVFHPLPFRI---YQEHTQDILDLDWSKNGF- 285
             +    RS+   P+ + +   + D    +++    +I    + H QDI  LD+  +G  
Sbjct: 338 TTADLYIRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQK 397

Query: 286 ILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDN 345
           +++ S D++ R+W     +     +  D VT     PN+ +   +G LD ++R+W   D+
Sbjct: 398 LVSGSGDRSIRIWDLKTGQCSLTLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIW---DS 454

Query: 346 SVSFDYYCGDIITAIDTSPRDGKYTAAGTFNGHIII 381
           S  F     D         +D  Y+ A T +G  ++
Sbjct: 455 STGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVV 490

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 93/228 (40%), Gaps = 40/228 (17%)

Query: 174 SDRAVWATKFSRDGKYMATGGKDCTLRVWK------VIASPLERNDLSSATAKPQAKRIS 227
           +D  + +  FS DG+++ATG +D  +R+W       V+       D+ S    P  +++ 
Sbjct: 340 ADLYIRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLV 399

Query: 228 MRVPPSPTVGRSVKEEPEQPIGPASMDLYAPVFHPLPFRIYQEHTQDILDLDWSKNGFIL 287
                S +  RS++   +   G  S+ L              E     + +  ++   I 
Sbjct: 400 -----SGSGDRSIRIW-DLKTGQCSLTLSI------------EDGVTTVAVSPNEGKLIA 441

Query: 288 TTSMDKTARLWHCDRPKALKVFT--------HPDFVTCAKFHPNDDRFFISGCLDHTLRL 339
             S+D++ R+W       ++           H D V    F   D +  +SG LD T++L
Sbjct: 442 AGSLDRSVRIWDSSTGFLVERLDSDNESGNGHQDSVYSVAF-TKDGQHVVSGSLDRTVKL 500

Query: 340 WSILDNSVSFD----YYCG--DIITAIDTSPRDGKYTAAGTFNGHIII 381
           W++ D           Y G  D + ++ TS  D KY  +G+ +  +II
Sbjct: 501 WNLGDTQSGTGKCEVTYIGHKDFVLSVATS-NDDKYIFSGSKDRGVII 547

>ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH]
           (843171..846785) [3615 bp, 1204 aa]
          Length = 1204

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 56/118 (47%), Gaps = 21/118 (17%)

Query: 238 RSVKEEPEQPIGPASMDLYAPVFHPLPFRIYQEHTQDIL-----DLDWSKNGF------- 285
           R V   P QP+  ++ D Y+        +++   T   L      LD+ +  F       
Sbjct: 57  RGVDFHPTQPLFVSAGDDYS-------IKVWSLSTHKCLFTLNGHLDYVRTVFFHTELPW 109

Query: 286 ILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI 342
           I++ S D+T R+W+    + +   T H  FV CA+FHP +D   +S  LD T+R+W I
Sbjct: 110 IISASDDQTIRIWNWQNRREIACLTGHNHFVMCAQFHPTED-LVVSASLDETVRIWDI 166

>CAGL0M04279g 469040..471862 highly similar to sp|Q12220
           Saccharomyces cerevisiae YLR129w DIP2 DOM34P-interacting
           protein, start by similarity
          Length = 940

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 71/171 (41%), Gaps = 6/171 (3%)

Query: 175 DRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSP 234
           D A+W+   + DG+ + TG  D T+R W    S +  +D S+ T           +    
Sbjct: 470 DAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDD 529

Query: 235 TVGRSVKEEPEQPIGPASMDLYAPVFHPLPFRIYQE---HTQDILDLDWSKNG-FILTTS 290
            +   V    ++ I  + +D    VF     + +     H   +L +D S +   I+T S
Sbjct: 530 DILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCS 589

Query: 291 MDKTARLWHCDRPKALK-VFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLW 340
            DK  ++W  D     K +F H D +   KF P    FF S   D T++ W
Sbjct: 590 ADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFF-SCSKDATVKYW 639

>Kwal_56.24526
          Length = 1210

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 55/118 (46%), Gaps = 21/118 (17%)

Query: 238 RSVKEEPEQPIGPASMDLYAPVFHPLPFRIYQEHTQDIL-----DLDWSKNGF------- 285
           R +   P QP+  ++ D Y         +++   T+  L      LD+ +  F       
Sbjct: 57  RGIDFHPTQPLFVSAGDDYT-------IKVWSLDTKKCLFTLNGHLDYVRTVFFHRELPW 109

Query: 286 ILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI 342
           I++ S D+T R+W+    K +   T H  FV CA FHP +D   +S  LD T+R+W I
Sbjct: 110 IISASDDQTIRIWNWQNRKEIACLTGHNHFVMCADFHPTED-LVVSASLDETVRVWDI 166

>Scas_704.40
          Length = 608

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 42/80 (52%), Gaps = 2/80 (2%)

Query: 268 YQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPNDDRF 327
           Y+ HT  ++ +D  K   I++ S DKT ++WH +      +  H ++V C K HP     
Sbjct: 329 YRGHTDSVMSVDAFKK-IIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTC 387

Query: 328 FISGCLDHTLRLWSILDNSV 347
           F SG  D T+R+W I  NS 
Sbjct: 388 F-SGSDDTTIRMWDIRTNSC 406

 Score = 33.5 bits (75), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 76/199 (38%), Gaps = 47/199 (23%)

Query: 268 YQEHTQDILDLDWSKNGFILTTSMDKTARLWH-CDRPKALKVFTHPDFVTCAKFHPNDDR 326
           ++ H   +L L ++    + T S D T  +W  C      ++  H D V    F   D+ 
Sbjct: 249 FKGHMDGVLTLQFNYR-LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF---DEA 304

Query: 327 FFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTSPRDGKYTAAGTFNGHI------- 379
             ++G LD T+R+W         +Y  G+ I+               T+ GH        
Sbjct: 305 KLVTGSLDKTIRVW---------NYKTGECIS---------------TYRGHTDSVMSVD 340

Query: 380 ----IILYTRGLEMVSTFHVLEKPNGTTKKVPESGPKITGIEFFKSAPDNDLRIMVTSND 435
               II+     + V  +HV  +   T +   E       +   K  P +       S+D
Sbjct: 341 AFKKIIVSGSADKTVKIWHVESRTCYTLRGHTE------WVNCVKLHPKS-FTCFSGSDD 393

Query: 436 SRIRIFRIKGQSLLEVLKG 454
           + IR++ I+  S L+V +G
Sbjct: 394 TTIRMWDIRTNSCLKVFRG 412

>AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH]
           complement(216252..216269,216423..218903) [2499 bp, 832
           aa]
          Length = 832

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 83/207 (40%), Gaps = 65/207 (31%)

Query: 285 FILTTSMDKTARLWHCDRPKAL-KVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI 342
           ++L+ S D T +LW+ ++  AL + F  H  FV    F+P D   F + CLDHT+++WS+
Sbjct: 111 YVLSASDDLTVKLWNWEKNWALEQTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSL 170

Query: 343 LDNSVSFDYYCGDIITAIDTSPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVLEKPNGT 402
                                   G+ T+  T   H                 LEK    
Sbjct: 171 ------------------------GQETSNFTLRAH-----------------LEK---- 185

Query: 403 TKKVPESGPKITGIEFFKSAPDNDLRIMVTSNDSR-IRIFRIKGQSLLEVLKGFENTHSQ 461
                       G+ F    P  D   ++TS+D R ++++  + +S +  L+G  +  S 
Sbjct: 186 ------------GVNFVDYYPFQDKPYLITSSDDRTVKVWDYQTKSCVATLEGHLSNVSY 233

Query: 462 ISAHLILPPSKKIFVLAPSENQWVYCW 488
              H +LP      +++ SE+  V  W
Sbjct: 234 AVYHPMLP-----IIISGSEDGTVKIW 255

>KLLA0F04884g complement(478044..481682) similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 coatomer complex
           alpha chain of secretory pathway vesicles, start by
           similarity
          Length = 1212

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 285 FILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI 342
           +I+++S D+T R+W+    K +   T H  FV CA+FHP +D   +S  LD T+R+W I
Sbjct: 109 WIISSSDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPVED-LVVSASLDETVRVWDI 166

>Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement
          Length = 760

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 80/201 (39%), Gaps = 63/201 (31%)

Query: 294 TARLWHCDRPKAL-KVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDY 351
           T +LW+ ++  AL + F  H  FV C  F+P D   F S CLDHT+++WS+   S +F  
Sbjct: 2   TIKLWNWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNF-- 59

Query: 352 YCGDIITAIDTSPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVLEKPNGTTKKVPESGP 411
                                 T   H     TRG+  V  + + +KP            
Sbjct: 60  ----------------------TMTAH----ETRGVNFVDYYPLQDKP------------ 81

Query: 412 KITGIEFFKSAPDNDLRIMVTSNDSRIRIFRIKGQSLLEVLKGFENTHSQISAHLILPPS 471
                            ++ +S+D  ++I+  + +S +  L+G    H    ++ I  PS
Sbjct: 82  ----------------YLITSSDDRSVKIWDYQTKSCVATLEG----HMANVSYAIFHPS 121

Query: 472 KKIFVLAPSENQWVYCWRVES 492
             I +++ SE+  V  W   +
Sbjct: 122 LPI-IISGSEDGTVKIWNANT 141

>KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30 involved in regulation of
           sulfur assimilation genes and cell cycle progression,
           start by similarity
          Length = 623

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 51/106 (48%), Gaps = 5/106 (4%)

Query: 245 EQPIGPASMDLYAPVFHPLP---FRIYQEHTQDILDLDWSKNGFILTTSMDKTARLWHCD 301
           +Q +  AS+D    V++ +       Y+ H   +L +D S    I++ S DKT ++WH +
Sbjct: 362 DQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVD-SYKKIIVSASADKTVKVWHVE 420

Query: 302 RPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSV 347
                 +  H ++V C K HP     + S   D TLR+W I  NS 
Sbjct: 421 SRTCYTLRGHTEWVNCVKLHPKSFTCY-SSSDDKTLRMWDIRTNSC 465

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 41/192 (21%), Positives = 79/192 (41%), Gaps = 27/192 (14%)

Query: 265 FRIYQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPN 323
            ++++ H   +L L ++    + T S D T  +W       ++  T H D V    F   
Sbjct: 305 IQLFKGHMDGVLSLKFNHR-LLFTGSYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYF--- 360

Query: 324 DDRFFISGCLDHTLRLWSILDNSVSFDYYC-GDIITAIDTSPRDGKYTAAGTFNGHIIIL 382
           DD+  I+  LD T+R+W+ +  S    Y    D + ++D+  +              II+
Sbjct: 361 DDQKMITASLDKTIRVWNYITGSCISTYRGHQDSVLSVDSYKK--------------IIV 406

Query: 383 YTRGLEMVSTFHVLEKPNGTTKKVPESGPKITGIEFFKSAPDNDLRIMVTSNDSRIRIFR 442
                + V  +HV  +   T +   E       +   K  P +      +S+D  +R++ 
Sbjct: 407 SASADKTVKVWHVESRTCYTLRGHTE------WVNCVKLHPKS-FTCYSSSDDKTLRMWD 459

Query: 443 IKGQSLLEVLKG 454
           I+  S ++V +G
Sbjct: 460 IRTNSCIKVFRG 471

>CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces
           cerevisiae YCR084c TUP1 general transcription repressor,
           hypothetical start
          Length = 643

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 54/242 (22%), Positives = 97/242 (40%), Gaps = 40/242 (16%)

Query: 175 DRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLER---NDLSSATAKPQAKRISMRVP 231
           D  V   KFS +G+Y+ATG    T ++++V    L     +D  + T    +        
Sbjct: 318 DSVVCCVKFSNNGEYLATGCNKTT-KIFEVATGNLVTELVDDTKTGTEDANS------AS 370

Query: 232 PSPTVGRSVKEEPEQP-IGPASMDLYAPVFHPLPFRI---YQEHTQDILDLDWSKNGF-I 286
            +    RSV   P+   +   + D    ++     +I    + H QDI  LD+ ++G  +
Sbjct: 371 SADLYIRSVCFSPDGKFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKL 430

Query: 287 LTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNS 346
           ++ S D+T R+W     +     +  D VT     P +  +  +G LD T+R+W      
Sbjct: 431 VSGSGDRTIRIWDLHTGQCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVW------ 484

Query: 347 VSFDYYCGDIITAIDTS----------------PRDGKYTAAGTFNGHIIILYTRGLEMV 390
              D   G ++  +D+                  RDGK   +G+ +  + +   R +   
Sbjct: 485 ---DSNSGFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNLRNINGA 541

Query: 391 ST 392
           ST
Sbjct: 542 ST 543

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 29/48 (60%), Gaps = 7/48 (14%)

Query: 177 AVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAK 224
           +V++  F+RDGK + +G  D ++++W +      RN ++ A+  PQ K
Sbjct: 508 SVYSVVFTRDGKNIVSGSLDRSVKLWNL------RN-INGASTSPQPK 548

>CAGL0I03718g complement(317565..321170) highly similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 Coatomer alpha
           subunit, start by similarity
          Length = 1201

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 285 FILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI 342
           ++++ S D+T R+W+    K L   T H  FV CA+FH  +D   +S  LD T+R+W I
Sbjct: 109 WVISASDDQTVRIWNWQNRKELACLTGHNHFVMCAQFHQTED-LVVSASLDETVRVWDI 166

>CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30, hypothetical start
          Length = 673

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 51/107 (47%), Gaps = 7/107 (6%)

Query: 245 EQPIGPASMDLYAPVFHPLP---FRIYQEHTQDILDLDWSKNGFILTTSMDKTARLWHCD 301
           +Q +   S+D    V++ +       Y+ HT  ++ +D S    I++ S DKT ++WH +
Sbjct: 384 DQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMSVD-SHKKIIVSGSADKTVKVWHVE 442

Query: 302 RPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDH-TLRLWSILDNSV 347
                 +  H ++V C K HP    F    C D  T+R+W I  N+ 
Sbjct: 443 SRTCYTLKGHTEWVNCVKLHPKS--FSCYSCSDDTTIRMWDIRTNTC 487

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 78/189 (41%), Gaps = 27/189 (14%)

Query: 268 YQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDR 326
           ++ H   +L L ++    + T S D T  +W     K ++  T H D V    F   DD+
Sbjct: 330 FKGHMDGVLTLQFNYR-LLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYF---DDQ 385

Query: 327 FFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTSPRDGKYTAAGTFNGH-IIILYTR 385
             I+G LD T+R+W         +Y  G+ I     S   G   +  + + H  II+   
Sbjct: 386 KLITGSLDKTIRVW---------NYITGECI-----STYRGHTDSVMSVDSHKKIIVSGS 431

Query: 386 GLEMVSTFHVLEKPNGTTKKVPESGPKITGIEFFKSAPDNDLRIMVTSNDSRIRIFRIKG 445
             + V  +HV  +   T K   E       +   K  P +       S+D+ IR++ I+ 
Sbjct: 432 ADKTVKVWHVESRTCYTLKGHTE------WVNCVKLHPKS-FSCYSCSDDTTIRMWDIRT 484

Query: 446 QSLLEVLKG 454
            + L V +G
Sbjct: 485 NTCLRVFRG 493

>Scas_713.50
          Length = 983

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 76/178 (42%), Gaps = 14/178 (7%)

Query: 172 ENSDRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVP 231
           E  D A+W+   + DGK + TG  D +++ W      LE+ +L   T+     ++ +   
Sbjct: 508 EAHDAAIWSLDLTSDGKRLITGSADKSVKFWNF---QLEQ-ELVPGTSDKFVPKLGLHHD 563

Query: 232 PSPTVG---RSVKEEPEQPIGPAS-MDLYAPVFHPLPFRIYQE---HTQDILDLDWSKNG 284
            +  +     SV+  PE      S +D    VF     + +     H   +L +D S + 
Sbjct: 564 TTLELSDDILSVRVSPEDKFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDS 623

Query: 285 -FILTTSMDKTARLWHCDRPKALK-VFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLW 340
             I+T+S DK  ++W  D     K +F H D +   KF P    FF S   D  ++ W
Sbjct: 624 KMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFF-SCSKDGIIKYW 680

>YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 snoRNP
           (renamed small subunit processome - SSU processome),
           which is required for 18S rRNA biogenesis [2832 bp, 943
           aa]
          Length = 943

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 76/181 (41%), Gaps = 26/181 (14%)

Query: 175 DRAVWATKFSRDGKYMATGGKDCTLRVW--KVIAS--PLERNDL-------SSATAKPQA 223
           D A+W+   + DGK + TG  D T++ W  KV  S  P  +N            T +   
Sbjct: 473 DAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELTD 532

Query: 224 KRISMRVPPSP-TVGRSVKEEPEQPIGPASMDLYAPVF-HPLPFRIYQEHTQDILDLDWS 281
             + +RV P    +  S+ +   +     SM  Y  ++ H LP          +L +D S
Sbjct: 533 DILCVRVSPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLP----------VLSIDIS 582

Query: 282 KNG-FILTTSMDKTARLWHCDRPKALK-VFTHPDFVTCAKFHPNDDRFFISGCLDHTLRL 339
            +   I+T+S DK  ++W  D     K +F H D +   KF P    FF S   D  ++ 
Sbjct: 583 FDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPQSHNFF-SCSKDAVVKY 641

Query: 340 W 340
           W
Sbjct: 642 W 642

>YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that
           targets proteins for ubiquitination by interacting with
           the SCF complex (Skp1p-Cdc53p-Cdc34p), regulates sulfur
           assimilation genes in response to S-adenosylmethionine
           levels, contains five WD (WD-40) repeats [1923 bp, 640
           aa]
          Length = 640

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 41/80 (51%), Gaps = 2/80 (2%)

Query: 268 YQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPNDDRF 327
           Y+ H+  +L +D S    I++ S DKT ++WH +      +  H ++V C K HP     
Sbjct: 378 YRGHSDSVLSVD-SYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFSC 436

Query: 328 FISGCLDHTLRLWSILDNSV 347
           F S   D T+R+W I  NS 
Sbjct: 437 F-SCSDDTTIRMWDIRTNSC 455

 Score = 38.1 bits (87), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 78/189 (41%), Gaps = 27/189 (14%)

Query: 268 YQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDR 326
           ++ H   +L L ++    + T S D T  +W     K ++  + H D V    F   DDR
Sbjct: 298 FKGHMDGVLTLQFNYR-LLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYF---DDR 353

Query: 327 FFISGCLDHTLRLWSILDNSVSFDYYC-GDIITAIDTSPRDGKYTAAGTFNGHIIILYTR 385
             I+G LD T+R+W+ +       Y    D + ++D+  +              +I+   
Sbjct: 354 KLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQK--------------VIVSGS 399

Query: 386 GLEMVSTFHVLEKPNGTTKKVPESGPKITGIEFFKSAPDNDLRIMVTSNDSRIRIFRIKG 445
             + V  +HV  +   T +   E       +   K  P +       S+D+ IR++ I+ 
Sbjct: 400 ADKTVKVWHVESRTCYTLRGHTE------WVNCVKLHPKS-FSCFSCSDDTTIRMWDIRT 452

Query: 446 QSLLEVLKG 454
            S L+V +G
Sbjct: 453 NSCLKVFRG 461

>AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH]
           (328838..331645) [2808 bp, 935 aa]
          Length = 935

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 71/173 (41%), Gaps = 14/173 (8%)

Query: 177 AVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTV 236
           A+W+   + DGK + T   D T++ W          +L + T      ++ +    +  +
Sbjct: 469 AIWSLDLTSDGKRLVTASADKTVKFWDFKV----EQELVAGTLDKFVPKMKLIHDTTLDL 524

Query: 237 GR---SVKEEPEQPIGPAS-MDLYAPVFHPLPFRIYQE---HTQDILDLDWSKNG-FILT 288
           G     VK  PE      S +D    VF     + +     H   +L +D S +   I+T
Sbjct: 525 GEDLWCVKISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIIT 584

Query: 289 TSMDKTARLWHCDRPKALK-VFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLW 340
           +S DK  ++W  D     K +F H D +   KF P    FF S   D T++ W
Sbjct: 585 SSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFF-SCSKDGTVKYW 636

>Kwal_23.5769
          Length = 627

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 40/80 (50%), Gaps = 2/80 (2%)

Query: 268 YQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPNDDRF 327
           Y  H+  +L +D S    I++ S DKT ++WH +      +  H ++V   K HP     
Sbjct: 393 YPGHSDSVLSVD-SYKKIIVSGSADKTVKVWHVESRTCYTLRGHTEWVGTVKLHPKSFTC 451

Query: 328 FISGCLDHTLRLWSILDNSV 347
           F SG  D T+R+W I  N+ 
Sbjct: 452 F-SGSDDTTIRMWDIRSNTC 470

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 78/189 (41%), Gaps = 27/189 (14%)

Query: 268 YQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDR 326
           ++ H   +L L ++    + T S D T  +W     K ++  T H D V    F   D +
Sbjct: 313 FKGHMDGVLSLQFNYR-LLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYF---DGQ 368

Query: 327 FFISGCLDHTLRLWSILDNSVSFDYYC-GDIITAIDTSPRDGKYTAAGTFNGHIIILYTR 385
             I+G LD  +R+W+ +  +    Y    D + ++D+     K   +G+ +  + + +  
Sbjct: 369 KLITGSLDRMIRVWNYVTGACVAAYPGHSDSVLSVDSYK---KIIVSGSADKTVKVWHVE 425

Query: 386 GLEMVSTFHVLEKPNGTTKKVPESGPKITGIEFFKSAPDNDLRIMVTSNDSRIRIFRIKG 445
                 T     +  GT K  P+S    +G                 S+D+ IR++ I+ 
Sbjct: 426 S-RTCYTLRGHTEWVGTVKLHPKSFTCFSG-----------------SDDTTIRMWDIRS 467

Query: 446 QSLLEVLKG 454
            + ++V +G
Sbjct: 468 NTCVKVFRG 476

>AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH]
           complement(850726..850730,850789..852685) [1902 bp, 633
           aa]
          Length = 633

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 42/91 (46%), Gaps = 3/91 (3%)

Query: 259 VFHPLPFRIYQEHTQDILDLDW--SKNGFILTTSMDKTARLWHCDRPKALKVFTHPDFVT 316
           V H  P +    H + +  + +  +  G + ++S+D T RLW+ ++     V THPD VT
Sbjct: 127 VEHVAPVKFLTGHQRKVGHVLYHPTAQGVLASSSLDHTVRLWNVEQGTNPIVLTHPDMVT 186

Query: 317 CAKFHPNDDRFFISGCLDHTLRLWSILDNSV 347
              F      +  + C D  LR+W I    V
Sbjct: 187 SMSFS-YGGTYLATVCRDKMLRVWDIRKGEV 216

>Scas_720.83d
          Length = 915

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 48/90 (53%), Gaps = 9/90 (10%)

Query: 256 YAPVFHPLPFRIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCD-RPKALKVFT--- 310
           +AP    + +R++  H QDIL L WS +  FI++TS D TAR+W  D   K L   T   
Sbjct: 133 FAPF---VRYRVHAGHFQDILSLTWSLDSRFIISTSKDLTARIWSIDSEEKDLASMTFAG 189

Query: 311 HPDFVTCAKFHPNDDRFFISGCLDHTLRLW 340
           H D+V  A F  + ++ + +   D  L +W
Sbjct: 190 HRDYVMGAFFSADQEKIY-TVSKDGALFVW 218

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 60/164 (36%), Gaps = 53/164 (32%)

Query: 268 YQEHTQDILDLDWSKNGFIL-TTSMDKTARLWHCDRPKALKVFT---------------- 310
           +QEHT  +  + ++K G +L ++S+D T R W   R +  + FT                
Sbjct: 381 FQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAVDPSG 440

Query: 311 -----------------------------HPDFVTCAKFHPNDDRFFISGCLDHTLRLWS 341
                                        H   V+C  F   ++    S   D T+R+WS
Sbjct: 441 EVVCAGSLDNFDIHVWSVQTGQLLDTLSGHEGPVSCLAF-SQENSVLASASWDKTVRVWS 499

Query: 342 ILDNSVS---FDYYCGDIITAIDTSPRDGKYTAAGTFNGHIIIL 382
           I   S     FD Y    + A+   P DGK  A  T  G I+++
Sbjct: 500 IFGRSQQVEPFDVYSD--VLALTIRP-DGKQVAVSTLKGQILMI 540

>Kwal_23.5351
          Length = 474

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/262 (19%), Positives = 106/262 (40%), Gaps = 27/262 (10%)

Query: 175 DRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSP 234
           D  +    +S D + +ATGG D  +++W              A +  +A R+ +R   + 
Sbjct: 225 DDKIGGVAWSSDSQLLATGGADNLVKIWN-----------PQAQSHSEASRVVLRGHEAR 273

Query: 235 TVGRSVKEEP-EQPIGPASMDLYAPVF---HPLPFRIYQEHTQDILDLDWSKNGFILTTS 290
                VK  P ++ +  AS D+   ++        ++ + H +++  LD+  +G +L ++
Sbjct: 274 V--SKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGHAKEVYCLDFQCDGSLLCSA 331

Query: 291 -MDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILD-NSV 347
            +D    +W     ++L V   H   +    + PN      +G  D T+++W I   N  
Sbjct: 332 GLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPN-GHHVATGSGDGTVQVWDIRKANKP 390

Query: 348 SFDYYCGDIITAIDTSPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVLEKPNGTTKKVP 407
           S       I++ ++    +G +  + +++  I +  T       ++  L    G T K+ 
Sbjct: 391 SSILAHNSIVSEVNFEKENGNFLVSSSYDRTIGVFAT------GSWIKLASLQGHTDKIL 444

Query: 408 ESGPKITGIEFFKSAPDNDLRI 429
                  G   + S  D  ++I
Sbjct: 445 SVDISRGGANLWSSGWDRSVKI 466

 Score = 36.6 bits (83), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 65/140 (46%), Gaps = 28/140 (20%)

Query: 357 ITAIDTSPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVLEKPNGTTKKVPESGPKITGI 416
           ++ +  SP DG   AAG++NG + IL+ + LE+V +       +G          KI G+
Sbjct: 185 VSQVARSP-DGASLAAGSWNGDVKILHPQSLEVVRSL------DGAHD------DKIGGV 231

Query: 417 EFFKSAPDNDLRIMVTSN-DSRIRIFRIKGQSLLE----VLKGFENTHSQISAHLILPPS 471
                A  +D +++ T   D+ ++I+  + QS  E    VL+G E   S++  H    PS
Sbjct: 232 -----AWSSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFH----PS 282

Query: 472 KKIFVLAPSENQWVYCWRVE 491
            +    A  +  W   W VE
Sbjct: 283 DRFVASASFDMTW-RLWDVE 301

>Kwal_23.5035
          Length = 744

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 52/116 (44%), Gaps = 8/116 (6%)

Query: 271 HTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKF-HPNDDRFF 328
           H   +  L +  +G +++ S D++ R+W+    K   VF  H   V C      N  +F 
Sbjct: 409 HDGGVWALKYGHDGILVSGSTDRSVRVWNIKSGKCTHVFKGHTSTVRCLDIVEHNGKKFI 468

Query: 329 ISGCLDHTLRLWSILD-NSVSFDYYCGDIITAIDTSPR-----DGKYTAAGTFNGH 378
           ++G  DHTL +W + + N+  ++    ++    D +P       G   A  T +GH
Sbjct: 469 VTGSRDHTLHVWKLPNCNAEDYNPEVCEVFNTTDANPYFVGVLRGHMAAVRTVSGH 524

>KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1 40S
           small subunit ribosomal protein, start by similarity
          Length = 326

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 83/196 (42%), Gaps = 33/196 (16%)

Query: 271 HTQDILDLDWSKNGF-ILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHP------- 322
           HT D+L +    N   I++ S DKT R+W+     A  +  H D+VT  +  P       
Sbjct: 107 HTGDVLSVAIDANSSKIISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPKNLEDGE 166

Query: 323 -NDDRF-FISGCLDHTLRLWSILDNSVSFDY-YCG--DIITAIDTSPRDGKYTAAGTFNG 377
            +D R  F+S  +D  +R WS+ ++S   +  + G  + I  +  SP DG   A+   +G
Sbjct: 167 VDDGRITFVSAGMDKIVRSWSLNEDSYRIEADFIGHNNYINVVQPSP-DGSLAASAGKDG 225

Query: 378 HIIILYTRGLEMVSTFHVLEKPNGTTKKVPESGPKITGIEFFKSAPDNDLRIMVTSNDSR 437
            I   Y   L+  S F   +  +                E F  A       +  +  S 
Sbjct: 226 QI---YVWNLKHKSAFMNFDAKD----------------EVFALAFSPSRFWLTAATASG 266

Query: 438 IRIFRIKGQSLLEVLK 453
           I+I+ ++ + L++ LK
Sbjct: 267 IKIYDLENEVLIDELK 282

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 49/106 (46%), Gaps = 3/106 (2%)

Query: 263 LPFRIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKF 320
           +P R Y+ H+  + D+  S +G + ++ S DKT RLW+     +   F  H   V     
Sbjct: 57  VPVRSYKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAI 116

Query: 321 HPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTSPRD 366
             N  +  IS   D T+R+W+ + +         D +T +  +P++
Sbjct: 117 DANSSK-IISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPKN 161

>Scas_720.95
          Length = 515

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 35/57 (61%), Gaps = 4/57 (7%)

Query: 286 ILTTSMDKTARLWHCDR--PKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLW 340
           ++T + D TAR+W CD   PKA  +  H ++V C  + PN +    +G +D+T+RLW
Sbjct: 159 MVTGAGDNTARIWDCDTQTPKA-TLTGHFNWVLCVSYCPNGE-VIATGSMDNTIRLW 213

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 48/234 (20%), Positives = 86/234 (36%), Gaps = 48/234 (20%)

Query: 242 EEPEQPIGPASM--DLYAPVFHPLPFRIYQEHTQDILDLDWSKNGFILTTSMDKTARLWH 299
           ++P  PI P  +  +LY+ +  P  +R     T+DI+ L ++         + +++    
Sbjct: 86  KKPTDPIQPIDITDNLYSSILKP-GYRT----TEDIITLIYTPRAVFKVKPVTRSSS--- 137

Query: 300 CDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITA 359
                   +  H   + C+ F PN     ++G  D+T R+W                   
Sbjct: 138 -------AIAGHGSTILCSAFAPNTSSRMVTGAGDNTARIW------------------- 171

Query: 360 IDTSPRDGKYTAAGTFNGHIIILYTRGLEMVS------TFHVLEKPNGTTKKVPESG--P 411
            D   +  K T  G FN  + + Y    E+++      T  + +  +G        G   
Sbjct: 172 -DCDTQTPKATLTGHFNWVLCVSYCPNGEVIATGSMDNTIRLWDSKDGKPLGDALRGHLK 230

Query: 412 KITGIEF---FKSAPDNDLRIMVTSNDSRIRIFRIKGQSLLEVLKGFENTHSQI 462
            IT + +       P    R+   S D  IRI+ I  +  L  + G  N+ S I
Sbjct: 231 WITSLAWEPIHLVKPGESPRLASASKDGTIRIWDITRRVCLYTMSGHTNSVSCI 284

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 65/336 (19%), Positives = 117/336 (34%), Gaps = 93/336 (27%)

Query: 178 VWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVG 237
           V    +  +G+ +ATG  D T+R+W             S   KP    +   +       
Sbjct: 189 VLCVSYCPNGEVIATGSMDNTIRLW------------DSKDGKPLGDALRGHL----KWI 232

Query: 238 RSVKEEPEQPIGPASMDLYAPVFHPLPFRIY-----------QEHTQDILDLDWSKNGFI 286
            S+  EP   + P      A        RI+             HT  +  + WS  G I
Sbjct: 233 TSLAWEPIHLVKPGESPRLASASKDGTIRIWDITRRVCLYTMSGHTNSVSCIKWSGQGII 292

Query: 287 LTTSMDKTARLWHCDRPK----------------------ALKV--FTH----------- 311
            + S DKT R+W  +                         AL+V  F H           
Sbjct: 293 YSGSHDKTVRVWDMNADGKCINILKSHAHWVNHLSLSTDYALRVGAFDHTGAQPASAKDA 352

Query: 312 -----PDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCG--DIITAIDTSP 364
                 ++    K +   +   ++   D T+ LW+ L ++       G   ++  +  SP
Sbjct: 353 RDKALANYEKVVKKNGKLEELMVTASDDFTMFLWNPLKSNKPIARMTGHQKLVNHVAFSP 412

Query: 365 RDGKYTAAGTFNGHIIILYTRGLEMVSTF--HVLEKPNGTTKKVPESGPKITGIEFFKSA 422
            DG+Y  + +F+  I +   R  + +STF  HV                       ++ A
Sbjct: 413 -DGRYIVSASFDNSIKLWDGRDGKFISTFRGHVA--------------------SVYQVA 451

Query: 423 PDNDLRIMVT-SNDSRIRIFRIKGQSLLEVLKGFEN 457
              D R++V+ S D+ ++++ ++ + L   L G ++
Sbjct: 452 WSADCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKD 487

>KLLA0E11297g complement(994770..996308) similar to sp|P38262
           Saccharomyces cerevisiae YBR103w SIF2 SIR4P interacting
           protein, start by similarity
          Length = 512

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 59/137 (43%), Gaps = 6/137 (4%)

Query: 249 GPASMDLYAPVFHPLPFRIYQEHTQDILDLDWSK-NGFILTTSMDKTARLWHCDRPKALK 307
           GP    L   + +  P      HT  I  L+++K N  +L+ S D T ++W      A  
Sbjct: 317 GPGGSLLVYTIGNNKPLGRLLGHTSTITTLEFNKSNKSLLSASDDNTIKVWRGGNSSAAN 376

Query: 308 VFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYC-GDIITAIDTSPR 365
            FT H   ++ A  H  +D   IS   D T+++WSI  NS+  +     + I     SP 
Sbjct: 377 DFTDHTKTISSA--HWINDDLIISTAYDGTVKVWSISKNSIVAEASLDSEPIFEASLSP- 433

Query: 366 DGKYTAAGTFNGHIIIL 382
           D  +   GT  G  I+ 
Sbjct: 434 DRNWLTVGTLQGSAIVF 450

>Kwal_23.6240
          Length = 913

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 41/73 (56%), Gaps = 8/73 (10%)

Query: 264 PF---RIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCD-RPKALKVFT---HPDFV 315
           PF   R++  H  +I+ L WS++  F+++TS D TAR+W  D + K L   T   H D+V
Sbjct: 135 PFVRHRVHAGHFSNIISLTWSRDSRFLISTSKDLTARIWSLDSQEKGLASVTFAGHRDYV 194

Query: 316 TCAKFHPNDDRFF 328
             A F  + +R +
Sbjct: 195 MGAFFSADQERIY 207

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 57/164 (34%), Gaps = 53/164 (32%)

Query: 268 YQEHTQDILDLDWSKNGFIL-TTSMDKTARLWHCDRPKALKVFT---------------- 310
           +QEHT  +  L ++K G +L + S+D T R W   R +  + FT                
Sbjct: 379 FQEHTAAVSALAFAKRGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSG 438

Query: 311 -----------------------------HPDFVTCAKFHPNDDRFFISGCLDHTLRLWS 341
                                        H   V+C  F   ++    S   D T+R+WS
Sbjct: 439 EVVCAGSVDSFAVHVWSVQTGQLVETLDGHEGPVSCLSF-SQENSVLASASWDKTIRIWS 497

Query: 342 ILDNSVS---FDYYCGDIITAIDTSPRDGKYTAAGTFNGHIIIL 382
           I   S      + Y    + ++   P DG   AA T +G I+  
Sbjct: 498 IFGRSQQVEPLEVYAD--VLSLSVRP-DGNEVAAATLDGQILFF 538

>YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential
           protein required for cell separation, has eight WD
           (WD-40) repeats, component of U3 snoRNP (also called
           small subunit processome), which is required for 18S
           rRNA biogenesis [2772 bp, 923 aa]
          Length = 923

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 40/73 (54%), Gaps = 8/73 (10%)

Query: 264 PF---RIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCD-RPKALKVFT---HPDFV 315
           PF   R++  H QDI  L WS++  FILTTS D +A++W  D   K L   T   H D+V
Sbjct: 135 PFVRHRVHAGHFQDITSLTWSQDSRFILTTSKDLSAKIWSVDSEEKNLAATTFNGHRDYV 194

Query: 316 TCAKFHPNDDRFF 328
             A F  + ++ +
Sbjct: 195 MGAFFSHDQEKIY 207

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 42/79 (53%), Gaps = 5/79 (6%)

Query: 268 YQEHTQDILDLDWSKNGFIL-TTSMDKTARLWHCDRPKALKVFTHPDFV--TCAKFHPND 324
           ++EHT  +  + ++K G ++ ++S+D T R W   R +  + FT  + +   C    P+ 
Sbjct: 383 FEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSG 442

Query: 325 DRFFISGCLDH-TLRLWSI 342
           +    +G LD+  + +WS+
Sbjct: 443 E-VVCAGSLDNFDIHVWSV 460

>YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the
           trimeric G protein that mediates signal transduction by
           pheromones, member of the WD (WD-40) repeat family [1272
           bp, 423 aa]
          Length = 423

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 62/245 (25%), Positives = 97/245 (39%), Gaps = 21/245 (8%)

Query: 182 KFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVGRSVK 241
           ++SRD K + +  +D  + +W   AS L++N    A        +S  + PS T+  S  
Sbjct: 99  RWSRDSKRILSASQDGFMLIWDS-ASGLKQN----AIPLDSQWVLSCAISPSSTLVASAG 153

Query: 242 EEPEQPIGPASMDLYAPVFHPLPFRIYQEHTQDILDLDWSKNGFILTTSMDKTARLWHCD 301
                 I   S +    V   +   I++ HT  I D++++ N  ILT S D T  LW  D
Sbjct: 154 LNNNCTIYRVSKE--NRVAQNVA-SIFKGHTCYISDIEFTDNAHILTASGDMTCALW--D 208

Query: 302 RPKALKVFTHPDFV--TCAKFHP------NDDRFFISGCLDHTLRLWSILDNSVSFDYYC 353
            PKA +V  + D +    A   P      N    F S   D    +W     S    +Y 
Sbjct: 209 IPKAKRVREYSDHLGDVLALAIPEEPNSENSSNTFASCGSDGYTYIWDSRSPSAVQSFYV 268

Query: 354 GDIITAIDTSPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVLEKPNGTTKKVPESGPKI 413
            D         +DG    AG+ NG I +   R    ++TF +     G  ++ P      
Sbjct: 269 NDSDINALRFFKDGMSIVAGSDNGAINMYDLRSDCSIATFSLFR---GYEERTPTPTYMA 325

Query: 414 TGIEF 418
             +E+
Sbjct: 326 ANMEY 330

>YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein of
           unknown function, member of WD (WD-40) repeat family
           [1548 bp, 515 aa]
          Length = 515

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 286 ILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLW 340
           ++T + D TAR+W CD    +     H ++V C  + P D     +G +D+T+RLW
Sbjct: 159 MVTGAGDNTARIWDCDTQTPMHTLKGHYNWVLCVSWSP-DGEVIATGSMDNTIRLW 213

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 66/336 (19%), Positives = 122/336 (36%), Gaps = 93/336 (27%)

Query: 178 VWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVG 237
           V    +S DG+ +ATG  D T+R+W     P     L  A  +  +K I+          
Sbjct: 189 VLCVSWSPDGEVIATGSMDNTIRLW----DPKSGQCLGDA-LRGHSKWIT---------- 233

Query: 238 RSVKEEPEQPIGPASMDLYAPVFHPLPFRIYQE-----------HTQDILDLDWSKNGFI 286
            S+  EP   + P S    A        +I+             HT  +  + W   G +
Sbjct: 234 -SLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGLL 292

Query: 287 LTTSMDKTARLW------HC------------------DRPKALKVFTHP---------- 312
            + S D+T R+W       C                  D    +  F H           
Sbjct: 293 YSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEA 352

Query: 313 ------DFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCG--DIITAIDTSP 364
                 ++    K + N +   ++   D+T+ LW+ L ++       G   ++  +  SP
Sbjct: 353 QKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSP 412

Query: 365 RDGKYTAAGTFNGHIIILYTRGLEMVSTF--HVLEKPNGTTKKVPESGPKITGIEFFKSA 422
            DG+Y  + +F+  I +   R  + +STF  HV                       ++ A
Sbjct: 413 -DGRYIVSASFDNSIKLWDGRDGKFISTFRGHV--------------------ASVYQVA 451

Query: 423 PDNDLRIMVT-SNDSRIRIFRIKGQSLLEVLKGFEN 457
             +D R++V+ S D+ ++++ ++ + L   L G ++
Sbjct: 452 WSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKD 487

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 53/124 (42%), Gaps = 3/124 (2%)

Query: 252 SMDLYAPVFHPLPFRIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVFT 310
           +M L+ P+    P      H + +  + +S +G +I++ S D + +LW     K +  F 
Sbjct: 382 TMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFR 441

Query: 311 HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYC-GDIITAIDTSPRDGKY 369
                       +D R  +S   D TL++W +    +S D     D +  +D S  DGK 
Sbjct: 442 GHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWS-VDGKR 500

Query: 370 TAAG 373
             +G
Sbjct: 501 VCSG 504

>CAGL0E02805g complement(265137..267659) similar to sp|P32479
           Saccharomyces cerevisiae YBL008w HIR1 histone
           transcription regulator, start by similarity
          Length = 840

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 82/196 (41%), Gaps = 36/196 (18%)

Query: 172 ENSDRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVP 231
           E+ D  ++    S DGK +ATGG D  +R+W V A       +S+A  +    R + R  
Sbjct: 14  ESRDYEIYTVDVSPDGKRVATGGLDGKIRIWSVDAL------VSAAAGESGVDRDTHR-- 65

Query: 232 PSPTVGR------SVKEEPE-QPIGPASMDLYAPVF------HPLPFRIYQE-------- 270
           P  ++ R       VK  P+   +   S D    ++      H   F    E        
Sbjct: 66  PLASMSRHTGSVTCVKFSPDGNYLASGSDDRILLIWAMDEENHGGSFGSEGEKEHWTVRK 125

Query: 271 ----HTQDILDLDWSKNGFIL-TTSMDKTARLWHCDRPKALKVF-THPDFVTCAKFHPND 324
               H  DI D+ W+ +  IL T  +D++  +W+    + LK F  H   V    F P  
Sbjct: 126 RLVAHDNDIQDICWAPDSSILVTVGLDRSVIVWNGLNFERLKRFDVHQSLVKGVIFDPA- 184

Query: 325 DRFFISGCLDHTLRLW 340
           +++F +   D T+R++
Sbjct: 185 NKYFATASDDRTMRVF 200

>KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777.1
           Kluyveromyces lactis CRN1 homologue, start by similarity
          Length = 707

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 61/144 (42%), Gaps = 20/144 (13%)

Query: 267 IYQEHTQDILDLDWS--KNGFILTTSMDKTARLWHC-------------DRPKALK---- 307
           +++ HT  +LD D+S   +  + + S D    +W                 PK LK    
Sbjct: 88  LFRGHTAQVLDTDFSPFNDHIVASGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDLKPVRM 147

Query: 308 VFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTSPRDG 367
           +  H   V    FHP  +    S  LD+T+++W I    V F     D++T++  S  DG
Sbjct: 148 LSGHSRKVGHLLFHPLAENILASSSLDYTVKIWDISQEEVKFTLKHPDMVTSMSFS-YDG 206

Query: 368 KYTAAGTFNGHIIILYTRGLEMVS 391
           K+    + +  + +   R  ++VS
Sbjct: 207 KHLVTVSRDKKLRVWDVRAEKIVS 230

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 24/45 (53%)

Query: 178 VWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQ 222
           V +  FS DGK++ T  +D  LRVW V A  +     + + AK Q
Sbjct: 197 VTSMSFSYDGKHLVTVSRDKKLRVWDVRAEKIVSEGPAHSGAKNQ 241

>Kwal_23.6324
          Length = 514

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 283 NGFILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLW 340
           +G ++T S D TAR+W C+    +     H ++V C  + P D     +G +D+T+RLW
Sbjct: 155 SGRMVTGSGDNTARIWDCNTNTPMYTLKGHFNWVLCVAWCP-DGELIATGSMDNTIRLW 212

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 37/86 (43%), Gaps = 9/86 (10%)

Query: 264 PFRIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKAL--KVFTHPDFVTCAKF 320
           P    + H   +L + W  +G  I T SMD T RLW  ++ ++    +  H  ++T   +
Sbjct: 177 PMYTLKGHFNWVLCVAWCPDGELIATGSMDNTIRLWDSNKGESYGEALRGHAKWITSLTW 236

Query: 321 HP------NDDRFFISGCLDHTLRLW 340
            P       D     S   D T+++W
Sbjct: 237 EPMHLVKAGDQPRLASASKDGTIKIW 262

>CAGL0K09284g 914937..917672 highly similar to sp|P25635
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 38/75 (50%), Gaps = 6/75 (8%)

Query: 260 FHPLP-FRIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVFT----HPD 313
           F P   +R++  H QDI    WS +  F+LTTS D T+R+W  +      V T    H D
Sbjct: 133 FAPFVRYRVHAGHFQDITSFTWSHDSRFLLTTSKDLTSRVWSINSEDKELVATTLAGHRD 192

Query: 314 FVTCAKFHPNDDRFF 328
           +V  A F+   ++ +
Sbjct: 193 YVLGAYFNSTQEKIY 207

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 65/162 (40%), Gaps = 49/162 (30%)

Query: 268 YQEHTQDILDLDWSKNGFIL-TTSMDKTARLWHCDRPKALKVFTHPDFV--TCAKFHPND 324
           ++EHT  +  + ++K G +L + S+D T R W   R +  +VFT  + V  TC    P+ 
Sbjct: 379 FEEHTSAVTAVQFAKKGQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCLAVEPSG 438

Query: 325 -----------DRFF-----------ISG------CL--------------DHTLRLWSI 342
                      D F            +SG      CL              D T+R+WSI
Sbjct: 439 EVVSAGSTDSFDVFVWSVQTGQLLDTLSGHEGPVSCLAFSMENAVLASASWDKTIRIWSI 498

Query: 343 LDNSVSFD--YYCGDIITAIDTSPRDGKYTAAGTFNGHIIIL 382
              S   +      DI+ AI  +P DGK+ A  T  G + I 
Sbjct: 499 FGRSQQVEPLEVFADIL-AITITP-DGKHVAVSTLKGQLTIF 538

>Sklu_2173.2 YCR072C, Contig c2173 2732-4279
          Length = 515

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 286 ILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLW 340
           ++T + D TAR+W C+    +     H ++V C  + P D     +G +D+T+RLW
Sbjct: 159 MITGAGDNTARIWDCNTQTPMSTLKGHFNWVLCVSWSP-DGELIATGSMDNTIRLW 213

 Score = 30.0 bits (66), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 53/124 (42%), Gaps = 3/124 (2%)

Query: 252 SMDLYAPVFHPLPFRIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVFT 310
           +M L+ P+    P      H + +  + +S +G  I++ S D + +LW+    K +  F 
Sbjct: 382 TMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWNGRDGKFISTFR 441

Query: 311 HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYC-GDIITAIDTSPRDGKY 369
                       +D R  +S   D TL++W +    ++ D     D +  +D S  DGK 
Sbjct: 442 GHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTKKLAVDLPGHKDEVYTVDWS-VDGKR 500

Query: 370 TAAG 373
             +G
Sbjct: 501 VCSG 504

>Scas_512.3
          Length = 534

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 83/176 (47%), Gaps = 21/176 (11%)

Query: 175 DRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSP 234
           ++A+   KF+  G  +A+ G D  + +WK      + N+ +  TA P    +     P P
Sbjct: 67  EQAINVVKFNSPGTILASAGDDGQILLWK----QQDVNEQNGETAAPVDSSV-----PKP 117

Query: 235 TVGRSVKEEPEQPIGPASMDLYAPVFHPLPFRIYQEHTQDILDLDWSK-NGFILTTSMDK 293
             G + +++ E      S  ++  +  P        ++ +I DLDWS  + ++++ SMD 
Sbjct: 118 -FGSTFEDDEEN--NKESWFVWKRLRAP------GSNSSEIYDLDWSPCDRYVVSGSMDN 168

Query: 294 TARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVS 348
           + R++  +  K L  +  H  +V    + P ++ F +S   D ++ ++ I+ +S S
Sbjct: 169 SIRVFDIESGKLLGTYADHNHYVQGVTWDPLNE-FILSQSADRSVNIYQIIWDSDS 223

>CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces
           cerevisiae YDR267c, start by similarity
          Length = 337

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/189 (22%), Positives = 81/189 (42%), Gaps = 17/189 (8%)

Query: 265 FRIYQEHTQDILDLDW-SKNGFILTTSMDKTARLW--HCDRPKALKVFT-HPDFVTCAKF 320
             + QEH+QD+  + W +K+  + ++S D T R+W  + D  +   V T H   + C+ F
Sbjct: 150 ISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDF 209

Query: 321 HPNDDRF-FISGCLDHTLRLWSIL--DNSVSFDYYCGDIITAIDTSPRDGKYTAAGTFNG 377
              +D     SG  D T+R+W  +  D     ++ C    + +  + R   Y  A + +G
Sbjct: 210 SKEEDPIRLCSGSDDSTVRVWKYIGDDEDDQQEWVCE---STLPNAHRSQIYGVAWSPSG 266

Query: 378 HIIILYTRGL-----EMVSTFHVLEKPNGTTKKVPESGPKITGIEFFKSAPDNDLRIMVT 432
            I  +   G+     E  +   V E     T K   +  +I  +++     D    ++  
Sbjct: 267 RIASVGADGVLAVYKEKQNDSEVSEWEISATYKAAHTVYEINTVKWVN--IDGKEMLITA 324

Query: 433 SNDSRIRIF 441
            +D R+ ++
Sbjct: 325 GDDGRVNLW 333

>Scas_719.52
          Length = 628

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 286 ILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDN 345
           + ++S+D T +LW+ +  +A+    HPD VT   F    +    + C D  LR+W I + 
Sbjct: 156 LASSSLDYTVKLWNIETGEAVITLKHPDMVTSMSFSYGGNH-LATVCRDKKLRVWDIREG 214

Query: 346 SV 347
            +
Sbjct: 215 KI 216

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 25/116 (21%), Positives = 46/116 (39%), Gaps = 19/116 (16%)

Query: 267 IYQEHTQDILDLDWS--KNGFILTTSMDKTARLWHCDRPKALKVFTHPDF---------- 314
           +++ HT  +LD D+    +  I ++S D    +W      + + +  PD           
Sbjct: 76  LFRGHTAQVLDTDFDPFNDHIIASSSDDSKIGIWKIPEDYSFQHYLDPDGEPKNIKPVKF 135

Query: 315 -------VTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTS 363
                  V    FHP  +    S  LD+T++LW+I            D++T++  S
Sbjct: 136 LSGHSRKVGHVLFHPVAENVLASSSLDYTVKLWNIETGEAVITLKHPDMVTSMSFS 191

>Kwal_27.12586
          Length = 509

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 68/162 (41%), Gaps = 18/162 (11%)

Query: 264 PFRIYQEHTQDILDLDW-SKNGFILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHP 322
           P      H+  I   D+ S+N  +L+ S DKT R+W      +   F        + F  
Sbjct: 327 PLGKLNGHSATITAFDFNSENNMLLSGSDDKTLRVWRSGSLSSSNCFMGNTLGITSAFWI 386

Query: 323 NDDRFFISGCLDHTLRLWSILDNSV-------SFDYYCGDIITAIDTSPRDGKYTAAGTF 375
           +DD+  I+  LD ++RLWS L N++           +CG +      SP   K+ A G  
Sbjct: 387 DDDK-VIATSLDGSVRLWSHLTNTLQAISMVDGVPIFCGSL------SPDKLKF-AIGKM 438

Query: 376 NGHIIILYTRGLEMVSTFHVLEKPNGTTKKVPESGPKITGIE 417
           +G + +      ++++T   +     +   +P  G   + IE
Sbjct: 439 DGEVTVYNIE--KLLATLKSIADVGNSPISIPIYGDYQSNIE 478

>Kwal_27.11585
          Length = 823

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 67/144 (46%), Gaps = 21/144 (14%)

Query: 210 ERNDLSSATAKPQAKRISMRVPPSPTVGRSVKEEPEQPIGPASMDLYAPVFHPLPFRIYQ 269
           E + L+ AT  P     ++RV  +P    +  E+ ++P   + +D+   +  PL   +Y+
Sbjct: 347 ELDKLALATNSP-----ALRVITAPVTKHNAAEKEDEP--TSKVDIQNCL--PLEVELYE 397

Query: 270 EHTQDILDLDWSKNG-FILTTSMDKTARLWHC----DRPKALKVFT-HPDFVTCAKFHPN 323
            HT  +  LD S+NG ++ T S D T  LW      ++ K    FT H   VT     PN
Sbjct: 398 GHTDLLNSLDSSENGEWLATCSKDHTVILWKLNADSEKFKPYARFTGHAGPVTAVGL-PN 456

Query: 324 DDR-----FFISGCLDHTLRLWSI 342
             R     F I+   D T++ WS+
Sbjct: 457 VMRNTWPEFIITASNDLTIKKWSV 480

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 74/186 (39%), Gaps = 36/186 (19%)

Query: 184 SRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVG--RSVK 241
           S +G+++AT  KD T+ +WK+ A         S   KP A R +    P   VG    ++
Sbjct: 409 SENGEWLATCSKDHTVILWKLNA--------DSEKFKPYA-RFTGHAGPVTAVGLPNVMR 459

Query: 242 EEPEQPIGPASMDLYAPVF------------HPLPFRIY--QEHTQDILDLDWSKNGFIL 287
               + I  AS DL    +            H +    Y  + H +DI  L  S N  + 
Sbjct: 460 NTWPEFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSISPNDSVF 519

Query: 288 -TTSMDKTARLWHCDRPKALKVFTHP-----DFVTCAKFHPNDDRFFISGCLDHTLRLWS 341
            T S DKT ++W+ D  +      +      D   C       D+   +   D T+++WS
Sbjct: 520 ATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQY-----DKLLATCSGDKTIKVWS 574

Query: 342 ILDNSV 347
           +   SV
Sbjct: 575 LESMSV 580

>Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement
          Length = 1261

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 39/79 (49%), Gaps = 3/79 (3%)

Query: 267 IYQEHTQDILDLDWSKN--GFILTTSMDKTARLWHCDRPKALKVF-THPDFVTCAKFHPN 323
           + Q H++ IL LDW K     +L++  D T  LW+    + L  F T  ++    KF P 
Sbjct: 246 MSQGHSKGILSLDWCKQDENLLLSSGRDNTCALWNPQTAQKLSQFPTRGNWCFKTKFAPE 305

Query: 324 DDRFFISGCLDHTLRLWSI 342
               F S  LD+ +++ ++
Sbjct: 306 APDLFASASLDNKIQVQTL 324

>Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement
          Length = 509

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 59/131 (45%), Gaps = 6/131 (4%)

Query: 281 SKNGFILTTSMDKTARLWHCDRPKALKVF-THPDFVTCAKFHPNDDRFFISGCLDHTLRL 339
           S N  +L+ S DKT R W      +   F  H   +T A +  +DDR  IS  +D ++R+
Sbjct: 346 SDNKLLLSASDDKTLRTWRGGNANSSNCFYGHTQSITYADW-LDDDR-LISTSMDGSVRV 403

Query: 340 WSILDNSVSFDYYCGDIITAIDTSPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVLEKP 399
           WS+  N++        +     T   D +  A GT +G + +   +  +++      EKP
Sbjct: 404 WSVKQNALVGLSVVDGVPIFCGTLSSDKQKFATGTLDGEVSVYNVK--KLLEVLDADEKP 461

Query: 400 NGTTKKVPESG 410
            G   ++P  G
Sbjct: 462 IGPV-RIPTIG 471

 Score = 33.5 bits (75), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 4/77 (5%)

Query: 268 YQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFTHPDFVT--CAKFHPNDD 325
           +  HTQ I   DW  +  +++TSMD + R+W   +  AL   +  D V   C     +D 
Sbjct: 374 FYGHTQSITYADWLDDDRLISTSMDGSVRVWSV-KQNALVGLSVVDGVPIFCGTL-SSDK 431

Query: 326 RFFISGCLDHTLRLWSI 342
           + F +G LD  + ++++
Sbjct: 432 QKFATGTLDGEVSVYNV 448

>AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH]
           (134760..136127) [1368 bp, 455 aa]
          Length = 455

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/163 (20%), Positives = 74/163 (45%), Gaps = 25/163 (15%)

Query: 186 DGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRIS-MRVPPSPTVGRSVKEEP 244
           DG ++ +GG D  +++W + ++  E         +  A R+S ++V PS  +  S     
Sbjct: 226 DGNHLLSGGGDNLVKLWDMTSNSFEE-------LRGHAGRVSRVKVHPSGRLAAS----- 273

Query: 245 EQPIGPASMDLYAPVF---HPLPFRIYQEHTQDILDLDWSKNGFILTTS-MDKTARLWHC 300
                 AS DL   ++     +  ++ + H++ +  + +  +G +L ++ +D    +W  
Sbjct: 274 ------ASFDLTWILWDLERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDL 327

Query: 301 DRPK-ALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI 342
              +  +K+  H   ++   + PN  +   +G  D T+R+W I
Sbjct: 328 RSGEPIMKLEGHAGAISGVDWSPNGYQLATAGA-DGTVRVWDI 369

>YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription
           inhibitor, required for periodic repression of 3 of the
           4 histone gene loci and for autogenous repression of
           HTA1-HTB1 locus by H2A and H2B, member of WD (WD-40)
           repeat family [2523 bp, 840 aa]
          Length = 840

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 80/191 (41%), Gaps = 32/191 (16%)

Query: 178 VWATKFSRDGKYMATGGKDCTLRVWKV--IASPLERNDLSSATAKPQAKRISM----RVP 231
           ++    S DGK +ATGG D  +R+W +  I   +E   L+     PQ  ++ +    R  
Sbjct: 20  IYTVDVSHDGKRLATGGLDGKIRIWSIDSILRCMELESLTPEIPLPQDLQMPLCSMSRHT 79

Query: 232 PSPTVGRSVKEEPEQPIGPASMD-----LYA--------PVF-------HPLPFRIYQEH 271
            S T    VK  P+     +  D     ++A        P F       H    +    H
Sbjct: 80  GSITC---VKFSPDGKYLASGSDDRILLIWALDEEQSSQPAFGSEHEREHWTVRKRLVAH 136

Query: 272 TQDILDLDWSKNGFIL-TTSMDKTARLWHCDRPKALKVF-THPDFVTCAKFHPNDDRFFI 329
             DI D+ W+ +  IL T  +D++  +W+    + LK F  H   V    F P  +++F 
Sbjct: 137 DNDIQDICWAPDSSILVTVGLDRSVIVWNGSTFEKLKRFDVHQSLVKGVVFDPA-NKYFA 195

Query: 330 SGCLDHTLRLW 340
           +   D T++++
Sbjct: 196 TTSDDRTMKIF 206

>YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-binding
           protein, inhibits ARP2/3-stimulated actin nucleation,
           contains WD (WD-40) repeats [1956 bp, 651 aa]
          Length = 651

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 1/62 (1%)

Query: 286 ILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDN 345
           + ++S D T +LW+ +  K +    HPD VT   F   D  +  +   D  LR+W+I + 
Sbjct: 156 LASSSGDYTVKLWNVETGKDMITLKHPDMVTSMSFS-YDGNYLATVARDKKLRVWNIREE 214

Query: 346 SV 347
            +
Sbjct: 215 KI 216

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 58/144 (40%), Gaps = 20/144 (13%)

Query: 267 IYQEHTQDILDLDWS--KNGFILTTSMDKTARLW----------HCDRP------KALKV 308
           +++ HT  +LD D+    +  I + S D    +W          H D        K +K 
Sbjct: 76  LFRGHTAQVLDTDFDPFNDHRIASGSDDSKIGIWDIPENYKFHDHVDEDGEPIDIKPVKF 135

Query: 309 FT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTSPRDG 367
            T H   V    +HP  +    S   D+T++LW++            D++T++  S  DG
Sbjct: 136 LTGHARKVGHVLYHPVAENVLASSSGDYTVKLWNVETGKDMITLKHPDMVTSMSFS-YDG 194

Query: 368 KYTAAGTFNGHIIILYTRGLEMVS 391
            Y A    +  + +   R  ++VS
Sbjct: 195 NYLATVARDKKLRVWNIREEKIVS 218

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 178 VWATKFSRDGKYMATGGKDCTLRVWKV 204
           V +  FS DG Y+AT  +D  LRVW +
Sbjct: 185 VTSMSFSYDGNYLATVARDKKLRVWNI 211

>Kwal_55.21559
          Length = 351

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 75/176 (42%), Gaps = 8/176 (4%)

Query: 265 FRIYQEHTQDILDLDW-SKNGFILTTSMDKTARLWHCDRPK---ALKVFTHPDFVTCAKF 320
             + QEH QD+  + W S+   + ++S D T RLW  D      A  +  H   V C+ F
Sbjct: 168 LSVLQEHAQDVKHVVWHSEMHLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDF 227

Query: 321 HPNDDRFFISGCLDH-TLRLWSILDNSVSFDYYCGDIITAIDTSPRDGKYTAAGTFNGHI 379
             ++    ++ C D  T+R+W+ ++   + +          +   R   Y+ + + +G+I
Sbjct: 228 EKSESSLRLASCSDDSTVRVWNYVEEEENGEDVWAQEAILPNVHSR-AVYSVSWSLDGYI 286

Query: 380 IILYTRGLEMVSTFHVLEKPNGTTKKVPESGPKITGIEFFKSAPDNDLRIMVTSND 435
             + + GL +V  +  ++K              I  I   K A  +D  +++T  D
Sbjct: 287 ASVGSDGLLVV--YKEVKKGEWEVVVQQHEAHGIYEINVVKWATVDDSVLLLTGGD 340

>KLLA0C08976g 784536..787271 highly similar to sgd|S0000653
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 39/75 (52%), Gaps = 6/75 (8%)

Query: 260 FHPLP-FRIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPK---ALKVFT-HPD 313
           F P   +RI+  H  DI  L WSK+  FI++TS D TAR+W  +  +   A   F  H D
Sbjct: 133 FAPFVRYRIHAGHFSDITSLTWSKDSRFIISTSKDLTARIWSVNSEEKNLASTTFAGHRD 192

Query: 314 FVTCAKFHPNDDRFF 328
            V  A F  + ++ +
Sbjct: 193 NVIGAYFSDDQEKIY 207

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 32/162 (19%), Positives = 57/162 (35%), Gaps = 49/162 (30%)

Query: 268 YQEHTQDILDLDWSKNGFIL-TTSMDKTARLWHCDRPKALKVFT---------------- 310
           + EH   +  ++++K G +L + S+D T + W   R +  + FT                
Sbjct: 379 FDEHAGGVSAVEFAKKGQVLFSASLDGTVKAWDLIRYRNFRTFTATERIQFNSLAVDPSG 438

Query: 311 -----------------------------HPDFVTCAKFHPNDDRFFISGCLDHTLRLWS 341
                                        H   ++C  F  N++    S   D T+R+WS
Sbjct: 439 EVVCAGSEDSFDIFVWSVQTGQLVDTLSGHEGPISCLSF-SNENGVLASASWDKTIRVWS 497

Query: 342 ILDNSVSFD-YYCGDIITAIDTSPRDGKYTAAGTFNGHIIIL 382
           +   S   + +     + +I   P DG+  AA T  G I+  
Sbjct: 498 LFGRSQQVEPFEVFSDVLSISMKP-DGQQIAASTLAGQILFF 538

>ADR090W [1831] [Homologous to ScYDL195W (SEC31) - SH]
           complement(868744..872445) [3702 bp, 1233 aa]
          Length = 1233

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 47/94 (50%), Gaps = 6/94 (6%)

Query: 263 LPFRIY-QEHTQDILDLDWSKNG--FILTTSMDKTARLWHCDRPKALKVF-THPDFVTCA 318
           +P ++  Q H++ IL LDW K+    +L++  D T  LW+ +  + L  + T  ++    
Sbjct: 240 MPLQVMSQGHSKGILSLDWCKHDEKLMLSSGRDNTCILWNPEEAQKLTQYPTRGNWCFKT 299

Query: 319 KFHPNDDRFFISGCLDHTLRLWSI--LDNSVSFD 350
           KF P     F S   D+ +++ ++  L N +  D
Sbjct: 300 KFAPEAPDLFASASFDNKIQVQTLQNLANKLDLD 333

 Score = 33.9 bits (76), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 39/91 (42%), Gaps = 8/91 (8%)

Query: 277 DLDWSKNGFILTTSMDKTARLWHCDRPK--ALKVFTHPDFVTCAKFHPNDDRFFISGCLD 334
           DLDWS++G +L  +++     + C R +    +V  H   V   +F+       +SG   
Sbjct: 66  DLDWSRDGAMLAGALENGVVEFFCARERRSVARVARHTTGVRAVRFNAKQANVAVSGGSQ 125

Query: 335 HTLRLWSILDNSVSFDYYC----GDIITAID 361
             + +W    N +S   Y     G  +T ID
Sbjct: 126 GEIFVWDT--NKISAAGYSPFGPGTAMTPID 154

>YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein
           required in ubiquitin proteolysis and found complexed
           with Cdc48p, has WD (WD-40) repeats [2148 bp, 715 aa]
          Length = 715

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 52/187 (27%), Positives = 79/187 (42%), Gaps = 47/187 (25%)

Query: 269 QEHTQDILD---LDWSKNGFILTTSMDKTARLWHCDRPKALKVFT--HPDFVTCAKFHPN 323
           Q H   + D   + +S+N F LT S DKT +LW  D  K +K F+  H D V        
Sbjct: 134 QAHNASVWDAKVVSFSENKF-LTASADKTIKLWQND--KVIKTFSGIHNDVVR--HLAVV 188

Query: 324 DDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTSPRDGKYTAAGTFNGHIIILY 383
           DD  FIS   D  ++L          D + GD++                T+ GH   +Y
Sbjct: 189 DDGHFISCSNDGLIKL---------VDMHTGDVLR---------------TYEGHESFVY 224

Query: 384 TRGL----EMVS-----TFHVLEKPNGTTKKVPESGPKITGIEFFKSAPDNDLRIMVTSN 434
              L    ++VS     T  +  K NG+ K+V      +  I  +     ++  I+V S+
Sbjct: 225 CIKLLPNGDIVSCGEDRTVRIWSKENGSLKQV----ITLPAISIWSVDCMSNGDIIVGSS 280

Query: 435 DSRIRIF 441
           D+ +RIF
Sbjct: 281 DNLVRIF 287

>CAGL0M02277g complement(271836..273119) highly similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46 Pre-mRNA splicing
           factor PRP46, hypothetical start
          Length = 427

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 70/163 (42%), Gaps = 22/163 (13%)

Query: 286 ILTTSMDKTARLWHCDRPKALKVFTHPD-FVTCAKFHPNDDRFFISGCLDHTLRLW---- 340
           ++++S+D + RLW     K++KV TH    V     HP+ +  F S C +  +R W    
Sbjct: 257 VISSSVDASIRLWDLVAGKSMKVLTHHQRTVRDISVHPS-EFSFASACTN-DIRSWLLPK 314

Query: 341 -SILDNSVSFDYYCGDIITAIDTSPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVLEKP 399
             +L N VS D    D+I  +  +  D  +  AG+ NG +     +      TF   E P
Sbjct: 315 GELLTNFVSQDL---DVINTVSINQDDVLF--AGSDNGSLTFFDYKSGHKYQTFKTKEAP 369

Query: 400 NGTTKKVPESGPKITGIEFFKSAPDNDLRIMVTSNDSRIRIFR 442
                  PES   I    F  +     LR++    D  I+I++
Sbjct: 370 GS-----PESERGILSSTFDGTG----LRLLTGETDRTIKIWK 403

 Score = 30.0 bits (66), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 40/205 (19%), Positives = 78/205 (38%), Gaps = 36/205 (17%)

Query: 291 MDKTARLWHCDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFD 350
           +++T R WH        +  H  +V C      D+ +F +G  D T+++W++    +   
Sbjct: 95  LNQTPR-WHAPWHLTRVIHGHHGWVRCIAMDKVDNEWFATGSNDKTIKIWNLASGKLKVT 153

Query: 351 YYCGDI-ITAIDTSPRD-----------------GKYTAAGTFNGHIIILYTRGLEMVST 392
               D+ +  +  S R                   K TA   ++GH+  ++T  +     
Sbjct: 154 LKAHDMTVRDLAISNRHPYMFSVSEDKTVKCWDLEKNTAIRNYHGHLSGVHTVDIHPTVD 213

Query: 393 FHVLEKPNGTTK------KVP------ESGPKITGIEFFKSAPDNDLRIMVTSNDSRIRI 440
             V    +   K      ++P        GP IT +      P    +++ +S D+ IR+
Sbjct: 214 VVVTAGRDSVVKVWDIRTRLPVMTLPGHKGP-ITKVRCLPVDP----QVISSSVDASIRL 268

Query: 441 FRIKGQSLLEVLKGFENTHSQISAH 465
           + +     ++VL   + T   IS H
Sbjct: 269 WDLVAGKSMKVLTHHQRTVRDISVH 293

>KLLA0D04840g 413362..414273 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8 required for
           transport of permeases from the golgi to the plasma
           membrane, start by similarity
          Length = 303

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 41/205 (20%), Positives = 81/205 (39%), Gaps = 37/205 (18%)

Query: 190 MATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVGRSVKEEPEQPIG 249
           +A+ G D T+R W+ +     R   +   A  Q  R+ +                ++   
Sbjct: 5   LASAGYDHTIRFWEALTGVCSR---TIQHADSQVNRLEI--------------TSDKKYL 47

Query: 250 PASMDLYAPVF-----HPLPFRIYQEHTQDILDLDWSK-NGFILTTSMDKTARLWHCDRP 303
            A+  L+  ++     +P P   ++ H  ++  + + + N +++++S D T ++W    P
Sbjct: 48  AAAGHLHVRLYDIRSNNPNPVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSP 107

Query: 304 KALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTS 363
              + + H   V     HPN     IS   D  +R+W + +N       C + +T  D +
Sbjct: 108 SVQRNYKHNAPVNEVAIHPNQGE-LISCDQDGNIRIWDLGENQ------CTNQLTPEDNT 160

Query: 364 P-------RDGKYTAAGTFNGHIII 381
           P        DG    AG   G+  +
Sbjct: 161 PLQSLSVASDGSMLVAGNNKGNCYV 185

 Score = 33.1 bits (74), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 4/82 (4%)

Query: 264 PFRIYQEHTQDILDLDWSKN-GFILTTSMDKTARLWHCDRPKALKVFT--HPDFVTCAKF 320
           P   ++ HT+ I  +  S +   + T S D TAR+W+ +    L+     H  +V    F
Sbjct: 199 PVTKFKSHTKYITRVLLSADVKHLATCSADHTARVWNIEDNFELETTLDGHQRWVWDCAF 258

Query: 321 HPNDDRFFISGCLDHTLRLWSI 342
              D  + ++ C DH +RLW +
Sbjct: 259 SA-DSAYLVTACSDHYVRLWDL 279

>Scas_605.18
          Length = 424

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 56/262 (21%), Positives = 106/262 (40%), Gaps = 22/262 (8%)

Query: 182 KFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVGRSVK 241
           ++SRD K + +  +D  + +W   AS L+RN    A        +S  + PS  +  S  
Sbjct: 98  RWSRDSKSILSASQDGFMLIWDT-ASGLKRN----AIPLDSQWVLSCALSPSGNLAASAG 152

Query: 242 EEPEQPIGPASMDLYAPVFHPLPFRIYQEHTQDILDLDWSKNGFILTTSMDKTARLWHCD 301
                 I   S +            I++ HT  I D+++  N  I+T+S D T  LW  D
Sbjct: 153 LNNNCTIYRVSKE---NRVQQNVVSIFKGHTCYISDIEFLDNSHIITSSGDMTCALW--D 207

Query: 302 RPKALKVFTHP----DFVTCAKFHPNDDR-----FFISGCLDHTLRLWSILDNSVSFDYY 352
            PKA +V  +     D +  A   P+ D       F S   D    +W    ++    ++
Sbjct: 208 IPKAKRVREYADHLGDVLALALPPPSADENTGANIFASCGSDGYTYIWDTRTSAAVQKFF 267

Query: 353 CGDIITAIDTSPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVLEKPNGTTKKVPESGPK 412
             D         +DG     G  +G I +   R    ++++ + +   G  K++ +    
Sbjct: 268 ASDTDVNAIQFFKDGNSIVTGGDDGVINMFDLRSDCAIASYSLQQ---GIQKEIRDPTYM 324

Query: 413 ITGIEFFKSAPDNDLRIMVTSN 434
            + +E+ + +P + +   ++S+
Sbjct: 325 SSNMEYSRGSPQSPISTAISSS 346

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 72/172 (41%), Gaps = 24/172 (13%)

Query: 174 SDRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSAT-AKPQAKRISMRVPP 232
           SD  V A +F +DG  + TGG D  + ++ +      R+D + A+ +  Q  +  +R P 
Sbjct: 269 SDTDVNAIQFFKDGNSIVTGGDDGVINMFDL------RSDCAIASYSLQQGIQKEIRDPT 322

Query: 233 SPTVGRSV-KEEPEQPIGPASMDLYAPVFHPLPFRIYQEHTQDILDLDWSKNG-FILTTS 290
             +      +  P+ PI  A    Y                Q ++ LD+S +G  +    
Sbjct: 323 YMSSNMEYSRGSPQSPISTAISSSYL-------------DNQGVVSLDFSNSGRLMFACY 369

Query: 291 MDKTARLWHCDRPKAL-KVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWS 341
            D    +W   + + + K+  H + V+  +  P D     +G  D T+R+WS
Sbjct: 370 TDLGCIIWDVLKAEIVGKLEGHSNRVSSVRTSP-DGLGVCTGSWDSTMRIWS 420

>AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH]
           (799876..800298,800493..801074) [1005 bp, 334 aa]
          Length = 334

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 50/101 (49%), Gaps = 6/101 (5%)

Query: 286 ILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHP----NDDRFFISGCLDHTLRLWS 341
           I++ S DKT ++W+      + +  H D+V+  +  P    +D    IS  +D  +++W 
Sbjct: 138 IVSASRDKTVKVWNTVGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWD 197

Query: 342 ILDNSVSFDYYC-GDIITAIDTSPRDGKYTAAGTFNGHIII 381
           +   ++  D+    + +T +  SP DG   A+   +G II+
Sbjct: 198 LQSFTIEADFIGHNNYVTTVTPSP-DGSIFASAGKDGQIIL 237

 Score = 37.4 bits (85), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 3/89 (3%)

Query: 261 HPLPFRIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCA 318
           + +P R ++ H+  + D   + +G + L+ S DKT RLW     K +K F  H   V   
Sbjct: 70  YGVPVRSFKGHSHIVQDCTVTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSV 129

Query: 319 KFHPNDDRFFISGCLDHTLRLWSILDNSV 347
              P   +  +S   D T+++W+ + + V
Sbjct: 130 SIDPRATQ-IVSASRDKTVKVWNTVGDCV 157

 Score = 33.1 bits (74), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 81/203 (39%), Gaps = 36/203 (17%)

Query: 184 SRDGKYMATGGKDCTLRVWKVIASPL------ERNDLSSATAKPQAKRISMRVPPSPTVG 237
           + DGKY  +   D TLR+W + +          ++D+ S +  P+A +I      S +  
Sbjct: 90  THDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQI-----VSASRD 144

Query: 238 RSVKEEPEQPIGPASMDLYAPVFHPLPFRIY-QEHTQDILDLDWSKNGFILTTSMDKTAR 296
           ++VK      +G   + L          RI   E + D +         +++  MDK  +
Sbjct: 145 KTVK--VWNTVGDCVVTLLGHNDWVSNVRIAPSEKSDDAVT--------VISAGMDKVVK 194

Query: 297 LWHCDRPKALKVFT-------HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSF 349
           +W       L+ FT       H ++VT     P D   F S   D  + LW++ + +  +
Sbjct: 195 VWD------LQSFTIEADFIGHNNYVTTVTPSP-DGSIFASAGKDGQIILWNLNEKTALY 247

Query: 350 DYYCGDIITAIDTSPRDGKYTAA 372
                D + A+  SP     TAA
Sbjct: 248 TLDAKDEVFAVAFSPNRYWLTAA 270

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 72/172 (41%), Gaps = 12/172 (6%)

Query: 177 AVWATKFSRDGKYMATGGKDCTLRVW--KVIASPLERNDLSSATAKPQAKRISMRVPPSP 234
           A+W+   + +GK + TG  D + + W  +V+   +     +     PQ K +        
Sbjct: 466 AIWSLDLTSNGKRLVTGSADKSCKFWDFEVVEQLVPG---TKDKYIPQLKLVHDTTLELT 522

Query: 235 TVGRSVKEEPE-QPIGPASMDLYAPVFHPLPFRIYQE---HTQDILDLDWSKNG-FILTT 289
               +VK   E + +  + +D    VF     + Y     H   +L +D+S +   ++T+
Sbjct: 523 DDILAVKISSEDRYLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITS 582

Query: 290 SMDKTARLWHCDRPKALK-VFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLW 340
           S DK  ++W  D     K +F H D +   +F  +   FF  G  D  ++ W
Sbjct: 583 SADKNIKIWGVDFGDCHKSIFAHQDSIMSVRFEADTHNFFSCGK-DGAVKRW 633

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 32/63 (50%), Gaps = 5/63 (7%)

Query: 264 PFRIY----QEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAK 319
           P R Y    Q H  DI  +D S +G +L+T+ +   ++W+    K ++ F+   +  C++
Sbjct: 371 PVRRYNVELQGHRTDIRSMDISDDGKLLSTASNGELKVWNLTTKKCIRTFS-CGYALCSQ 429

Query: 320 FHP 322
             P
Sbjct: 430 MLP 432

>Scas_660.8
          Length = 510

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 40/84 (47%), Gaps = 14/84 (16%)

Query: 310 THPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI-------LDNSVSFDYYCGDIITAIDT 362
           THP  VT  KFHP D++  I+   D  +RLW I       L+ + S DY     + ++  
Sbjct: 124 THPTHVT--KFHPQDNKTLITASDDRVIRLWDISNAYQPQLELTGSTDY-----VRSVTC 176

Query: 363 SPRDGKYTAAGTFNGHIIILYTRG 386
            P       +G+++G I +  TR 
Sbjct: 177 VPSAPHMIVSGSYDGIIRLYDTRA 200

>CAGL0J03476g 331933..333486 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 517

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 286 ILTTSMDKTARLWHCD--RPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLW 340
           ++T   D TAR+W CD   PK + +  H ++V C  +   D     +G +D+T+RLW
Sbjct: 161 VVTGGGDNTARIWDCDTQTPK-VTLNGHRNWVLCVSWSA-DGEVIATGSMDNTIRLW 215

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 34/79 (43%), Gaps = 9/79 (11%)

Query: 271 HTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKAL--KVFTHPDFVTCAKF------H 321
           H   +L + WS +G  I T SMD T RLW  +  K L   +  H  ++T   +       
Sbjct: 187 HRNWVLCVSWSADGEVIATGSMDNTIRLWDAESGKPLGDALRGHSKWITSLTWEPIHLVE 246

Query: 322 PNDDRFFISGCLDHTLRLW 340
           P       S   D T+R+W
Sbjct: 247 PGSKPRLASASKDGTIRIW 265

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 52/124 (41%), Gaps = 3/124 (2%)

Query: 252 SMDLYAPVFHPLPFRIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVFT 310
           +M L+ P+    P      H + +  + +S +G +I++ S D + +LW       L  F 
Sbjct: 384 TMFLWNPLKGTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDGKEGTFLSTFR 443

Query: 311 HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYC-GDIITAIDTSPRDGKY 369
                       +D R  +S   D TL++W +    +S D     D +  +D S  DGK 
Sbjct: 444 GHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWS-VDGKR 502

Query: 370 TAAG 373
             +G
Sbjct: 503 VCSG 506

>Kwal_26.7736
          Length = 507

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 38/86 (44%), Gaps = 4/86 (4%)

Query: 310 THPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCG--DIITAIDTSPRDG 367
           +HP  V  AKFHP D R  ++   D  +R+W I           G  D + ++   P+  
Sbjct: 124 SHPTHV--AKFHPADSRTLVTASDDRVVRVWDITQAQEPQVELTGASDYVRSVCMVPQAP 181

Query: 368 KYTAAGTFNGHIIILYTRGLEMVSTF 393
                G+++G + +  TR  E  +T 
Sbjct: 182 HLVVTGSYDGQVRLFDTRTNERATTL 207

>Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement
          Length = 314

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 55/261 (21%), Positives = 105/261 (40%), Gaps = 20/261 (7%)

Query: 271 HTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPNDDRFFI 329
           H + + D+ WS +   I T S D T  + H    +  ++  H   V  +  + +      
Sbjct: 55  HVESMSDICWSPDSQCIATASDDFTIEINHITYGRLHRLVGHTAPVL-SLVYTSKGNLLC 113

Query: 330 SGCLDHTLRLWSILDNSV--SFDYYCGDIITAIDTSPRDGKYTAAGTFNGHIIILYTRGL 387
           S  +D ++++W +L  ++  +   +  + + +ID    D    ++G+++G I I  T   
Sbjct: 114 SASMDESIKIWDVLTGTLLKTISAH-SEPVVSIDMPVCDPSILSSGSYDGLIRIFDTTTG 172

Query: 388 EMVSTFHVLEKPNGTTKKVPESGPK--ITGIEFFKSAPDNDLRIMVTSNDSRIRIFRIKG 445
             + T    +        VP S  K  + G      + D  L+I      S +R F+I  
Sbjct: 173 HCLKTLTYDKDWKSENGVVPISQVKFSVNGKYLLVKSLDGVLKIWDFIRGSVVRTFKICD 232

Query: 446 QSLLEVLKGFENTHSQISAHLILPPSKKI---FVLAPSENQWVYCWRVESSAGVSNSDDS 502
            + L+   G +           L PS ++    V+A  E+  +YCW  +S   + + +  
Sbjct: 233 STKLKYSCGMD----------FLYPSDQLSSPVVVAGGESDGIYCWDAQSKKLLQHINYK 282

Query: 503 QNNGTHRRGSIRGLLQRSLSI 523
             N      S +G    SLS+
Sbjct: 283 HQNSPVVSVSCQGTTMCSLSL 303

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 286 ILTTSMDKTARLWHCD-RPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLW 340
           ++T + D TA +W CD + +   +  H ++V C  + P D     +G +D+T+RLW
Sbjct: 159 MVTGAGDNTACIWDCDTQTRMCTLQGHHNWVLCCSWSP-DGELIATGSMDNTIRLW 213

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 66/336 (19%), Positives = 118/336 (35%), Gaps = 93/336 (27%)

Query: 178 VWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVG 237
           V    +S DG+ +ATG  D T+R+W+            S+  KP    +      S  + 
Sbjct: 189 VLCCSWSPDGELIATGSMDNTIRLWE------------SSKGKPYGDALRGH---SKWI- 232

Query: 238 RSVKEEPEQPIGPASMDLYAPVFHPLPFRIYQE-----------HTQDILDLDWSKNGFI 286
            S+  EP   + P      A        +I+             HT  +  + W     +
Sbjct: 233 TSLSWEPIHLVKPGDKPRLATASKDGTIKIWDTTRRVCLLTLCGHTSSVSCVKWGGKNVL 292

Query: 287 LTTSMDKTARLW------HC------------------DRPKALKVFTHP---------- 312
            + S DKT R W       C                  D    L  F H           
Sbjct: 293 YSGSHDKTIRCWDMNLNGKCINILKSHAHWVNHLSLSTDYALRLGAFDHKGETPASPEEA 352

Query: 313 ------DFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCG--DIITAIDTSP 364
                 ++   AK   + +   ++   D T+ LW+ L ++       G   ++  +  SP
Sbjct: 353 QQKALKNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSP 412

Query: 365 RDGKYTAAGTFNGHIIILYTRGLEMVSTF--HVLEKPNGTTKKVPESGPKITGIEFFKSA 422
            DG+Y  + +F+  I +   R  + +STF  HV                       ++ A
Sbjct: 413 -DGRYIVSASFDNSIKLWDGRDGKFLSTFRGHV--------------------ASVYQVA 451

Query: 423 PDNDLRIMVT-SNDSRIRIFRIKGQSLLEVLKGFEN 457
             +D R++V+ S D+ ++++ +K + L   L G ++
Sbjct: 452 WSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQD 487

 Score = 33.1 bits (74), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 34/81 (41%), Gaps = 9/81 (11%)

Query: 269 QEHTQDILDLDWSKNG-FILTTSMDKTARLWHCD--RPKALKVFTHPDFVTCAKFH---- 321
           Q H   +L   WS +G  I T SMD T RLW     +P    +  H  ++T   +     
Sbjct: 183 QGHHNWVLCCSWSPDGELIATGSMDNTIRLWESSKGKPYGDALRGHSKWITSLSWEPIHL 242

Query: 322 --PNDDRFFISGCLDHTLRLW 340
             P D     +   D T+++W
Sbjct: 243 VKPGDKPRLATASKDGTIKIW 263

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 53/124 (42%), Gaps = 3/124 (2%)

Query: 252 SMDLYAPVFHPLPFRIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVFT 310
           +M L+ P+    P      H + +  + +S +G +I++ S D + +LW     K L  F 
Sbjct: 382 TMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFLSTFR 441

Query: 311 HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYC-GDIITAIDTSPRDGKY 369
                       +D R  +S   D TL++W +    +S D     D +  +D S  DGK 
Sbjct: 442 GHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWS-VDGKR 500

Query: 370 TAAG 373
             +G
Sbjct: 501 VCSG 504

>Scas_658.1
          Length = 442

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 88/213 (41%), Gaps = 16/213 (7%)

Query: 263 LPFRIYQEHTQDILDL--DWSKNGFI-----LTTSMDKTARLWHCDRPKALKVFT--HPD 313
           +P+  ++E +Q   D   D+   G I     + TS++K    + C  PK +K     H +
Sbjct: 91  IPYEPFKESSQFYGDAEKDYQGRGIIHPPIDVGTSLNKPPLSFKCFLPKKIKYAMDGHTN 150

Query: 314 FVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCG--DIITAIDTSPRDGKYTA 371
             T   F PN     +SG  D+ +++W           Y G    I ++D +  DG    
Sbjct: 151 GTTSLTFLPNSGNLLLSGGNDNIVKVWDFYHKRNLLRDYKGHSKAINSLDFN-DDGTNFI 209

Query: 372 AGTFNGHIIILYTRGLEMVSTFHVLEKPNGTTKKVPESGPKITGIEFFKSAPDNDLRIMV 431
           + +F+  I I  T   ++ +  H    PN    +   S   I G   F ++        +
Sbjct: 210 SSSFDHTIKIWDTEQGKVKTKLHFKSTPNDVKFRPFNSSEFIVG---FANSKIYHYDTRI 266

Query: 432 TSNDSRIRIFRIKGQSLLEVLKGFENTHSQISA 464
           + ND R++++     S+L  LK F +    IS+
Sbjct: 267 SENDGRVQVYDHHMSSIL-ALKFFPDGSKFISS 298

>CAGL0L02629g complement(307323..309710) similar to sp|P07834
           Saccharomyces cerevisiae YFL009w CDC4 cell division
           control, hypothetical start
          Length = 795

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 38/74 (51%), Gaps = 2/74 (2%)

Query: 271 HTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDD-RFF 328
           H   +  L ++ NG +++ S D++ R+W+    K   VF  H   V C     ++  ++ 
Sbjct: 408 HDGGVWALKYAGNGILVSGSTDRSVRIWNIHLGKCTHVFKGHTSTVRCLDIVEHEGVKYI 467

Query: 329 ISGCLDHTLRLWSI 342
           ++G  D+TL +W +
Sbjct: 468 VTGSRDNTLHIWKL 481

>AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)
           [1542 bp, 513 aa]
          Length = 513

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 286 ILTTSMDKTARLWHCDRPKALKVF-THPDFVTCAKFHPNDDRFFISGCLDHTLRLW 340
           ++T + D TAR+W CD    L     H ++V C  +   D     +G +D T+RLW
Sbjct: 157 MVTGAGDNTARIWDCDTQTPLCTLKGHSNWVLCVAWSA-DGEVIATGSMDATIRLW 211

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 40/86 (46%), Gaps = 9/86 (10%)

Query: 264 PFRIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKAL--KVFTHPDFVTCAKF 320
           P    + H+  +L + WS +G  I T SMD T RLW  ++ ++L   +  H  ++T   +
Sbjct: 176 PLCTLKGHSNWVLCVAWSADGEVIATGSMDATIRLWDSEKGQSLGDALRGHTKWITSLSW 235

Query: 321 H------PNDDRFFISGCLDHTLRLW 340
                  P +     S   D T+++W
Sbjct: 236 EPIHLVKPGEKPRLASASKDGTIKIW 261

 Score = 30.4 bits (67), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 53/124 (42%), Gaps = 3/124 (2%)

Query: 252 SMDLYAPVFHPLPFRIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVFT 310
           +M L+ P+    P      H + +  + +S +G +I++ S D + +LW     K +  F 
Sbjct: 380 TMYLWNPLKGSKPILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFR 439

Query: 311 HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYC-GDIITAIDTSPRDGKY 369
                       +D R  +S   D TL++W +    ++ D     D +  +D S  DGK 
Sbjct: 440 GHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLTVDLPGHNDEVYTVDWS-VDGKR 498

Query: 370 TAAG 373
             +G
Sbjct: 499 VCSG 502

>Kwal_56.23920
          Length = 937

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 70/172 (40%), Gaps = 12/172 (6%)

Query: 177 AVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAK--PQAKRISMRVPPSP 234
           A+W+   + DGK + TG  D T+  W      +E+  +   T K  P+ K          
Sbjct: 469 AIWSLDMTTDGKRLVTGSADKTVCFWDF---QVEQEPVPGTTDKFNPKLKMFHDTTLELN 525

Query: 235 TVGRSVKEEPEQPIGPAS-MDLYAPVFHPLPFRIYQE---HTQDILDLDWSKNG-FILTT 289
               +VK  P+  +   S +D    VF     + +     H   +L +D S +   ++T+
Sbjct: 526 DDVLAVKISPDNRLLAVSLLDNTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITS 585

Query: 290 SMDKTARLWHCDRPKALK-VFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLW 340
           S DK  ++W  D     + +F H D +    F P    FF S   D  ++ W
Sbjct: 586 SADKNIKIWGLDFGDCHRSLFAHNDSIMKVVFVPESHNFF-SCSKDALVKYW 636

>Kwal_0.212
          Length = 303

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 76/198 (38%), Gaps = 39/198 (19%)

Query: 183 FSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKP------QAKRIS--------- 227
           F ++ K+M +  +D T++VW V A  ++RN    A          Q + IS         
Sbjct: 83  FQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRI 142

Query: 228 MRVPPSPTVGRSVKEE--PEQPIGPAS------------------MDLYAPVFHPLPFRI 267
             +  +  V +   E+  P Q +  AS                  M       +P P   
Sbjct: 143 WDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTK 202

Query: 268 YQEHTQDILDLDWSKN-GFILTTSMDKTARLWHCDRPKALKVF--THPDFVTCAKFHPND 324
           ++ H + I  +  S +   + T S D TAR+W  D    L+     H  +V    F   D
Sbjct: 203 FRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFSA-D 261

Query: 325 DRFFISGCLDHTLRLWSI 342
             + ++ C DH +RLW +
Sbjct: 262 SAYLVTACSDHYVRLWDL 279

 Score = 36.2 bits (82), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 42/201 (20%), Positives = 77/201 (38%), Gaps = 29/201 (14%)

Query: 190 MATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVGRSVKEEPEQPIG 249
           +A+ G D T+R W+ +     R    S     Q  R+ +          S  +      G
Sbjct: 5   LASAGYDHTIRFWEALTGVCSRTIQHS---DSQVNRLEI----------SSDKRFLAAAG 51

Query: 250 PASMDLY-APVFHPLPFRIYQEHTQDILDLDWSK-NGFILTTSMDKTARLWHCDRPKALK 307
             ++ LY     +P P   ++ H  ++  + + + N +++++S D T ++W    P   +
Sbjct: 52  HLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQR 111

Query: 308 VFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTSP--- 364
            + H   V     HPN     IS   D  +R+W + +N       C   +   D +P   
Sbjct: 112 NYKHQAAVNEVVIHPNQGE-LISCDQDGNVRIWDLGENQ------CVHQLAPEDDTPLQS 164

Query: 365 ----RDGKYTAAGTFNGHIII 381
                DG    AG   G+  +
Sbjct: 165 LSVASDGSMLVAGNNKGNCYV 185

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 19/40 (47%)

Query: 172 ENSDRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLER 211
           +N  R VW   FS D  Y+ T   D  +R+W +    + R
Sbjct: 247 DNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVR 286

>CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces
           cerevisiae YJL112w MDV1, hypothetical start
          Length = 711

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 47/100 (47%), Gaps = 15/100 (15%)

Query: 286 ILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILD 344
           + T + D   RLW     + ++V   H D +T  KF   D    ISG LD T+RLW +  
Sbjct: 577 LATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKF---DATTIISGSLDGTIRLWDLRS 633

Query: 345 NSVSFDYYCGDIITA---IDTSPRDGKY--TAAGTFNGHI 379
           N+++      DII+    I +   D K+   A+   N HI
Sbjct: 634 NNLT------DIISYEKPISSLDFDAKHIVVASNEHNTHI 667

 Score = 33.5 bits (75), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 5/38 (13%)

Query: 303 PKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLW 340
           PKA     H D +TC  F P+      +G +DH ++LW
Sbjct: 400 PKA-----HDDAITCLDFDPHFSTLCTAGYMDHIVKLW 432

>Kwal_56.24478
          Length = 1296

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 42/87 (48%), Gaps = 3/87 (3%)

Query: 267 IYQEHTQDILDLDWSKNG--FILTTSMDKTARLWHCDRPKALKVF-THPDFVTCAKFHPN 323
           + Q HT+ +L LDW K     +L++  D +  LW+ +  + L  F T  ++    KF P 
Sbjct: 246 LSQGHTKGVLSLDWCKQDETLLLSSGRDNSCVLWNPESGQNLTQFPTRGNWCFKTKFAPQ 305

Query: 324 DDRFFISGCLDHTLRLWSILDNSVSFD 350
               F S   D+ + + ++ + + + D
Sbjct: 306 APDLFASASFDNKIEVQTLQNITCTLD 332

>KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP 52 KD protein, start
           by similarity
          Length = 459

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 40/75 (53%), Gaps = 2/75 (2%)

Query: 269 QEHTQDILDLDWSKNGFILTT-SMDKTARLWHCDRPKALK-VFTHPDFVTCAKFHPNDDR 326
           Q H++ I  +DWS+NG+ L + S D T ++W   +   ++ +  H   V+  KF+  +  
Sbjct: 344 QGHSKPIYSVDWSQNGYQLASGSGDGTIKVWDIRKKGNVETILAHNSIVSQVKFNKQNGG 403

Query: 327 FFISGCLDHTLRLWS 341
           + +S   D  + +++
Sbjct: 404 YLVSSGYDKKVNIFN 418

>Scas_707.22
          Length = 730

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 51/111 (45%), Gaps = 8/111 (7%)

Query: 271 HTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDD-RFF 328
           H   +  L +  +G I++ S D++ R+W   R     VF  H   V C +     + ++ 
Sbjct: 395 HEGGVWALKYDADGIIVSGSTDRSVRIWDIKRGCCTHVFKGHTSTVRCLEIVTYKNMKYI 454

Query: 329 ISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTSPRDGKYTAAGTFNGHI 379
           ++G  D+TL +W ++     FD   G++    +T P +  Y   G   GH+
Sbjct: 455 VTGSRDNTLHVWKLIKEE-KFD---GELPMVYNT-PEENPY-FVGVLRGHM 499

>CAGL0D02090g join(214357..214893,215564..215860) highly similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1
          Length = 277

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 85/201 (42%), Gaps = 33/201 (16%)

Query: 263 LPFRIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKF 320
           +P + ++ H+  + D   ++NG + L+ S DKT RLW     +  + F  H   V     
Sbjct: 56  VPVKSFKGHSHIVQDCTLTENGAYALSGSWDKTLRLWDVATGETFQTFVGHKGDVMSVAI 115

Query: 321 HPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAI---DTSPRDGKYTAAGTFNG 377
                   ISG  D ++++WSI  + ++      D ++ +   ++S  D K T     N 
Sbjct: 116 DKK-ASMIISGSRDKSIKVWSIKGDCLATLIGHNDWVSQVRIANSSDDDDKVTVISAGND 174

Query: 378 HII-ILYTRGLEMVSTFHVLEKPNGTTKKVP----ESGPKITGIEFFKSAPDNDLRIMVT 432
            ++ +L+                  +  KVP     +G ++  + F   +P+       T
Sbjct: 175 KMVKVLWN-----------------SAAKVPMYTLSAGDEVYALSF---SPNRYWLCAAT 214

Query: 433 SNDSRIRIFRIKGQSLLEVLK 453
           +  S I+IF +  Q LL+ LK
Sbjct: 215 A--SGIKIFSLDPQCLLDDLK 233

>Scas_442.2*
          Length = 795

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 87/210 (41%), Gaps = 37/210 (17%)

Query: 254 DLYAPVFHPLPFRIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVFT-- 310
           D +  V  PL F     HT  +  L +S +  ++L+   D+   +W  D P+  K FT  
Sbjct: 603 DNWLEVKPPLAF-----HTLTVTKLRFSPDSKYLLSVCRDRQWVVWERD-PETDK-FTLK 655

Query: 311 ------HPDFVTCAKFHPND-DRFFISGCLDHTLRLWSILDNSVSFDYY----CGDIITA 359
                 H   +    + P +    F++G  D T++LW   +N  +FD         ++TA
Sbjct: 656 YKTAKPHTRIIWDGDWAPLEFGNVFVTGSRDRTIKLWKFDENKSNFDLENSLNMTSLVTA 715

Query: 360 IDT--SPRDGKYTAAGTFNGHIIILY----TRGLEMVSTFHVLEKPNGTTKKVPESGPKI 413
           +    S  DG+   A       I +Y    T G ++V   + L  P            K+
Sbjct: 716 LSVXDSVLDGRLLIAXGLEDGSIYIYKYDSTSGFDVVEVLNDLITP----------AEKL 765

Query: 414 TGIEFFKSAPDNDLRIMVTSNDSRIRIFRI 443
           T + + +S  +N L +   S+D+  RI+ I
Sbjct: 766 TRLRWSRSQRNNKLWLAAASSDTSTRIYSI 795

>KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces
           cerevisiae YDR364c CDC40 cell division control protein
           singleton, start by similarity
          Length = 429

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 49/110 (44%), Gaps = 8/110 (7%)

Query: 265 FRIYQEHTQDILDLDWSKNGF-ILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPN 323
            R Y+ H+  I DL+++ NG    + S DK  ++W+ ++    K         C  FHP 
Sbjct: 172 LRTYEGHSMTIKDLNFTDNGHSFASASFDKWVKIWNTEKGIIDKRLRFNSVPNCITFHPK 231

Query: 324 DDRFFISGCLD-----HTLRLWSILDNSVSFDYYCGDIITAIDTSPRDGK 368
           D    + G  +     + LRL         +D++ G I+ A+   P DGK
Sbjct: 232 DKNQLVVGLSNSEIRHYDLRLSENHGEVQKYDHHQGSIL-ALKYFP-DGK 279

>CAGL0J04818g 455846..457810 highly similar to sp|Q06440
           Saccharomyces cerevisiae YLR429w CRN1, start by
           similarity
          Length = 654

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 1/62 (1%)

Query: 286 ILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDN 345
           + ++S+D T R+W+ +  + +    HPD VT   F   D     +   D  LR+W++ + 
Sbjct: 155 LASSSLDYTVRIWNVETGEDIYKLKHPDMVTSMSFS-YDGTHLATVARDKKLRVWNVREE 213

Query: 346 SV 347
            V
Sbjct: 214 KV 215

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%)

Query: 178 VWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQ 222
           V +  FS DG ++AT  +D  LRVW V    +     + A AK Q
Sbjct: 184 VTSMSFSYDGTHLATVARDKKLRVWNVREEKVVSEGAAHAGAKNQ 228

>Scas_603.5
          Length = 589

 Score = 38.1 bits (87), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 68/165 (41%), Gaps = 9/165 (5%)

Query: 185 RDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVGRSVKEEP 244
           R  + +A+ G+       K + S   RN+ + + AK +      ++ P+     +V  +P
Sbjct: 204 RQNRNIASRGEGMISLRGKHVHSYKHRNEQNESAAKAEPDLTDAKLDPNIRGINNVMNDP 263

Query: 245 EQPI------GPASMDLYAPVFHPLPFRIYQEHTQDILDLDWSKNGFILTTSMDKTARLW 298
            Q +         + DL +         +Y + T   LD D S          + + ++W
Sbjct: 264 AQVMFFHKNDKENNEDLKSGSHLGTLDSVYTD-TVTCLDFDLSTKMLYTAGKYNTSIKVW 322

Query: 299 HCD-RPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI 342
             +   + + +  H   VTC + HP D +  I+G  D TL+LW +
Sbjct: 323 DLETNDQVMDLDDHIASVTCMQLHP-DSKTLITGSKDATLKLWDL 366

>CAGL0D05588g 533235..534668 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1, start by
           similarity
          Length = 477

 Score = 38.1 bits (87), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 43/79 (54%), Gaps = 4/79 (5%)

Query: 265 FRIYQEHTQDILDLDWSKNGF-ILTTSMDKTARLWHCDRPKALKVF--THPDFVTCAKFH 321
             ++++H   ++D+D S  G  ++T S DKT R++  ++  + +++       V  AKF 
Sbjct: 295 LNVFKDHVSAVMDVDISPTGEEVVTASYDKTIRIFPINKGHSREIYHTKRMQHVFQAKF- 353

Query: 322 PNDDRFFISGCLDHTLRLW 340
             D ++ +SG  D  +RLW
Sbjct: 354 SMDSKYVMSGSDDGNVRLW 372

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 2/39 (5%)

Query: 178 VWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSS 216
           V+  KFS D KY+ +G  D  +R+W+  A   ER+++ S
Sbjct: 348 VFQAKFSMDSKYVMSGSDDGNVRLWR--AKAWERSNVKS 384

>KLLA0F05159g 506007..509702 similar to sp|P38968 Saccharomyces
           cerevisiae YDL195w SEC31 component of the COPII coat of
           ER-golgi vesicles, start by similarity
          Length = 1231

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 44/92 (47%), Gaps = 4/92 (4%)

Query: 263 LPFRIY-QEHTQDILDLDWSKN--GFILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCA 318
           +P ++  Q H++ +L LDW K     +L++  D T+ LW+      L  F    ++V  +
Sbjct: 241 VPLKVLSQGHSKGVLSLDWCKQDENLLLSSGRDNTSVLWNPQEGSILTQFAPRGNWVFKS 300

Query: 319 KFHPNDDRFFISGCLDHTLRLWSILDNSVSFD 350
           KF P     F S   D  + + ++ + S + D
Sbjct: 301 KFAPEAPDLFASASFDSKIVVQTLQNLSNTLD 332

>Kwal_33.15136
          Length = 473

 Score = 38.1 bits (87), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 41/79 (51%), Gaps = 4/79 (5%)

Query: 265 FRIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVF--THPDFVTCAKFH 321
             ++++H   ++D+D+S  G  I+T S DKT R++      + +++       V   K+ 
Sbjct: 293 LHVFKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIYQVKHGHSREIYHTKRMQHVFQVKY- 351

Query: 322 PNDDRFFISGCLDHTLRLW 340
             D R+ +SG  D  +R+W
Sbjct: 352 TMDSRYIVSGSDDGNVRMW 370

>KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces
           cerevisiae YBL008w HIR1 histone transcription regulator,
           start by similarity
          Length = 861

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 64/166 (38%), Gaps = 42/166 (25%)

Query: 177 AVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTV 236
           +V   KFS DGKY+A+G  D  L +W          +L   T +P               
Sbjct: 78  SVTTVKFSPDGKYLASGSDDRILLIW----------ELEGGTTQPM-------------- 113

Query: 237 GRSVKEEPEQPIGPASMDLYAPVFHPLPFRIYQEHTQDILDLDWSKNGFIL-TTSMDKTA 295
                       G  S D+     H    R    H  DI D+ W+ +  I+ +  +D+  
Sbjct: 114 -----------FGAESTDIE----HWNVRRRLVAHDNDIQDICWAPDSSIMVSVGLDRAI 158

Query: 296 RLWHCDRPKALKVF-THPDFVTCAKFHPNDDRFFISGCLDHTLRLW 340
            +W+    + +K F  H   V    F P  +++F +   D T++++
Sbjct: 159 IIWNGSTFEKVKRFDVHQSHVKGVVFDPA-NKYFATASDDRTIKMF 203

>Scas_720.45
          Length = 755

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 18/26 (69%)

Query: 317 CAKFHPNDDRFFISGCLDHTLRLWSI 342
           C  F+P D   F SGCLD T+++WS+
Sbjct: 2   CVAFNPKDPNTFASGCLDRTVKVWSL 27

>AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516)
           [1440 bp, 479 aa]
          Length = 479

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 42/79 (53%), Gaps = 4/79 (5%)

Query: 265 FRIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVF--THPDFVTCAKFH 321
             ++++H   ++D+D+S  G  I+T S DKT R+++     + +V+       V   KF 
Sbjct: 295 LHVFKDHVSAVMDVDFSPTGEEIVTGSYDKTIRIFNLKHGHSREVYHTKRMQHVFQVKF- 353

Query: 322 PNDDRFFISGCLDHTLRLW 340
             D ++ +SG  D  +RLW
Sbjct: 354 TMDSKYIVSGSDDGNVRLW 372

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 178 VWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAK 220
           V+  KF+ D KY+ +G  D  +R+W+  A   ER+ + +   K
Sbjct: 348 VFQVKFTMDSKYIVSGSDDGNVRLWR--AKAWERSHVKTTKEK 388

>Sklu_2442.2 YNL006W, Contig c2442 3831-4742
          Length = 303

 Score = 37.4 bits (85), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 41/205 (20%), Positives = 80/205 (39%), Gaps = 37/205 (18%)

Query: 190 MATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVGRSVKEEPEQPIG 249
           +A+ G D T+R W+ +     R   +   A  Q  R+ +                ++   
Sbjct: 5   LASAGYDHTIRFWEALTGVCSR---TIQHADSQVNRLEI--------------TSDKRFL 47

Query: 250 PASMDLYAPVF-----HPLPFRIYQEHTQDILDLDWSK-NGFILTTSMDKTARLWHCDRP 303
            A+  L+  ++     +P P   ++ H  ++  + + + N +++++S D T ++W    P
Sbjct: 48  AAAGHLHVRLYDIRTTNPNPVTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAP 107

Query: 304 KALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTS 363
              + + H   V     HPN     IS   D  +R+W + +N       C   +T  D +
Sbjct: 108 SVQRNYKHHAPVNEVVIHPNQGE-LISCDQDGNIRIWDLGENQ------CTHQLTPEDDT 160

Query: 364 P-------RDGKYTAAGTFNGHIII 381
           P        DG    AG   G+  +
Sbjct: 161 PLQSLSIASDGSMLVAGNNKGNCYV 185

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 43/198 (21%), Positives = 78/198 (39%), Gaps = 39/198 (19%)

Query: 183 FSRDGKYMATGGKDCTLRVWKVIASPLERN-----DLSSATAKP-QAKRISM-------- 228
           F +D K+M +  +D T++VW V A  ++RN      ++     P Q + IS         
Sbjct: 83  FQQDNKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAPVNEVVIHPNQGELISCDQDGNIRI 142

Query: 229 ----------RVPP---SPTVGRSVKEEPEQPIGPAS--------MDLYAPVFHPLPFRI 267
                     ++ P   +P    S+  +    +   +        M  +    +  P   
Sbjct: 143 WDLGENQCTHQLTPEDDTPLQSLSIASDGSMLVAGNNKGNCYVWQMPNHTDAANLKPVTK 202

Query: 268 YQEHTQDILDLDWSKN-GFILTTSMDKTARLWHCDRPKALKVFT--HPDFVTCAKFHPND 324
           ++ HT+ I  +  S +   + T S D TAR+W  +    L+     H  +V    F   D
Sbjct: 203 FRSHTKYITRVLLSSDVKHLATCSADHTARVWSIEDNFKLETTLDGHQRWVWDCAFSA-D 261

Query: 325 DRFFISGCLDHTLRLWSI 342
             + ++ C DH +RLW +
Sbjct: 262 SAYLVTACSDHYVRLWDL 279

>CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces
           cerevisiae YBR103w SIF2 SIR4P interacting protein, start
           by similarity
          Length = 535

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%)

Query: 268 YQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDR 302
           +  HTQ I+ L W  N  +++ SMD + +LW C +
Sbjct: 397 FYGHTQTIVSLKWVNNDMLISASMDGSVKLWDCGK 431

>CAGL0B01529g 137174..138283 highly similar to sp|P39108
           Saccharomyces cerevisiae YDR142c PAS7 peroxisomal import
           protein - peroxin, start by similarity
          Length = 369

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 40/77 (51%), Gaps = 8/77 (10%)

Query: 243 EPEQPI---GPASMDLYAPVFHPLPFRIYQEHTQDILDLDW---SKNGFILTTSMDKTAR 296
           +P Q +   G  S+ L+       P  ++ EH++++   +W   SK+ F+ ++S D   +
Sbjct: 72  KPNQVVVAQGDGSLRLFDTTLQKFPIAMFHEHSKEVYSCNWNLVSKSNFV-SSSWDGQVK 130

Query: 297 LWHCDRPKALKVFT-HP 312
           +W  +R  +L  F+ HP
Sbjct: 131 IWSPNRKASLITFSPHP 147

>YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Protein
           containing seven WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to WD40 protein Ciao1 (human CIAO1), which
           binds and inhibits Wilms tumor suppressor protein (human
           WT1) transactivation activity [993 bp, 330 aa]
          Length = 330

 Score = 37.4 bits (85), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 73/184 (39%), Gaps = 17/184 (9%)

Query: 267 IYQEHTQDILDLDWS-KNGFILTTSMDKTARLW--HCDRPKALKVFT-HPDFVTCAKFHP 322
           + QEH+QD+  + W      + ++S D T R+W  + D  + + V   H   V  + F  
Sbjct: 148 VLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDK 207

Query: 323 NDDRF-FISGCLDHTLRLWSIL--DNSVSFDYYCGDIITAIDTSPRDGKYTAAGTFNGHI 379
            +  F   SG  D T+R+W  +  D     ++ C  I+   D   R   Y  A  FNG I
Sbjct: 208 TEGVFRLCSGSDDSTVRVWKYMGDDEDDQQEWVCEAILP--DVHKRQ-VYNVAWGFNGLI 264

Query: 380 IILYTRGLEMVSTFHVLEKPNGTTKKVPESG--PKITGIEFFKSAPDNDLRIMVTSNDSR 437
             +   G+       V E+ +G  K   +      +  I   K    N   I+ T  D  
Sbjct: 265 ASVGADGV-----LAVYEEVDGEWKVFAKRALCHGVYEINVVKWLELNGKTILATGGDDG 319

Query: 438 IRIF 441
           I  F
Sbjct: 320 IVNF 323

>YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of
           the WD (WD-40) repeat family that binds to substrates
           (CLB2, CLB3, CDC5, HSL1) of the anaphase promoting
           complex (APC) and targets them for degradation [1701 bp,
           566 aa]
          Length = 566

 Score = 37.7 bits (86), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 36/89 (40%), Gaps = 11/89 (12%)

Query: 275 ILDLDWSKNGFILTTSMDKTA---RLWHCDRPKALKVFTHPDFVTCAKFHPNDDRFFISG 331
           I ++ WSKN   L TS   +     LW C+    + +     F        ND    +SG
Sbjct: 474 ICNMVWSKNTNELVTSHGYSKYNLTLWDCNSMDPIAILKGHSFRVLHLTLSNDGTTVVSG 533

Query: 332 CLDHTLRLWSILD--------NSVSFDYY 352
             D TLR W + D        NS+ FD +
Sbjct: 534 AGDETLRYWKLFDKPKAKVQPNSLIFDAF 562

>Kwal_56.23895
          Length = 367

 Score = 37.4 bits (85), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 2/64 (3%)

Query: 249 GPASMDLYAPVFHPLPFRIYQEHTQDILDLDWS--KNGFILTTSMDKTARLWHCDRPKAL 306
           G  S+ L+       P  I+ EH +++   +W+       +++S D T ++W   RPK+L
Sbjct: 81  GDGSLRLFDTQLTDYPIAIFHEHEKEVFSCNWNLINKQLFVSSSWDGTVKVWSPTRPKSL 140

Query: 307 KVFT 310
              T
Sbjct: 141 ATLT 144

>AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH]
           complement(442821..445589) [2769 bp, 922 aa]
          Length = 922

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 6/75 (8%)

Query: 260 FHPLP-FRIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCD-RPKALKVFT---HPD 313
           F P   +R++  H  DI  L WS++  FI++T+ D TAR++  +   K L   T   H D
Sbjct: 149 FAPFVRYRVHAGHFADITSLTWSRDSRFIISTAKDMTARIYSVNAEEKDLASMTFAGHRD 208

Query: 314 FVTCAKFHPNDDRFF 328
           +V  A F  + ++ +
Sbjct: 209 YVMGAFFSADQEKIY 223

 Score = 37.4 bits (85), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 44/79 (55%), Gaps = 5/79 (6%)

Query: 268 YQEHTQDILDLDWSKNGFIL-TTSMDKTARLWHCDRPKALKVFTHPDFV--TCAKFHPND 324
           ++EHT  +  + ++KNG I+ ++S+D T + W   R +  + FT  + +  +C    P  
Sbjct: 394 FEEHTSSVTSVQFAKNGQIMFSSSLDGTVKAWDLMRFRNFRTFTATERIQFSCLAADPTG 453

Query: 325 DRFFISGCLD-HTLRLWSI 342
           +    +G LD + +++WS+
Sbjct: 454 E-VVCAGSLDNYDIQVWSV 471

>Scas_721.115*
          Length = 318

 Score = 37.4 bits (85), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 52/110 (47%), Gaps = 11/110 (10%)

Query: 263 LPFRIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVFT--HPDFVTCAK 319
           +P R ++ H+  + D   +++G + L+ S DKT RLW     +  + F     D ++ A 
Sbjct: 56  VPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAI 115

Query: 320 FHPNDDR---FFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTSPRD 366
                DR     ISG  D T+++W+I    ++      D ++ +  +P D
Sbjct: 116 -----DRKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTD 160

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 75/178 (42%), Gaps = 27/178 (15%)

Query: 282 KNGFILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHP---NDDRF-FISGCLDHTL 337
           K   I++ S DKT ++W         +  H D+V+  +  P   NDD    IS   D  +
Sbjct: 118 KASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMV 177

Query: 338 RLWSILDNSVSFDY--YCGDIITAIDTSPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHV 395
           + W++    +  D+  + G++ T   T+  DG   A+   +G I++           +++
Sbjct: 178 KAWNLNQFQIEADFVGHNGNVNTV--TASPDGTLIASAGKDGEIML-----------WNL 224

Query: 396 LEKPNGTTKKVPESGPKITGIEFFKSAPDNDLRIMVTSNDSRIRIFRIKGQSLLEVLK 453
            EK    T    +        E F  A   +   +  +  S I+IF +  QSL++ L+
Sbjct: 225 AEKKAMYTLSAQD--------EVFALAFSPNRYWLAAATASGIKIFCLDPQSLVDDLR 274

>Scas_592.4*
          Length = 318

 Score = 37.4 bits (85), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 52/110 (47%), Gaps = 11/110 (10%)

Query: 263 LPFRIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVFT--HPDFVTCAK 319
           +P R ++ H+  + D   +++G + L+ S DKT RLW     +  + F     D ++ A 
Sbjct: 56  VPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAI 115

Query: 320 FHPNDDR---FFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTSPRD 366
                DR     ISG  D T+++W+I    ++      D ++ +  +P D
Sbjct: 116 -----DRKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTD 160

 Score = 36.6 bits (83), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 76/178 (42%), Gaps = 27/178 (15%)

Query: 282 KNGFILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHP---NDDRF-FISGCLDHTL 337
           K   I++ S DKT ++W         +  H D+V+  +  P   NDD    IS   D  +
Sbjct: 118 KASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMV 177

Query: 338 RLWSILDNSVSFDY--YCGDIITAIDTSPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHV 395
           + W++    +  D+  + G+ + A+  SP DG   A+   +G I++           +++
Sbjct: 178 KAWNLNQFQIEADFVGHNGN-VNAVTASP-DGTLIASAGKDGEIML-----------WNL 224

Query: 396 LEKPNGTTKKVPESGPKITGIEFFKSAPDNDLRIMVTSNDSRIRIFRIKGQSLLEVLK 453
            EK    T    +        E F  A   +   +  +  S I+IF +  QSL++ L+
Sbjct: 225 AEKKAMYTLSAQD--------EVFSLAFSPNRYWLAAATASGIKIFCLDPQSLIDDLR 274

>Kwal_56.24163
          Length = 729

 Score = 37.7 bits (86), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 65/169 (38%), Gaps = 61/169 (36%)

Query: 320 FHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTSPRDGKYTAAGTFNGHI 379
           F+P D   F S CLDHT+++WS+                        G+ TA  T   H 
Sbjct: 5   FNPKDPSTFASACLDHTVKIWSL------------------------GQPTANFTLQAH- 39

Query: 380 IILYTRGLEMVSTFHVLEKPNGTTKKVPESGPKITGIEFFKSAPDNDLRIMVTSNDSRIR 439
               TRG+  V  + + +KP                             ++ +S+D  ++
Sbjct: 40  ---ETRGVNYVDYYPLQDKP----------------------------YLITSSDDRTVK 68

Query: 440 IFRIKGQSLLEVLKGFENTHSQISAHLILPPSKKIFVLAPSENQWVYCW 488
           I+  + +S +  L+G    H    ++ +  PS  I +L+ SE+  +  W
Sbjct: 69  IWDYQTKSCVATLEG----HMANVSYAVFHPSLPI-ILSGSEDGTLKVW 112

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 285 FILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWS 341
           +++T+S D+T ++W       +     H   V+ A FHP+     +SG  D TL++W+
Sbjct: 57  YLITSSDDRTVKIWDYQTKSCVATLEGHMANVSYAVFHPS-LPIILSGSEDGTLKVWN 113

>Scas_711.11
          Length = 695

 Score = 37.7 bits (86), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 8/70 (11%)

Query: 286 ILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLW---- 340
           + T + D   RLW     K ++    H   +TC KF   D++  ++G +D T+R+W    
Sbjct: 552 LATGTRDGIVRLWDLRAGKVVRALEGHSGSITCLKF---DNKNIVTGSIDKTVRIWDLRS 608

Query: 341 SILDNSVSFD 350
            IL + ++F+
Sbjct: 609 GILSDMLTFE 618

>ACR091W [1138] [Homologous to ScYDR267C - SH]
           complement(520609..521595) [987 bp, 328 aa]
          Length = 328

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 44/90 (48%), Gaps = 6/90 (6%)

Query: 267 IYQEHTQDILDLDWSKNGFIL-TTSMDKTARLW---HCDRPKALKVFTHPDFVTCAKFHP 322
           + QEH+QD+  + W  +  +L ++S D T R+W     D   A  +  H   V C+ F  
Sbjct: 145 VLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFER 204

Query: 323 NDDRF-FISGCLDHTLRLWSIL-DNSVSFD 350
            +      SG  D T+R+W  L D++  FD
Sbjct: 205 AETGIRLCSGSDDTTVRIWRCLTDDADVFD 234

>Scas_700.27*
          Length = 433

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 73/174 (41%), Gaps = 18/174 (10%)

Query: 286 ILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILD 344
           I++ S D T RLW     K++KV T H   V    FHP +  F +S C  + +R W + +
Sbjct: 263 IVSCSTDATIRLWDIVAGKSMKVITHHKKSVRNIAFHPTE--FSMSSCSANDIRSWKLPE 320

Query: 345 NSV--SFDYYCGDIITAIDTSPRDGKYTAAGTFNGHIIIL-YTRGLEMVSTFHVLEKPNG 401
             +  +F+     II  +  +  D  +  AG+ NG +    Y  G +  S          
Sbjct: 321 GGLLTNFNSDGLGIINTLSINQDDVLF--AGSDNGMLSFYDYKSGHKYQSMM-------- 370

Query: 402 TTKKVPESGPKITGIEFFKSAPDNDLRIMVTSNDSRIRIFRIKGQSLLEVLKGF 455
            TK++P S     GI    +     LR++    D  I+I+ +   +  E   G 
Sbjct: 371 -TKEIPGSLESERGI-LCSTFDRTGLRLLTGETDKSIKIWSMDSDATPETDPGL 422

>Scas_659.9
          Length = 475

 Score = 37.0 bits (84), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 42/77 (54%), Gaps = 4/77 (5%)

Query: 267 IYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVF--THPDFVTCAKFHPN 323
           ++++H   ++D+D+S  G  I+T S DKT R+++     + +++       V   KF   
Sbjct: 294 VFKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIFNTTHGHSREIYHTKRMQHVFQVKF-SM 352

Query: 324 DDRFFISGCLDHTLRLW 340
           D ++ +SG  D  +RLW
Sbjct: 353 DAKYIVSGSDDGNVRLW 369

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 33/64 (51%), Gaps = 5/64 (7%)

Query: 178 VWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQA---KRISMRVPPSP 234
           V+  KFS D KY+ +G  D  +R+W+  +   ER+++ +   K +    +++  R    P
Sbjct: 345 VFQVKFSMDAKYIVSGSDDGNVRLWR--SKAWERSNVKTTKEKNKLAYDEKLKERFKHMP 402

Query: 235 TVGR 238
            + R
Sbjct: 403 EIKR 406

>YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component of
           U3 snoRNP (also called small subunit processome), which
           is required for 18S rRNA biogenesis, contains seven WD
           (WD-40) repeats [1470 bp, 489 aa]
          Length = 489

 Score = 37.0 bits (84), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 42/77 (54%), Gaps = 4/77 (5%)

Query: 267 IYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVF--THPDFVTCAKFHPN 323
           ++++H   ++D+D+S  G  I+T S DK+ R++  +   + +++       V   K+   
Sbjct: 300 VFKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQHVFQVKY-SM 358

Query: 324 DDRFFISGCLDHTLRLW 340
           D ++ ISG  D  +RLW
Sbjct: 359 DSKYIISGSDDGNVRLW 375

>KLLA0E24508g complement(2175775..2176758) similar to sp|P38123
           Saccharomyces cerevisiae YBR175w, start by similarity
          Length = 327

 Score = 36.6 bits (83), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 70/159 (44%), Gaps = 14/159 (8%)

Query: 248 IGPASMDLYAPVFHPLPFRI--YQEHTQDILDLDWSKNGFIL-TTSMDKTARLWHCDRPK 304
           I   S D    + H +  RI     HT  ++ + ++  G IL ++SMD++ + WH     
Sbjct: 84  IASGSEDFTVEITHIIYGRIRRLMGHTAPVISICYNNKGNILCSSSMDESIKEWHVLSGT 143

Query: 305 ALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDN----SVSF--DYYCGDII 357
           ALK  + H D V        D     SG  D  +R++         ++++  D+   D +
Sbjct: 144 ALKTMSAHSDAVVSIDIPKFDSSILSSGSYDGLIRIFDTESGHCLKTLTYDKDWIAEDGV 203

Query: 358 TAIDTS--PRDGKYTAAGTFNGHIIIL-YTRGLEMVSTF 393
             I T    R+GK+    + +  + +  YTRG  +V TF
Sbjct: 204 VPISTVKFSRNGKFLLVKSLDNVVKLWEYTRG-TVVRTF 241

 Score = 30.0 bits (66), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 38/87 (43%), Gaps = 11/87 (12%)

Query: 267 IYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPN-- 323
           I ++    I  + +S+NG F+L  S+D   +LW   R   ++ F  P   T AK   N  
Sbjct: 198 IAEDGVVPISTVKFSRNGKFLLVKSLDNVVKLWEYTRGTVVRTFLWPHQETKAKLKYNCG 257

Query: 324 --------DDRFFISGCLDHTLRLWSI 342
                    D   ISG    ++ +W++
Sbjct: 258 LELIYPQGKDPLVISGNDSGSMCVWNV 284

>Sklu_1880.3 YDR364C, Contig c1880 4293-5708
          Length = 471

 Score = 36.6 bits (83), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 265 FRIYQEHTQDILDLDWSKNGF-ILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPN 323
            R Y+ H + + D++++ +G   L+ S D+T ++W  +  K            CA +HP 
Sbjct: 215 LRDYRGHRKAVRDINFNSDGTEFLSVSFDQTLKVWDTETGKVKSRLKWHSVPNCATYHPT 274

Query: 324 DDRFFISGCLDHTLR 338
           ++  +I G  +  +R
Sbjct: 275 NNNEYIVGLSNSEIR 289

>Scas_601.2
          Length = 389

 Score = 36.6 bits (83), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query: 296 RLWHCDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLD 334
           R W  D+P    V +H D VTC K+HPND    +SG  D
Sbjct: 137 RKW--DQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTD 173

>KLLA0F15598g 1439610..1441046 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1 involved in 18S
           pre-rRNA production singleton, start by similarity
          Length = 478

 Score = 36.6 bits (83), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 40/78 (51%), Gaps = 2/78 (2%)

Query: 265 FRIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKF-HP 322
             ++++H   ++D+D+S  G  ++T S DKT R++      + +++         +  + 
Sbjct: 291 LHVFKDHVSAVMDVDFSPTGDEVVTGSYDKTIRIYQVKHGHSREIYHTKRMQHIFQVKYT 350

Query: 323 NDDRFFISGCLDHTLRLW 340
            D ++ +SG  D  +RLW
Sbjct: 351 MDSKYIVSGSDDGNVRLW 368

>KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces
           cerevisiae YLR409c singleton, start by similarity
          Length = 942

 Score = 36.6 bits (83), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 271 HTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPNDDRFFI 329
           H+  I   D+S +G +I+++S+D T R W       +      + +T  KF PN D    
Sbjct: 586 HSNRISSFDFSPDGRWIVSSSLDSTIRTWDLPTGGCIDGMKVENVITNIKFSPNGDLLAT 645

Query: 330 SGCLDHTLRLWS 341
           +    + + LW+
Sbjct: 646 TSVSGNGISLWA 657

 Score = 33.9 bits (76), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 41/86 (47%), Gaps = 2/86 (2%)

Query: 307 KVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTSPRD 366
           +++ H + ++   F P D R+ +S  LD T+R W +            ++IT I  SP +
Sbjct: 582 QLWGHSNRISSFDFSP-DGRWIVSSSLDSTIRTWDLPTGGCIDGMKVENVITNIKFSP-N 639

Query: 367 GKYTAAGTFNGHIIILYTRGLEMVST 392
           G   A  + +G+ I L+    + +S 
Sbjct: 640 GDLLATTSVSGNGISLWANRAQFISV 665

>AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH]
           complement(1497416..1499560) [2145 bp, 714 aa]
          Length = 714

 Score = 36.6 bits (83), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 58/271 (21%), Positives = 113/271 (41%), Gaps = 35/271 (12%)

Query: 190 MATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVGRSVKEEPEQPIG 249
           +A+G +D T+RVW    S    + L S       +R          V     EE EQ + 
Sbjct: 32  IASGSRDGTVRVWTRDTS---DSRLWSGAILHSTERY---------VNAVCYEENEQLVF 79

Query: 250 PASMDLYAPVFHPLPFRIYQE------HTQDILDLDWSKNGFILTTSMDKTARLWHCDRP 303
               +       PL   +         H+ ++  L+ +++G ++++S D+TAR+W     
Sbjct: 80  FGGQEAVIGAVSPLVLEVQDASYLLAGHSGNVCALE-ARDGQLVSSSWDQTARVWREGTE 138

Query: 304 KALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTS 363
           +  +  +  +           DR F++   D T++LW    +  +++ +  D++  +  +
Sbjct: 139 E--RALSGHNATVWHALALGYDR-FLTASADKTIKLWDGARDLATYNVHT-DVVRHLALA 194

Query: 364 PRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVLEKPNGTTKKVPESGPKITGIEFFKSAP 423
           P DG + A+ + +G + + +T   + V TF   E      K +P+ G             
Sbjct: 195 P-DGHHFASCSNDGSVKV-HTLDGKTVRTFDGHESFVYCVKYLPDGG-------LVSCGE 245

Query: 424 DNDLRIMVTSNDSRIRIFRIKGQSL--LEVL 452
           D  +R+   S   R ++ R+   SL  L+VL
Sbjct: 246 DKTVRVWDMSGHVR-QVIRLCATSLWSLDVL 275

>CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP, hypothetical start
          Length = 500

 Score = 36.2 bits (82), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 75/185 (40%), Gaps = 22/185 (11%)

Query: 271 HTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFF 328
           H   I DL    +G FI T+S D T RLW  ++ K L +   H   + C  F   D    
Sbjct: 297 HEGRITDLQVHPSGKFIGTSSFDSTWRLWDIEKQKQLLLQEGHSKELYCLAFQA-DGALV 355

Query: 329 ISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTSPRDGKYTAAGTFNGHIIILYTRGLE 388
            +   D T  +W         D   G  ++ +    +   Y    + +GH   L T G +
Sbjct: 356 STAGTDKTAIIW---------DLRSGKAVSQLQGHAKT-IYCMDWSIDGH--TLATGGGD 403

Query: 389 MVSTFHVLEKPNGTTKKVPESGPKITGIEFFKSAPDN------DLRIMVTSNDSRIRIFR 442
            V T   L K +  T K+ E    +T ++F K+   N      D  I V S D+ +++  
Sbjct: 404 GVITIWDLRKSDKLT-KITEHKSIVTSLKFDKANDHNLISSGYDRSIFVYSKDNYLKVSS 462

Query: 443 IKGQS 447
           + G +
Sbjct: 463 LIGHA 467

 Score = 36.2 bits (82), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 61/160 (38%), Gaps = 21/160 (13%)

Query: 187 GKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVGRSVKEEPEQ 246
           GK++ T   D T R+W +                 + K++ ++   S  +     +    
Sbjct: 310 GKFIGTSSFDSTWRLWDI----------------EKQKQLLLQEGHSKELYCLAFQADGA 353

Query: 247 PIGPASMDLYAPVFHPLPFRI---YQEHTQDILDLDWSKNGFILTT-SMDKTARLWHCDR 302
            +  A  D  A ++     +     Q H + I  +DWS +G  L T   D    +W   +
Sbjct: 354 LVSTAGTDKTAIIWDLRSGKAVSQLQGHAKTIYCMDWSIDGHTLATGGGDGVITIWDLRK 413

Query: 303 PKAL-KVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWS 341
              L K+  H   VT  KF   +D   IS   D ++ ++S
Sbjct: 414 SDKLTKITEHKSIVTSLKFDKANDHNLISSGYDRSIFVYS 453

>AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH]
           complement(341382..342494) [1113 bp, 370 aa]
          Length = 370

 Score = 36.2 bits (82), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 34/61 (55%), Gaps = 4/61 (6%)

Query: 249 GPASMDLYAPVFHPLPFRIYQEHTQDILDLDWS---KNGFILTTSMDKTARLWHCDRPKA 305
           G  S+ L+       P  ++QEH +++   +W+   K+ F+ ++S D T ++W   RP++
Sbjct: 81  GDGSLRLFDITLQQYPIALFQEHQREVFSCNWNLLHKDTFV-SSSWDGTVKVWTPARPQS 139

Query: 306 L 306
           +
Sbjct: 140 M 140

>CAGL0C01441g complement(156930..159947) similar to tr|Q08924
           Saccharomyces cerevisiae YPL183c, start by similarity
          Length = 1005

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 79/184 (42%), Gaps = 28/184 (15%)

Query: 175 DRAVWATKFSRDGK--YMATGGK-----DCTLRVWKVIASPLERNDLSSATAKPQAKRIS 227
           D  + A +FS+DG   Y+ T        D T +V +      ER+ L S + K  ++   
Sbjct: 91  DENITAIEFSKDGSKLYILTNYNKVLITDLTGKVVEEKKLVGERSILYSGSIKVISES-E 149

Query: 228 MRVPPSPTVGRSVKEEPEQPIGPASMDLY-APVFHPLPFRIYQEHTQDILDLDWSK-NGF 285
           +++     +G           G    DLY   + H L       H   I  +  S+ N  
Sbjct: 150 VQINAGTVMG-----------GAIVWDLYKEELIHNLT-----GHEGSIFYIQSSEHNKL 193

Query: 286 ILTTSMDKTARLWHCDRPKALKV-FTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILD 344
           I + S D++ RLW  +  K L + ++H   +   KF  ND+   +S   D T R+W+I+ 
Sbjct: 194 IASCSDDRSIRLWDRETGKELSIGWSHTARIWNLKFFNNDENL-VSVSEDCTCRVWNIIP 252

Query: 345 NSVS 348
           N +S
Sbjct: 253 NDIS 256

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 11/37 (29%), Positives = 21/37 (56%)

Query: 178 VWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDL 214
           +W  KF  + + + +  +DCT RVW +I + +   +L
Sbjct: 224 IWNLKFFNNDENLVSVSEDCTCRVWNIIPNDISGYEL 260

>Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement
          Length = 426

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 70/174 (40%), Gaps = 33/174 (18%)

Query: 182 KFSRDGKYMATGGKDCTLRVW------KVIASPLERNDLSSATAKPQAKRI-SMRVPPSP 234
           ++SRD K + +  +D  + +W      K  A PL+   + +    P    + S  +  + 
Sbjct: 95  RWSRDSKSILSASQDGFMLIWDPMSGLKKNAIPLDSQWVLACAISPSRNLVASGGLSNNC 154

Query: 235 TVGRSVKEE-PEQPIGPASMDLYAPVFHPLPFRIYQEHTQDILDLDWSKNGFILTTSMDK 293
           T+ R  +E   +Q I                  I++ HT  + DL++  N  ILT S D 
Sbjct: 155 TIYRISQENRTQQKI----------------VSIFKGHTCYVSDLEFINNESILTASGDM 198

Query: 294 TARLWHCDRPKALKVFTHPDF---VTCAKFHPND----DRFFISGCLDHTLRLW 340
           T  LW  D PK+ +V  + D    V      P      D  F SG  D  + LW
Sbjct: 199 TCALW--DIPKSKRVSEYSDHLGDVLTLSVPPAGTTSYDSMFASGGSDGYVYLW 250

>Scas_718.6*
          Length = 546

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 38/76 (50%), Gaps = 8/76 (10%)

Query: 271 HTQDILDLDWSKNGFILTTSMDKTARLW----HCDRPKALKVFTHPDFVTCAKFHPNDDR 326
           H+Q I+ L W  +  +++ SMD + R+W    +C    A+      + + C K   + ++
Sbjct: 411 HSQSIISLSWINDDLVISASMDGSVRIWSVVENCLVGMAM---VDGNAIICGKISHDKNK 467

Query: 327 FFISGCLDHTLRLWSI 342
           F I G ++  + ++ I
Sbjct: 468 FAI-GSMNGQINVYDI 482

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/82 (19%), Positives = 41/82 (50%), Gaps = 2/82 (2%)

Query: 261 HPLPFRIYQEHTQDI-LDLDWSKNGFILTTSMDKTARLWHCDRPKAL-KVFTHPDFVTCA 318
           H  P +  + +T+ + +D++W     ++   ++ +  ++  D  K + K+  H   ++C 
Sbjct: 316 HFEPEQKLENNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCI 375

Query: 319 KFHPNDDRFFISGCLDHTLRLW 340
           +F+ N      S   D+++R+W
Sbjct: 376 EFNVNSRLLLTSSDSDYSIRIW 397

>YMR116C (ASC1) [4073] chr13
           complement(499455..499877,500151..500687) Ribosomal
           protein of the 40S ribosomal subunit that influences
           translational efficiency and cell size, contains two WD
           (WD-40) repeats [960 bp, 319 aa]
          Length = 319

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 75/182 (41%), Gaps = 24/182 (13%)

Query: 265 FRIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPN 323
           ++ +  H  D++ +D  K    I++ S DKT ++W         +  H D+V+  +  PN
Sbjct: 100 YQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVPN 159

Query: 324 -----DDRFFISGCLDHTLRLWSILDNSVSFDYYCGDI-ITAIDTSPRDGKYTAAGTFNG 377
                D    IS   D  ++ W++    +  D+   +  I  +  SP DG   A+   +G
Sbjct: 160 EKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASP-DGTLIASAGKDG 218

Query: 378 HIII--------LYTRGLEMVSTFHVLEKPNGTTKKVPESGPKITGIEFFKSAPD---ND 426
            I++        +YT   +    F +   PN    +   +    TGI+ F   P    +D
Sbjct: 219 EIMLWNLAAKKAMYTLSAQD-EVFSLAFSPN----RYWLAAATATGIKVFSLDPQYLVDD 273

Query: 427 LR 428
           LR
Sbjct: 274 LR 275

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 3/82 (3%)

Query: 263 LPFRIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKF 320
           +P R ++ H+  + D   + +G + L+ S DKT RLW     +  + F  H   V     
Sbjct: 56  VPVRSFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDI 115

Query: 321 HPNDDRFFISGCLDHTLRLWSI 342
                   ISG  D T+++W+I
Sbjct: 116 DKK-ASMIISGSRDKTIKVWTI 136

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 66/159 (41%), Gaps = 25/159 (15%)

Query: 192 TGGKDCTLRVWKV----IASPLERNDLSSATAKPQAKRISMRVPPSPTVGRSVKEEPEQP 247
           +G +D T++VW +    +A+ L  ND  S           +RV P+        ++    
Sbjct: 124 SGSRDKTIKVWTIKGQCLATLLGHNDWVS----------QVRVVPNEKA-----DDDSVT 168

Query: 248 IGPASMDLYAPVFHPLPFRI---YQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRP 303
           I  A  D     ++   F+I   +  H  +I  L  S +G  I +   D    LW+    
Sbjct: 169 IISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAK 228

Query: 304 KALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI 342
           KA+   +  D V    F PN  R++++      ++++S+
Sbjct: 229 KAMYTLSAQDEVFSLAFSPN--RYWLAAATATGIKVFSL 265

>KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces
           cerevisiae YDR142c PAS7 peroxisomal import protein -
           peroxin singleton, start by similarity
          Length = 372

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 33/67 (49%), Gaps = 2/67 (2%)

Query: 249 GPASMDLYAPVFHPLPFRIYQEHTQDILDLDWS--KNGFILTTSMDKTARLWHCDRPKAL 306
           G  S+ L+       P  IY+EH +++   +W+  +    +++S D   +LW   RP++L
Sbjct: 81  GDGSLRLFDIKLKDYPIAIYKEHQREVFSCNWNMIQKQMFVSSSWDGKVKLWSLMRPQSL 140

Query: 307 KVFTHPD 313
              +  D
Sbjct: 141 MTMSPND 147

>Scas_571.4
          Length = 601

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 286 ILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI 342
           + ++S+D T ++W+  + K +    H D VT   F P D  +  +   +  L +W I
Sbjct: 164 LASSSLDFTVKIWNIKKGKVIGTLQHSDMVTAMAFDP-DGAYLATITRNKKLTIWDI 219

>YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and
           component of the SCF-Cdc4p complex
           (Skp1p-Cdc53p-Cdc34p-Cdc4p) which targets Sic1p, Far1p,
           Cdc6p, Ctf13p and Gcn4p for ubiquitin-dependent
           degradation, has WD (WD-40) repeats [2340 bp, 779 aa]
          Length = 779

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 35/74 (47%), Gaps = 2/74 (2%)

Query: 271 HTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKF-HPNDDRFF 328
           H   +  L ++  G +++ S D+T R+W   +     VF  H   V C       + ++ 
Sbjct: 421 HDGGVWALKYAHGGILVSGSTDRTVRVWDIKKGCCTHVFKGHNSTVRCLDIVEYKNIKYI 480

Query: 329 ISGCLDHTLRLWSI 342
           ++G  D+TL +W +
Sbjct: 481 VTGSRDNTLHVWKL 494

>YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative
           spliceosomal protein with similarity to S. pombe prp5p,
           has four WD (WD-40) repeats [1356 bp, 451 aa]
          Length = 451

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 31/69 (44%), Gaps = 1/69 (1%)

Query: 298 WHCDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDII 357
           WH     +  +  H  +V C    P D+ +FI+G  D T+++W +    +      G ++
Sbjct: 125 WHAPWKLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLK-TTLAGHVM 183

Query: 358 TAIDTSPRD 366
           T  D +  D
Sbjct: 184 TVRDVAVSD 192

 Score = 33.1 bits (74), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 7/95 (7%)

Query: 286 ILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILD 344
           ++++S D T RLW     K +KV T H   V     HP +  F ++      +R W + +
Sbjct: 281 VVSSSTDATVRLWDVVAGKTMKVLTHHKRSVRATALHPKE--FSVASACTDDIRSWGLAE 338

Query: 345 NSV--SFDYYCGDIITAIDTSPRDGKYTAAGTFNG 377
            S+  +F+     II  +  +  D  +  AG  NG
Sbjct: 339 GSLLTNFESEKTGIINTLSINQDDVLF--AGGDNG 371

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 84/237 (35%), Gaps = 68/237 (28%)

Query: 177 AVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTV 236
           +V A KFS D KY+A+G  D  L +W+                                 
Sbjct: 79  SVTALKFSPDNKYLASGSDDKILLIWE--------------------------------- 105

Query: 237 GRSVKEEPE-QPIGPASMDLYAPVFHPLPFRIYQEHTQDILDLDWSKNGFIL-TTSMDKT 294
               KEE   QP+     D+   + H    R    H  DI D+ W+ +  IL T  +D++
Sbjct: 106 ----KEEGAVQPL----FDMENDLEHWNVRRRLVAHDNDIQDICWAPDSSILVTVGLDRS 157

Query: 295 ARLWHCDRPKALKVF-THPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYC 353
             +W+    + +K F  H   V    F P  +++F +   D T+++         F Y+ 
Sbjct: 158 IIVWNGSTFEKIKRFDVHQSHVKGVVFDPA-NKYFATASDDRTVKV---------FRYHK 207

Query: 354 GD----IITAIDTSPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVLEKPNGTTKKV 406
           G      I  I T P          F G  +  Y R L        +  PN T   V
Sbjct: 208 GTDLSFTIEHIITEP----------FQGSPLTTYFRRLSWSPDGQHIAVPNATNGPV 254

>AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -
           NSH] complement(667539..669809) [2271 bp, 756 aa]
          Length = 756

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 37/76 (48%), Gaps = 2/76 (2%)

Query: 271 HTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVF-THPDFVTCAKFHPNDD-RFF 328
           H   +  L ++ +  +++ S D+T R+W+    K   VF  H   V C     +   ++ 
Sbjct: 406 HEGGVWALKYAGDEILVSGSTDRTVRIWNVKAGKCTHVFRGHTSTVRCLDVVEHGGIKYV 465

Query: 329 ISGCLDHTLRLWSILD 344
           ++G  D+TL +W + D
Sbjct: 466 VTGSRDNTLHVWKLPD 481

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 41/97 (42%), Gaps = 21/97 (21%)

Query: 267 IYQEHTQDILDLDWSKNG---FILTTSMDKTARLWHCD-------RPKALKVFT----HP 312
           +++ HT  +  LD  ++G   +++T S D T  +W           P A++ F     +P
Sbjct: 443 VFRGHTSTVRCLDVVEHGGIKYVVTGSRDNTLHVWKLPDPNSPDYNPNAMRQFNSIEDNP 502

Query: 313 DFVTCAKFHPNDDR-------FFISGCLDHTLRLWSI 342
            FV   + H    R         +SG  DH L +W I
Sbjct: 503 FFVGVLRGHMASVRTVSGHGNIVVSGSYDHNLMVWDI 539

>Kwal_55.21450
          Length = 503

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/79 (21%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 265 FRIYQEHTQDILDLDWSKNGF-ILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPN 323
            R Y+ H++ +  + ++  G   L+ S D+  ++W  +  K    +++     CA+F P+
Sbjct: 247 LRDYRGHSKAVRGISFNSEGSEFLSVSFDQQIKIWDTETGKVRHQYSYSCIPNCAEFRPS 306

Query: 324 DDRFFISGCLDHTLRLWSI 342
           +   FI G  +  +R + +
Sbjct: 307 NSNEFIVGLSNSEIRHYDL 325

>CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces
           cerevisiae YBR175w, start by similarity
          Length = 316

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 49/246 (19%), Positives = 95/246 (38%), Gaps = 16/246 (6%)

Query: 255 LYAPVFHPLPFRIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVFTHPD 313
           +Y    + L   +  EH   +  + WS +G  I + S D T  + H       ++  H  
Sbjct: 38  IYETSGYQLRETLVLEHAAGVSQICWSPDGKCIASCSDDFTVVVTHRQLGLLHRLVGHTA 97

Query: 314 FVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYC-GDIITAIDTSPRDGKYTAA 372
            V    ++   +  F S  +D ++++W +L  +V        + + +ID S  DG   ++
Sbjct: 98  PVISLCYNNKGNLLFTSS-MDESIKVWDVLTGTVMKTMSAHSEPVVSIDLSDNDGSILSS 156

Query: 373 GTFNGHIIILYTRGLEMVSTFHVLEKPNGTTKKVPESGPKITGIEFFKSAPDNDLRIMVT 432
           G+ +G I I  T     + T    +     T  VP +  K +          N   ++V 
Sbjct: 157 GSHDGLIRIFDTATGHCLKTLTYDKDWQSETGVVPIAKVKFSA---------NTKYLLVK 207

Query: 433 SNDSRIRIFRIKGQSLLEVL----KGFENTHSQISAHLILPPSKKIFVLAPSENQWVYCW 488
           S D  ++I+      ++       K +  TH      +    ++   +L+  E   +YCW
Sbjct: 208 SYDGVVKIWDSVSGDVVRTFKPSNKKYNLTHCCGMDFMYPQSTQSPLILSGYEKGEIYCW 267

Query: 489 RVESSA 494
              + A
Sbjct: 268 DSNTKA 273

>Scas_702.16
          Length = 816

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 60/267 (22%), Positives = 99/267 (37%), Gaps = 55/267 (20%)

Query: 172 ENSDRAVWATKFSRDGKYMATGGKDCTLRVWKV-----IASPLERND---LSSATAKPQA 223
           E+    ++    S DGK +ATGG D  +R+W V     I   L   D   +     KP A
Sbjct: 14  ESRSYEIYTVDVSPDGKRVATGGLDGKIRIWSVDSIKQIVKILSLKDEVPIDKELKKPLA 73

Query: 224 KR-------ISMRVPPSPTVGRSV------------KEEPEQPI--GPASMDLYAPVFHP 262
                      ++  P+     S             +E P QPI  G +  + +A     
Sbjct: 74  SMSRHTGSVTCLKFSPNGKYLASGSDDRILLIWTLDEERPIQPIFGGESEKERWA----- 128

Query: 263 LPFRIYQEHTQDILDLDWSKN-GFILTTSMDKTARLWHCDRPKALKVF-THPDFVTCAKF 320
           +  R+   H  DI D+ W+ +   +++  +D+   +W+    + LK F  H   V    F
Sbjct: 129 VRKRLVA-HDNDIQDICWAPDSSLLVSVGLDRAVIIWNGITFEKLKRFDVHQSHVKGVIF 187

Query: 321 HPNDDRFFISGCLDHTLRLWSILDNSVSFDYY-CGDIITAIDTSPRDGKYTAAGTFNGHI 379
            P  +++F +   D T+++         F Y+  GD    I+       +     F G  
Sbjct: 188 DPA-NKYFATASDDRTMKI---------FRYHKIGDASFTIE-------HVVTEPFKGSP 230

Query: 380 IILYTRGLEMVSTFHVLEKPNGTTKKV 406
           +  Y R L        +  PN T   V
Sbjct: 231 LTTYFRRLSWSPDGQHIAAPNATNGPV 257

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 44/104 (42%), Gaps = 25/104 (24%)

Query: 263 LPF--RIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKAL-KVFT-------- 310
           LP+   I +  + +I  +D S +G  + T  +D   R+W  D  K + K+ +        
Sbjct: 6   LPWLSHIEESRSYEIYTVDVSPDGKRVATGGLDGKIRIWSVDSIKQIVKILSLKDEVPID 65

Query: 311 ------------HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI 342
                       H   VTC KF PN  ++  SG  D  L +W++
Sbjct: 66  KELKKPLASMSRHTGSVTCLKFSPN-GKYLASGSDDRILLIWTL 108

>Scas_631.17
          Length = 474

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 35/75 (46%), Gaps = 2/75 (2%)

Query: 269 QEHTQDILDLDWSKNGF-ILTTSMDKTARLWHCDR-PKALKVFTHPDFVTCAKFHPNDDR 326
           Q H + I  +DWS +G+ I T   D    +W   +  +  ++  H + VT  +F  +   
Sbjct: 356 QGHAKPIYSVDWSPDGYHIATGGGDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGH 415

Query: 327 FFISGCLDHTLRLWS 341
             +S   D  +R++S
Sbjct: 416 CLVSCGYDKQIRIYS 430

>YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in
           mitochondrial division and mitochondrial fission,
           contains WD (WD-40) repeats [2145 bp, 714 aa]
          Length = 714

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%)

Query: 310 THPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI 342
           TH DF+TC  F         +G LDHT+++W +
Sbjct: 396 THDDFLTCLDFDAPFGTLCTAGYLDHTVKIWDL 428

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 4/58 (6%)

Query: 286 ILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI 342
           + T + D   RLW     K ++    H D +T  KF   D    ++G  D T+R+W +
Sbjct: 579 LATGTKDGVVRLWDLRSGKVIRTLKGHTDAITSLKF---DSACLVTGSYDRTVRIWDL 633

>AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH]
           (1107932..1109335) [1404 bp, 467 aa]
          Length = 467

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 79/193 (40%), Gaps = 24/193 (12%)

Query: 300 CDRPK-ALKVF-THPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCG--D 355
           C  PK  L V+  H    T  +F       F+SG  D  L++W +    +    YCG   
Sbjct: 160 CYLPKRILHVYDGHDRGTTALEFLRKTGHLFLSGGNDGVLKIWDMYHERLLLRDYCGHRK 219

Query: 356 IITAIDTSPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVLEKPNGTTKKVPESGPKITG 415
            I+A   S  D    A+ +++  + I  T   ++++       PN  T            
Sbjct: 220 AISATSFS-HDNVQFASSSYDKTVKIWDTETGDIINRLSFKATPNCMTFH---------- 268

Query: 416 IEFFKSAPDNDLRIMVTSNDSRIRIFRIKGQSLLEVLKGFENTHSQISAHLILPPSKKIF 475
                  P N  +++V  +DS+IR F ++      V++ +++  + I+A    P   K  
Sbjct: 269 -------PQNKEQLLVGFSDSKIRHFDLRVDKKDGVIQIYDHHLAAINALRYFPDGSKF- 320

Query: 476 VLAPSENQWVYCW 488
            ++ S+++ +  W
Sbjct: 321 -ISSSDDKSIRIW 332

>YDR142C (PEX7) [987] chr4 complement(740467..741594) Peroxisomal
           biogenesis protein (peroxin) that serves as import
           receptor for proteins containing peroxisomal targeting
           signal 2 (PTS2), member of WD (WD-40) repeat family
           [1128 bp, 375 aa]
          Length = 375

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 34/65 (52%), Gaps = 4/65 (6%)

Query: 249 GPASMDLYAPVFHPLPFRIYQEHTQDILDLDW---SKNGFILTTSMDKTARLWHCDRPKA 305
           G  ++ L+   F   P  I++EH +++   +W   ++  F L++S D + ++W   R ++
Sbjct: 81  GDGTLRLFDTTFKEFPIAIFKEHEREVFSCNWNLVNRQNF-LSSSWDGSIKIWSPLRKQS 139

Query: 306 LKVFT 310
           L   T
Sbjct: 140 LMTLT 144

>YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa
           subunit of elongator and elongating RNA polymerase II
           holoenzyme, has WD (WD-40) repeats [2367 bp, 788 aa]
          Length = 788

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 5/65 (7%)

Query: 286 ILTTSMDKTARLWHCDRPKALKVFT----HPDFVTCAKFHPNDDRFFISGCLDHTLRLWS 341
           I+     KT  LW    P    V+     H   VTC +F P+ D F +S   DH +++W 
Sbjct: 29  IVAFGAGKTIALWDPIEPNNKGVYATLKGHEAEVTCVRFVPDSD-FMVSASEDHHVKIWK 87

Query: 342 ILDNS 346
             D S
Sbjct: 88  FTDYS 92

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 21/27 (77%), Gaps = 1/27 (3%)

Query: 272 TQDILDLDWSKNG-FILTTSMDKTARL 297
           T+D+ D+ WS +G ++L TS+D+T RL
Sbjct: 385 TKDVTDIAWSPSGEYLLATSLDQTTRL 411

>CAGL0H03729g 342948..343859 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8, start by
           similarity
          Length = 303

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 71/174 (40%), Gaps = 22/174 (12%)

Query: 180 ATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVGRS 239
           +  F +D K+M T  +D T++VW + +  + RN   +A            V   P  G  
Sbjct: 80  SVSFQQDNKWMVTSSEDGTIKVWDIRSPSVPRNYKHNAPVN--------EVVIHPNQGEL 131

Query: 240 VKEEPEQPIGPASMDLYAPVFHPLPFRIYQEHTQDILDLDWSKNGFILTTSMDK-TARLW 298
           +  + +      ++ ++    +    ++  E    +  L  + +G +L  + +K    +W
Sbjct: 132 ISCDRD-----GNIRIWDLGENQCTHQLTPEDDVPLQSLSVASDGSMLVAANNKGNCYVW 186

Query: 299 ----HCDRPK---ALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDN 345
               H D      A K   HP ++T      +D +   +   DHT R+WS+ DN
Sbjct: 187 EMPNHTDASNLKPATKFKAHPSYITRVLL-SSDVKHMATCSADHTARIWSVEDN 239

 Score = 33.5 bits (75), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 42/197 (21%), Positives = 78/197 (39%), Gaps = 30/197 (15%)

Query: 264 PFRIYQEHTQDILDLDWSK-NGFILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHP 322
           P   ++ H  ++  + + + N +++T+S D T ++W    P   + + H   V     HP
Sbjct: 67  PVASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIRSPSVPRNYKHNAPVNEVVIHP 126

Query: 323 NDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTSPRDGKYTAAGTFNGHIIIL 382
           N     IS   D  +R+W + +N       C   +T  D  P      A+   +G +++ 
Sbjct: 127 NQGE-LISCDRDGNIRIWDLGENQ------CTHQLTPEDDVPLQSLSVAS---DGSMLVA 176

Query: 383 YTRGLEMVSTFHVLEKPNGTTKKVPESGPKITGIEFFKSAPDNDLRIMVTSN-------- 434
                      +V E PN T     +   K      FK+ P    R++++S+        
Sbjct: 177 ANNK----GNCYVWEMPNHTDASNLKPATK------FKAHPSYITRVLLSSDVKHMATCS 226

Query: 435 -DSRIRIFRIKGQSLLE 450
            D   RI+ ++    LE
Sbjct: 227 ADHTARIWSVEDNFNLE 243

>Scas_581.3
          Length = 626

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 9/55 (16%)

Query: 307 KVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAID 361
           +V  H   VT  +FHP +D    SG +D    LW   +N         D+I +ID
Sbjct: 486 RVNFHSSDVTSLRFHPQNDDLLCSGSMDWNCHLWDTFNN---------DLIDSID 531

>ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH]
           complement(647933..649102) [1170 bp, 389 aa]
          Length = 388

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 46/100 (46%), Gaps = 17/100 (17%)

Query: 255 LYAPVFHPLPFRIYQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKAL-KVFTHPD 313
           L+ P+FH      +Q H   +  LD S+  ++++ S D+  R++   + K L  +  H  
Sbjct: 30  LFTPIFH------FQAHALSVKTLDISRR-YLVSGSNDEHIRIYDLQKRKELGTLLNHNG 82

Query: 314 FVTCAKF---------HPNDDRFFISGCLDHTLRLWSILD 344
            +T  +F             +++ +S   DHT+ +W + D
Sbjct: 83  SITSLRFSRATTDKDGKQQGNKWLLSASEDHTIIIWRVKD 122

>AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH]
           (526057..527832) [1776 bp, 591 aa]
          Length = 591

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 46/110 (41%), Gaps = 16/110 (14%)

Query: 355 DIITAIDTSPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVLEKPNGTTKKVPESGPKIT 414
           D I  +  SP DGKY   G  +  +I+  T  L  V      ++             ++ 
Sbjct: 256 DEILTVAASP-DGKYVVTGGRDKKLIVWSTESLAPVKVIPTKDRRG-----------EVL 303

Query: 415 GIEFFKSAPDNDLRIMVTSNDSRIRIFRIKGQSLLEVLKGFENTHSQISA 464
           G+ F +    N  ++     D +IR F I   S LEVL G ++  + ISA
Sbjct: 304 GLAFRR----NTDQLYAACADYKIRTFAINQFSQLEVLYGHQDIVADISA 349

>Kwal_14.884
          Length = 395

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 49/109 (44%), Gaps = 26/109 (23%)

Query: 255 LYAPVFHPLPFRIYQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKAL-KVFTHPD 313
           ++ P+FH      +Q H+  +  LD SK  ++++ S D+  R++   + K L  + +H  
Sbjct: 30  IFTPIFH------FQAHSLSVKCLDISKR-YLVSGSNDEHIRIYDLQKRKELGTLLSHQG 82

Query: 314 FVTCAKFHP-------NDD-----------RFFISGCLDHTLRLWSILD 344
            +T  KF         N+D           ++ IS   DH L +W + D
Sbjct: 83  SITALKFSKGTKIEDKNEDDTGLTTGRGNSKWLISASDDHNLVIWRVKD 131

>AAL009C [178] [Homologous to ScYNL006W (LST8) - SH]
           (325785..326696) [912 bp, 303 aa]
          Length = 303

 Score = 33.5 bits (75), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 31/165 (18%), Positives = 68/165 (41%), Gaps = 24/165 (14%)

Query: 190 MATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVGRSVKEEPEQPIG 249
           +A+ G D T+R W+ +     R   +   A  Q  R+ +                ++   
Sbjct: 5   LASAGYDHTIRFWEALTGVCSR---TIQHADSQVNRLEI--------------TSDKRYL 47

Query: 250 PASMDLYAPVF-----HPLPFRIYQEHTQDILDLDWSK-NGFILTTSMDKTARLWHCDRP 303
            A+  L+  ++     +P P   ++ H  ++  + + + N +++++S D T ++W    P
Sbjct: 48  AAAGHLHVRMYDIRTTNPNPVTSFEGHRGNVTSIAFQQDNKWMVSSSEDGTIKVWDVRSP 107

Query: 304 KALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVS 348
              + + H   V     HPN     IS   D  +++W + +N  +
Sbjct: 108 SVQRNYKHDAPVNEVVIHPNQGE-LISCDQDGNIKIWDLGENQCT 151

 Score = 32.7 bits (73), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 3/59 (5%)

Query: 286 ILTTSMDKTARLWHCDRPKALKVF--THPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI 342
           + T S D TAR+W  +    L+     H  +V    F   D  + ++ C DH +RLW +
Sbjct: 222 LATCSADHTARVWSVEDNFQLETTLDAHSRWVWDCAFSA-DSAYLVTACSDHYVRLWDL 279

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 20/30 (66%)

Query: 183 FSRDGKYMATGGKDCTLRVWKVIASPLERN 212
           F +D K+M +  +D T++VW V +  ++RN
Sbjct: 83  FQQDNKWMVSSSEDGTIKVWDVRSPSVQRN 112

>KLLA0E21879g complement(1944865..1945866) similar to sgd|S0002675
           Saccharomyces cerevisiae YDR267c, start by similarity
          Length = 333

 Score = 33.5 bits (75), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 45/91 (49%), Gaps = 5/91 (5%)

Query: 265 FRIYQEHTQDILDLDWSKN-GFILTTSMDKTARLW-HCDRP-KALKVFT-HPDFVTCAKF 320
             + QEH+QD+  + W ++   + ++S D T R+W  CD   +   V   H   V  + F
Sbjct: 148 ISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSDF 207

Query: 321 H-PNDDRFFISGCLDHTLRLWSILDNSVSFD 350
              N +    SG  D T+R+W + D++  ++
Sbjct: 208 EKSNSNVRLCSGSDDGTVRIWCLEDDNGEYE 238

>Kwal_33.13515
          Length = 398

 Score = 33.5 bits (75), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 49/127 (38%), Gaps = 20/127 (15%)

Query: 306 LKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTS-- 363
           ++   H   +TC K  P D+RF ++G LD     W +          C  +I   DTS  
Sbjct: 230 VRACGHTGAITCMKLDP-DNRFLVAGSLDTICSFWDLSSMC------CERVINGFDTSIL 282

Query: 364 ----PRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVLEKPNGTTKKVPESGPKITGIEFF 419
                RDG   A G  + +   +Y   +E  +  +  E  N   K+     P   G   F
Sbjct: 283 DLDLSRDG--VAVGLCSDNQTRIYL--IESGACLYEFESKNKIEKQKFRFYP---GKMSF 335

Query: 420 KSAPDND 426
            +  DND
Sbjct: 336 LAVSDND 342

>CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces
           cerevisiae YOR269w PAC1, hypothetical start
          Length = 467

 Score = 33.5 bits (75), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 6/63 (9%)

Query: 280 WSKNGFIL--TTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHT 336
           W K+  +L  ++S D T ++W  +  + L+ F+ H ++V         D + +SG LD T
Sbjct: 230 WQKDNDVLLASSSRDATVKVWRVNDSRCLQSFSPHSEWVKSIDVL---DEYILSGSLDST 286

Query: 337 LRL 339
           LRL
Sbjct: 287 LRL 289

>Scas_695.15
          Length = 327

 Score = 33.5 bits (75), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 31/161 (19%), Positives = 67/161 (41%), Gaps = 16/161 (9%)

Query: 190 MATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVGRSVKEEPEQPIG 249
           + + G D T+R W+ +     R   +   +  Q  R+ +          +  ++     G
Sbjct: 25  LVSAGYDHTIRFWEALTGVCSR---TIQHSDSQVNRLEI----------TNDKKLLAAAG 71

Query: 250 PASMDLY-APVFHPLPFRIYQEHTQDILDLDWSK-NGFILTTSMDKTARLWHCDRPKALK 307
             ++ LY     +P     ++ H  ++  + + + N +++T+S D T ++W    P   +
Sbjct: 72  YQNVRLYDIRTTNPNAVATFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKVWDVRSPSVPR 131

Query: 308 VFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVS 348
            + H   V     HPN     IS   D T+++W + +N  +
Sbjct: 132 NYKHNAPVNEVVIHPNQGE-LISCDRDGTIKIWDLGENQCT 171

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 180 ATKFSRDGKYMATGGKDCTLRVWKVIASPLERN 212
           +  F +D K+M T  +D T++VW V +  + RN
Sbjct: 100 SVSFQQDNKWMVTSSEDGTIKVWDVRSPSVPRN 132

>ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH]
           (128830..130335) [1506 bp, 501 aa]
          Length = 501

 Score = 33.5 bits (75), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 37/82 (45%), Gaps = 6/82 (7%)

Query: 264 PFRIYQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFT---HPDFVTCAKF 320
           P  ++  H+Q I    W  +  I++TSMD + R+W       +   T    P+F      
Sbjct: 357 PSHVFYGHSQSITSAHWVDDDTIISTSMDGSIRVWSLASNSTVASATVDGVPNF--TGAL 414

Query: 321 HPNDDRFFISGCLDHTLRLWSI 342
            P+  + F +G LD  + ++ I
Sbjct: 415 SPDQGK-FATGTLDGEVMVYDI 435

>Scas_615.11
          Length = 349

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 42/88 (47%), Gaps = 7/88 (7%)

Query: 265 FRIYQEHTQDILDLDWS-KNGFILTTSMDKTARLW--HCDRPKALKVFT-HPDFVTCAKF 320
             + QEH+QD+  + W  +   + ++S D T RLW  + D  +   V   H   V C+ F
Sbjct: 160 ISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDF 219

Query: 321 HPNDDRFFI---SGCLDHTLRLWSILDN 345
               +   I   SG  D T+R+W  +D+
Sbjct: 220 EKGKNGESIRLCSGSDDSTVRVWRYIDD 247

>YNL035C (YNL035C) [4552] chr14 complement(568520..569689) Protein
           containing three WD domains (WD-40 repeats), which may
           mediate protein-protein interactions, has moderate
           similarity to uncharacterized C. albicans Orf6.3370p
           [1170 bp, 389 aa]
          Length = 389

 Score = 33.5 bits (75), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 296 RLWHCDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI 342
           R W  D P    + +H D VTC KFHP+D    +SG  D    ++ +
Sbjct: 134 RKW--DTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDL 178

>YNL006W (LST8) [4579] chr14 (620066..620977) Protein required for
           transport of permeases from the Golgi to the plasma
           membrane [912 bp, 303 aa]
          Length = 303

 Score = 33.1 bits (74), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 44/201 (21%), Positives = 77/201 (38%), Gaps = 39/201 (19%)

Query: 180 ATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKP------QAKRIS------ 227
           +  F +D ++M T  +D T++VW V +  + RN   +A          Q + IS      
Sbjct: 80  SVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEVVIHPNQGELISCDRDGN 139

Query: 228 MRV-------------PPSPTVGRSVKEEPEQPIGPAS----------MDLYAPVFHPLP 264
           +R+             P   T  +S+    +  +  A+          M  +    H  P
Sbjct: 140 IRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKP 199

Query: 265 FRIYQEHTQDILDLDWSKN-GFILTTSMDKTARLWHCDRPKALKVFT--HPDFVTCAKFH 321
              ++ H+  I  +  S +   + T S D TAR+W  D    L+     H  +V    F 
Sbjct: 200 VTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFS 259

Query: 322 PNDDRFFISGCLDHTLRLWSI 342
             D  + ++   DH +RLW +
Sbjct: 260 A-DSAYLVTASSDHYVRLWDL 279

 Score = 32.7 bits (73), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 32/161 (19%), Positives = 67/161 (41%), Gaps = 16/161 (9%)

Query: 190 MATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVGRSVKEEPEQPIG 249
           + + G D T+R W+ +     R   +   +  Q  R+ +          +  ++     G
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSR---TIQHSDSQVNRLEI----------TNDKKLLATAG 51

Query: 250 PASMDLY-APVFHPLPFRIYQEHTQDILDLDWSK-NGFILTTSMDKTARLWHCDRPKALK 307
             ++ LY     +P P   ++ H  ++  + + + N +++T+S D T ++W    P   +
Sbjct: 52  HQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPR 111

Query: 308 VFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVS 348
            + H   V     HPN     IS   D  +R+W + +N  +
Sbjct: 112 NYKHNAPVNEVVIHPNQGE-LISCDRDGNIRIWDLGENQCT 151

>ABL044C [548] [Homologous to ScYMR093W - SH] (312378..313934) [1557
           bp, 518 aa]
          Length = 518

 Score = 33.5 bits (75), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 4/57 (7%)

Query: 286 ILTTSMDKTARLW---HCDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRL 339
           ++T + D+  R+W   H   P  L++    D+V    F P      +SGC D  +RL
Sbjct: 140 LVTATDDRVVRVWDISHAYEP-TLELLGASDYVRSVCFVPGAPHMVVSGCYDGVVRL 195

 Score = 33.1 bits (74), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 2/38 (5%)

Query: 305 ALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI 342
           ++K  THP  VT  KFHP D +  ++   D  +R+W I
Sbjct: 119 SIKASTHPAHVT--KFHPLDKQTLVTATDDRVVRVWDI 154

>YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and
           COMPASS complex, has several WD (WD-40) repeats and may
           be involved in chromatin remodeling [948 bp, 315 aa]
          Length = 315

 Score = 32.7 bits (73), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 45/99 (45%), Gaps = 6/99 (6%)

Query: 246 QPIGPASMDLYAPVFHPLPFRI---YQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCD 301
           Q I  AS D    + H L + +   +  HT  ++ L +++ G  + T+SMD++ ++W   
Sbjct: 68  QCIATASDDFSVEIIH-LSYGLLHTFIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTL 126

Query: 302 RPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRL 339
               +K  + H + V       ND     SG  D  +R+
Sbjct: 127 NGSLMKTISAHSEAVVSVDVPMNDSSILSSGSYDGLIRI 165

>KLLA0F13772g 1276532..1278094 highly similar to sp|Q04305
           Saccharomyces cerevisiae YMR093w singleton, start by
           similarity
          Length = 520

 Score = 33.1 bits (74), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 35/82 (42%), Gaps = 12/82 (14%)

Query: 264 PFRIYQEHTQDILDLDWSKNGFILTTSMDKTARLW---HCDRPKALKVFTHPDFVTCAKF 320
           P  + + H QD        N  ++T + D+  RLW   H   P  L++    D+V    F
Sbjct: 126 PTHVTKFHDQD--------NKTLVTANDDRVVRLWDVSHAYEP-TLQLTGASDYVRSVCF 176

Query: 321 HPNDDRFFISGCLDHTLRLWSI 342
            PN      +G  D  +RL+ I
Sbjct: 177 VPNAPHMVATGSYDGVVRLYDI 198

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 38/81 (46%), Gaps = 5/81 (6%)

Query: 305 ALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCG--DIITAIDT 362
           +++  +HP  VT  KFH  D++  ++   D  +RLW +           G  D + ++  
Sbjct: 119 SIQASSHPTHVT--KFHDQDNKTLVTANDDRVVRLWDVSHAYEPTLQLTGASDYVRSVCF 176

Query: 363 SPRDGKYTAAGTFNGHIIILY 383
            P      A G+++G ++ LY
Sbjct: 177 VPNAPHMVATGSYDG-VVRLY 196

>Sklu_2435.13 YPR137W, Contig c2435 18346-20073
          Length = 575

 Score = 33.1 bits (74), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 7/75 (9%)

Query: 300 CDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYY-----CG 354
           C +    K  THP ++T     P  +  F+SG  + +L+LW I +N   F+       C 
Sbjct: 462 CQQQLQDKNLTHPYWITSLHAIPYSN-VFVSGSWNGSLKLWKISENLREFEILAELPNCR 520

Query: 355 DIITAIDTSPRDGKY 369
            ++T I  +   GKY
Sbjct: 521 GLVTNIQ-AVESGKY 534

 Score = 30.0 bits (66), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 45/110 (40%), Gaps = 16/110 (14%)

Query: 355 DIITAIDTSPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVLEKPNGTTKKVPESGPKIT 414
           D I  +  SP DGKY   G  +  +I+  T  L  V      ++             ++ 
Sbjct: 239 DEILTVAASP-DGKYVVTGGRDRKLIVWSTESLSPVKVIPTKDRRG-----------EVL 286

Query: 415 GIEFFKSAPDNDLRIMVTSNDSRIRIFRIKGQSLLEVLKGFENTHSQISA 464
            + F K    N  ++  +  D ++R + I   S LEVL G ++    ISA
Sbjct: 287 SLAFRK----NSDQLFASCADYKVRTYAINQFSQLEVLYGHQDLVVDISA 332

>YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein
           required for the second catalytic step of mRNA splicing,
           member of WD (WD-40) repeat family [1368 bp, 455 aa]
          Length = 455

 Score = 33.1 bits (74), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 5/43 (11%)

Query: 311 HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYC 353
           HP+  T  KF P      +SG  DHT+++W         DY C
Sbjct: 161 HPEGTTALKFLPKTGHLILSGGNDHTIKIWDFY-----HDYEC 198

>Kwal_26.7570
          Length = 218

 Score = 32.3 bits (72), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 48/108 (44%), Gaps = 3/108 (2%)

Query: 261 HPLPFRIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCA 318
           + +P R ++ H+  + D   + +G + L+ S DKT RLW     K ++ F  H   V   
Sbjct: 54  YGVPVRSFRGHSHIVQDCTVTPDGEYALSASWDKTVRLWELATGKCIQRFVGHKSDVLSV 113

Query: 319 KFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTSPRD 366
                  +  +S   D T+++W+ L   +       D ++ +  +P +
Sbjct: 114 TIDRRASQ-IVSASRDKTVKVWNTLGECMVTLLGHNDWVSQVRVAPNE 160

>YMR093W (UTP15) [4051] chr13 (454014..455555) Protein component of
           U3 snoRNP (renamed small subunit processome) which is
           required for 18S biogenesis, has WD (WD-40) repeats
           [1542 bp, 513 aa]
          Length = 513

 Score = 33.1 bits (74), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 33/78 (42%), Gaps = 4/78 (5%)

Query: 310 THPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCG--DIITAIDTSPRDG 367
           THP  VT  KFH  D++   +   D   RLW I +         G  D +  +   P   
Sbjct: 124 THPTHVT--KFHTQDNKILATASDDRVTRLWDISNAYEPQLELTGATDYVRTLSFIPAAP 181

Query: 368 KYTAAGTFNGHIIILYTR 385
              A G+++G I +  TR
Sbjct: 182 HLVATGSYDGLIRLYDTR 199

>YGL190C (CDC55) [1803] chr7 complement(145813..147393) Protein
           serine/threonine phosphatase 2A (PP2A) regulatory
           subunit B, ceramide-activated protein phosphatase B
           subunit, has WD (WD-40) repeats [1581 bp, 526 aa]
          Length = 526

 Score = 33.1 bits (74), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 44/203 (21%), Positives = 80/203 (39%), Gaps = 26/203 (12%)

Query: 196 DCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSP--TVGRSVKEEPE-QPIGPAS 252
           D T+++WKV    ++   L S     +    + +  P    + G SV+     Q +    
Sbjct: 107 DKTIKLWKVYEKNIK---LVSQNNLTEGVTFAKKGKPDNHNSRGGSVRAVLSLQSLKLPQ 163

Query: 253 MDLYAPVFHPLPFRIYQE-HTQDILDLDWSKNGFILTTSMDKTARLWHCDRP-------- 303
           +  +  +    P RIY   HT  I  +  + +     ++ D    LW+ D P        
Sbjct: 164 LSQHDKIIAATPKRIYSNAHTYHINSISLNSDQETFLSADDLRINLWNLDIPDQSFNIVD 223

Query: 304 -KALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSV------SFDYYCGDI 356
            K   +    + +T A+FHP +   F+      T++L  +  NS+      +F+ Y   I
Sbjct: 224 IKPTNMEELTEVITSAEFHPQECNLFMYSSSKGTIKLCDMRQNSLCDNKTKTFEEYLDPI 283

Query: 357 ----ITAIDTSPRDGKYTAAGTF 375
                T I +S  D K++  G +
Sbjct: 284 NHNFFTEITSSISDIKFSPNGRY 306

>AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C
           (CAF4) - SH] complement(52978..55125) [2148 bp, 715 aa]
          Length = 715

 Score = 33.1 bits (74), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 4/58 (6%)

Query: 286 ILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI 342
           + T + D   RLW     + ++    H D VT  +F   D    ++G LD+++R+W +
Sbjct: 580 LATGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQF---DSLNLVTGSLDNSIRIWDL 634

>ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH]
           complement(529784..531187) [1404 bp, 467 aa]
          Length = 467

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 70/176 (39%), Gaps = 23/176 (13%)

Query: 174 SDRAVWATKFSRDGKYMATGGKD-CT----LRVWKVIASPLERNDLSSATAKPQAKRISM 228
           SD  V   KF R+G  +ATG  D CT    LR    IA+      +  AT   Q   I  
Sbjct: 303 SDSDVSKVKFFRNGNTIATGSDDGCTNLYDLRSDCRIANYSLSRSIHGATPVQQQTYIMS 362

Query: 229 RVPPSPTVGRSVKEEPEQP-IGPASMDLYAPVFHPLPFRIYQEHTQDILDLDWSKNGFIL 287
            +  +   G   +  P  P IG  S                    Q ++ +D+S++G +L
Sbjct: 363 NMDYTAPSGTLARASPYSPAIGTVSSSFI--------------DNQGVISMDFSRSGRLL 408

Query: 288 TTSMDK-TARLWHCDRPKAL-KVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWS 341
             S  +    +W   + + + K+  H D ++     P D     +G  D T+++WS
Sbjct: 409 YVSYTEFGCAVWDLVKGEIIGKLDGHSDRISGVATSP-DGLAICTGSWDMTMKVWS 463

 Score = 30.4 bits (67), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 5/79 (6%)

Query: 267 IYQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFT-HPDFVTCAKFHP--- 322
           I++ HT  I ++++  +  ILT S D T  LW   + K +  F  H   V      P   
Sbjct: 211 IFKGHTCYISEIEFLDDNSILTASGDMTCALWDITKSKRINEFADHLGDVLSLSAAPTET 270

Query: 323 -NDDRFFISGCLDHTLRLW 340
             +   F SG  D  L +W
Sbjct: 271 EGNGNVFASGGSDGYLYIW 289

>YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member of
           the Utp21-specific WD40 associated domain containing
           family, contains seven WD domains (WD-40 repeat), which
           may mediate protein-protein interactions, has high
           similarity to uncharacterized C. albicans Orf6.6423p
           [2820 bp, 939 aa]
          Length = 939

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/92 (23%), Positives = 39/92 (42%), Gaps = 4/92 (4%)

Query: 254 DLYAPVFHPLPFRIYQE---HTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVF 309
           DL   V   +  R+ ++   H+  I   D+S  G +I++ S+D T R W       +   
Sbjct: 564 DLSIVVIDAVTQRVVRQLWGHSNRITAFDFSPEGRWIVSASLDSTIRTWDLPTGGCIDGI 623

Query: 310 THPDFVTCAKFHPNDDRFFISGCLDHTLRLWS 341
              +  T  KF PN D    +    + + +W+
Sbjct: 624 IVDNVATNVKFSPNGDLLATTHVTGNGICIWT 655

>CAGL0C00737g complement(75028..77478) similar to tr|Q05946
           Saccharomyces cerevisiae YLR222c, hypothetical start
          Length = 816

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 42/92 (45%), Gaps = 12/92 (13%)

Query: 262 PLPFRIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAK- 319
           P+   +Y+ H+  +  L  +++G ++ T S DKTA LWH +     + + +  FV  A  
Sbjct: 380 PIEVNLYEGHSDLLNSLACTEDGQWLATASKDKTAILWHWNNTSK-RFYIYATFVGHAAS 438

Query: 320 ---------FHPNDDRFFISGCLDHTLRLWSI 342
                       N  ++ I+   D T++ W I
Sbjct: 439 VSAVCLPNVMEKNYPKYIITASNDLTVKKWEI 470

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 68/161 (42%), Gaps = 12/161 (7%)

Query: 188 KYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVGRSVKEEPEQP 247
           KY+ T   D T++ W++   P  +NDL+      ++  I  R      +  ++   P   
Sbjct: 454 KYIITASNDLTVKKWEI---PPMKNDLNEVPFIVKSS-IYTRHAHEKDI-NAISMAPNDS 508

Query: 248 I-GPASMDLYAPVFH---PLPFRIYQEHTQDILDLDWSKN-GFILTTSMDKTARLWHCDR 302
           I   AS D    +++     P      H + + D+ + ++  +I T S DKT ++W  + 
Sbjct: 509 IFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCESEKWIATCSGDKTVKIWSLES 568

Query: 303 PKALKVFT-HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI 342
              LK    H + V    F  N  +  +S   D  +++W I
Sbjct: 569 FTVLKTLEGHTNAVQRCSFM-NKQKQLVSAGADGLIKVWDI 608

>Sklu_2420.2 YPL151C, Contig c2420 3924-5249
          Length = 441

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 71/173 (41%), Gaps = 16/173 (9%)

Query: 286 ILTTSMDKTARLWHCDRPKALKVFTHPD-FVTCAKFHPNDDRFFISGCLDHTLRLWSILD 344
           +++ S D T RLW     K LKV TH    V     HP +  F IS      +R W + +
Sbjct: 271 VVSCSADATVRLWDITAGKTLKVLTHHKRSVRDIGIHPGE--FSISSACTDDIRSWKLPE 328

Query: 345 NSV--SFDYYCGDIITAIDTSPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVLEKPNGT 402
             +  +F      II  +  +  D  +  AG+ NG ++  Y        T H  ++ +  
Sbjct: 329 GQLLTNFQSEKTGIINTLSINQDDVLF--AGSDNG-VLSFYD-----YKTGHKYQQLD-- 378

Query: 403 TKKVPESGPKITGIEFFKSAPDNDLRIMVTSNDSRIRIFRIKGQSLLEVLKGF 455
           T ++P S     GI    +     LR++   +D  I+I++    +  E   G 
Sbjct: 379 TTEIPGSLESERGI-LTSTFDQTGLRLITGESDKSIKIWKQDQDATPETYTGL 430

>ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH]
           complement(590077..591354) [1278 bp, 425 aa]
          Length = 425

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 62/159 (38%), Gaps = 21/159 (13%)

Query: 298 WHCDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDII 357
           WH        +  H  +V C    P D+ +F +G  D T+R+W +    +      G I+
Sbjct: 99  WHAPWKLTRVINGHTGWVRCVCVDPVDNAWFATGSNDSTIRVWDLATGKLKVTLQ-GHIM 157

Query: 358 TAID--TSPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVLEKPNGTTKKVPESGPKITG 415
           T  D   S R   Y  + + +  +         +V  FH      GT          ++G
Sbjct: 158 TVRDICISARH-PYMFSASQDKLVKCWDLERNTVVRDFH------GT----------LSG 200

Query: 416 IEFFKSAPDNDLRIMVTSNDSRIRIFRIKGQSLLEVLKG 454
           +      P  DL I+    DS +R++ I+ +S +  L G
Sbjct: 201 VHSVDLHPSLDL-IVSAGRDSVVRVWDIRSRSCVLTLAG 238

>Scas_675.18
          Length = 876

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%)

Query: 173 NSDRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLE 210
           N+  +V     S D KY+ + G D  +R+W +  SPLE
Sbjct: 64  NTRSSVLCLTRSDDEKYLFSAGADSLVRIWSINGSPLE 101

>Kwal_27.12239
          Length = 316

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 31/143 (21%), Positives = 63/143 (44%), Gaps = 29/143 (20%)

Query: 180 ATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPP-SPTVGR 238
           + K++  G  + +   D ++++W +++  L R    SA ++P    +S+ +PP  P++  
Sbjct: 104 SVKYTMKGNLLCSCSMDESIKIWDILSGTLLRT--LSAHSEP---VVSIDLPPFDPSI-- 156

Query: 239 SVKEEPEQPIGPASMDLYAPVF-----HPLPFRIYQEHTQD------ILDLDWSKNG-FI 286
                    +   S D    +F     H L    Y +  Q       I  + +S+NG ++
Sbjct: 157 ---------LSSGSYDGLIRIFDTATGHCLKTLTYDKDWQSENGVVPISQVKFSRNGKYL 207

Query: 287 LTTSMDKTARLWHCDRPKALKVF 309
           L  S+D   ++W   R K ++ F
Sbjct: 208 LVKSLDGILKIWDFVRGKVVRTF 230

 Score = 29.6 bits (65), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 20/41 (48%)

Query: 172 ENSDRAVWATKFSRDGKYMATGGKDCTLRVWKVIASPLERN 212
           EN    +   KFSR+GKY+     D  L++W  +   + R 
Sbjct: 189 ENGVVPISQVKFSRNGKYLLVKSLDGILKIWDFVRGKVVRT 229

>Kwal_23.4118
          Length = 939

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 33/72 (45%), Gaps = 1/72 (1%)

Query: 271 HTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPNDDRFFI 329
           H+  I   D+S +G +I++TS+D TAR W       +         T  +F PN D    
Sbjct: 585 HSNRISSFDFSPDGRWIISTSLDGTARTWDLPTGCCIDGIRLDSVATNIRFSPNADFVAT 644

Query: 330 SGCLDHTLRLWS 341
           +    + + +W+
Sbjct: 645 THVNGNGILIWT 656

>ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH]
           complement(140589..143003) [2415 bp, 804 aa]
          Length = 804

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 50/114 (43%), Gaps = 15/114 (13%)

Query: 203 KVIASPLERNDLSSATAKPQAKRISMRVPPSP-----TVGRSVKEEPEQPIGPASMDLYA 257
           K++AS  + N+ S A  +  +    +++PP P     T+ R    +  + +   S D   
Sbjct: 584 KLLASACKSNNTSHAVVRIFSTHTWLQLPPCPEFHNLTITRLRFSKDNRHLLSVSRDRMW 643

Query: 258 PVFH-------PLPFRIYQEHTQDILDLDW---SKNGFILTTSMDKTARLWHCD 301
            V++        L +   + H++ I D DW   S     +T S DKT ++W  D
Sbjct: 644 AVWYRNDDDTFTLKYSDQKPHSRIIWDGDWLPASCGTAFVTASRDKTVKIWRLD 697

>Scas_692.25
          Length = 488

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 2/44 (4%)

Query: 282 KNGFILTTSMDKTARLWHCDRPKALKVFT--HPDFVTCAKFHPN 323
           +  ++ + S DKT R W+ +  + +K +T  H  FVTC    P+
Sbjct: 415 RGNYLFSCSDDKTIRCWNLENGECVKQWTDLHSGFVTCLDMDPD 458

>Scas_595.3*
          Length = 555

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 58/139 (41%), Gaps = 22/139 (15%)

Query: 278 LDWSKNGFILTTSMDKTARLWHCDRPKALKVFTH------PDFVTCAKFHPNDDRFFISG 331
           + WSK    +   +  ++ +W  +   A+ V  H       D +TC  F P D +F I G
Sbjct: 204 ISWSKTTNAVLVGLGCSSYMWS-EALGAIPVLDHHYLFSKGDLITCVSFSPRDTKFVI-G 261

Query: 332 CLDHTLRLWS---ILDNSVSF--DYYCGDIITAIDTSPR---------DGKYTAAGTFNG 377
             D  + L+    I+DN   +  + +   I T  +T+ +         DG+    G   G
Sbjct: 262 TKDGRILLFDQDLIIDNYEKYEDEVFLEPIFTYKNTASKGLGCIEWLSDGESLIVGDETG 321

Query: 378 HIIILYTRGLEMVSTFHVL 396
            I I+  R     +++H++
Sbjct: 322 FINIINIRSTLDPNSYHLM 340

>Sklu_1710.1 YDR267C, Contig c1710 17-739
          Length = 240

 Score = 31.6 bits (70), Expect = 2.1,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 5/85 (5%)

Query: 267 IYQEHTQDILDLDW-SKNGFILTTSMDKTARLWH---CDRPKALKVFTHPDFVTCAKFHP 322
           + QEH+QD+  + W S    + ++S D T R+W     D   A  +  H   V C+ F  
Sbjct: 60  VLQEHSQDVKHVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEK 119

Query: 323 NDDRF-FISGCLDHTLRLWSILDNS 346
           ++      SG  D T+R+W  ++++
Sbjct: 120 SESSLRLCSGSDDTTVRIWKYIEDN 144

>CAGL0M09845g 975007..977817 highly similar to sp|Q06078
           Saccharomyces cerevisiae YLR409c, start by similarity
          Length = 936

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 31/72 (43%), Gaps = 1/72 (1%)

Query: 271 HTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPNDDRFFI 329
           H   I   D+S +G ++++ S+D T R W       +         T  KF PN D    
Sbjct: 582 HGNRITAFDFSPDGRWLVSASLDSTIRTWDLPTGSCIDGVKIESVATNLKFSPNGDMLAT 641

Query: 330 SGCLDHTLRLWS 341
           +  + + + +W+
Sbjct: 642 THVIGNGIFIWT 653

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 2/78 (2%)

Query: 307 KVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTSPRD 366
           +++ H + +T   F P D R+ +S  LD T+R W +   S         + T +  SP +
Sbjct: 578 QLWGHGNRITAFDFSP-DGRWLVSASLDSTIRTWDLPTGSCIDGVKIESVATNLKFSP-N 635

Query: 367 GKYTAAGTFNGHIIILYT 384
           G   A     G+ I ++T
Sbjct: 636 GDMLATTHVIGNGIFIWT 653

>ADL218C [1523] [Homologous to ScYNL035C - SH] (319676..320887)
           [1212 bp, 403 aa]
          Length = 403

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 21/41 (51%)

Query: 302 RPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI 342
           RP    V +H D VT  KFHP D    +SG  D  + ++ +
Sbjct: 137 RPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDL 177

>KLLA0B11077g complement(970761..972464) similar to sgd|S0006341
           Saccharomyces cerevisiae YPR137w RRP9 protein associated
           with the U3 small nucleolar RNA, required for
           pre-ribosomal RNA processing, start by similarity
          Length = 567

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 46/110 (41%), Gaps = 16/110 (14%)

Query: 355 DIITAIDTSPRDGKYTAAGTFNGHIIILYTRGLEMVSTFHVLEKPNGTTKKVPESGPKIT 414
           D I  +  SP DGKY  +G  +  +I+  T  L  V      ++             ++ 
Sbjct: 233 DEILTVAASP-DGKYVVSGGRDRKLIVWSTESLAPVKIIPTKDRRG-----------EVL 280

Query: 415 GIEFFKSAPDNDLRIMVTSNDSRIRIFRIKGQSLLEVLKGFENTHSQISA 464
           G+ F K    N  ++     D +IR + I   S LE+L G ++    ISA
Sbjct: 281 GLAFKK----NSDQLFAACADYKIRTYAINQFSQLEILYGHQDLVIDISA 326

>Kwal_33.15591
          Length = 714

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 47/104 (45%), Gaps = 7/104 (6%)

Query: 271 HTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALK--VFTHPDFVTCAKFHPNDDRFF 328
           H  ++  L+ S  G++L+ S D TA++W      ALK  +  H   V   K  P +  F+
Sbjct: 104 HENNVCVLN-SSQGYVLSGSWDTTAKVWF---QGALKHELKGHTASVWDVKMLP-EVGFY 158

Query: 329 ISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTSPRDGKYTAA 372
           ++   D T++LW       +F     D+I  ID      K+ + 
Sbjct: 159 MTASADGTIKLWEGEKVLKTFTGLHTDVIRHIDIDASGEKFASC 202

>KLLA0E05181g 460483..464460 highly similar to sp|Q06706
           Saccharomyces cerevisiae YLR384c IKI3 confers
           sensitivity to killer toxin singleton, start by
           similarity
          Length = 1325

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 7/61 (11%)

Query: 275 ILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFTHPDF----VTCAKFHPNDDRFFIS 330
           +LDL W+ N  ILT  +    +LW     K    F   +F    +T AK+HP  D   + 
Sbjct: 334 VLDLCWNANSEILTIVLIDRVQLWTT---KNYHWFLKQEFYFNNITYAKWHPEKDFTLMV 390

Query: 331 G 331
           G
Sbjct: 391 G 391

>KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46, start by
           similarity
          Length = 434

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 12/45 (26%), Positives = 22/45 (48%)

Query: 298 WHCDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI 342
           WH     +  +  H  +V C    P D+ +F +G  D T+++W +
Sbjct: 108 WHAPWKLSKVINGHTGWVRCVCVDPVDNEWFATGSNDTTIKIWDL 152

>Sklu_2317.3 YDR142C, Contig c2317 5804-6910
          Length = 368

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 32/65 (49%), Gaps = 4/65 (6%)

Query: 249 GPASMDLYAPVFHPLPFRIYQEHTQDILDLDW---SKNGFILTTSMDKTARLWHCDRPKA 305
           G  S+ L+       P  I+QEH +++   +W   +K  F+ ++S D T ++W   R ++
Sbjct: 81  GDGSLRLFDINLPQYPISIFQEHQKEVFSCNWNLVNKQTFV-SSSWDGTVKIWSPMRQES 139

Query: 306 LKVFT 310
           L    
Sbjct: 140 LTTLV 144

>KLLA0F06754g complement(650475..651509) similar to sp|P53011
           Saccharomyces cerevisiae YGL100w SEH1 nuclear pore
           protein, start by similarity
          Length = 344

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 51/124 (41%), Gaps = 19/124 (15%)

Query: 178 VWATKFSRDGKYMATGGKDCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVG 237
            WA    R  + +ATG KD  LR++KV  S   RN+ ++   +      ++         
Sbjct: 219 AWAPSVGRWYQLIATGCKDGKLRIFKVTES---RNNGTNIINEENDNNANI--------- 266

Query: 238 RSVKEEPEQPIGPASMDLYAPV--FHPLPFRIYQEHTQDILDLDWSKNGFIL-TTSMDKT 294
               E    PI  +++D    V   H      + +H  ++  + W+  G IL +T  D  
Sbjct: 267 ----ERDGPPIDSSAIDADGSVANLHVELISEHSDHQGEVWSVSWNLTGTILSSTGDDGK 322

Query: 295 ARLW 298
            RLW
Sbjct: 323 IRLW 326

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 50/114 (43%), Gaps = 20/114 (17%)

Query: 268 YQEHTQDILDLDWSKNGF---ILTTSMDKTARLWHCDRPKALKV-------------FTH 311
           ++ H   I+ LDW+   F   I + S DKT +LW  D P AL++              T 
Sbjct: 51  WKAHDSSIVSLDWAAPEFGRIIASVSYDKTIKLWEED-PDALELSGKRWQKLCTLNDATG 109

Query: 312 PDFVTCAKFHPNDDRFFISGCL-DHTLRLWSILDNSVSFDYYCGDIITAIDTSP 364
           P F    KF P+     ++    D  LRL+  L++S    +     IT ++T P
Sbjct: 110 PLF--SVKFAPSHLGLRLAALGNDGKLRLYDALESSDLRSWTLTSEITVLNTPP 161

>YAR003W (SWD1) [68] chr1 (155009..156289) Component of SET1 and
           COMPASS complex, contains a WD (WD-40) repeat [1281 bp,
           426 aa]
          Length = 426

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 253 MDLYAPVFHPLPFRIYQEHTQDILDLDWSKNG-FILTTSMDKTARLWHCDRP-KALK 307
           MD + P+   +P  +   H + I  + WS +G  +LT+S D + +LW   +P K LK
Sbjct: 55  MDTFRPIC--VPGNMLGAHVRPITSIAWSPDGRLLLTSSRDWSIKLWDLSKPSKPLK 109

>Scas_627.9
          Length = 500

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 44/203 (21%), Positives = 79/203 (38%), Gaps = 39/203 (19%)

Query: 196 DCTLRVWKVIASPLE---RNDLSSATAKPQAKRISMRVPPSPTVGRSVKEEPEQPIGPAS 252
           D T+++WKV    ++    N+L + T        S +  PS ++         Q +    
Sbjct: 108 DKTIKLWKVYEKNIKLVSENNLDTTTT-------STKNLPSLSL---------QNLKLPQ 151

Query: 253 MDLYAPVFHPLPFRIYQE-HTQDILDLDWSKNGFILTTSMDKTARLWHCDRP-------- 303
           +  +  +    P RIY   HT  I  +  + +     ++ D    LW+ D P        
Sbjct: 152 LSQHDKIIAAAPKRIYSNAHTYHINSISTNSDQETFISADDLRINLWNLDIPDQSFNIVD 211

Query: 304 -KALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSV------SFDYYCGDI 356
            K   +    + +T A FHP D   F+      T++L  +  N++      +F+ Y   I
Sbjct: 212 IKPTNMEELTEVITSAVFHPQDCNLFMYSSSKGTIKLCDMRQNALCDYKTKTFEEYMDPI 271

Query: 357 ----ITAIDTSPRDGKYTAAGTF 375
                T I +S  D K++  G +
Sbjct: 272 SHNFFTEITSSISDVKFSPNGRY 294

>KLLA0D07546g complement(647984..649927) some similarities with
           sp|P07834 Saccharomyces cerevisiae YFL009w CDC4 cell
           division control protein, hypothetical start
          Length = 647

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 177 AVWATKFSRDGKYMATGGKDCTLRVWKV 204
            VWA KF  DGK + +G  D ++R+W +
Sbjct: 302 GVWALKFV-DGKILVSGSTDRSVRIWNI 328

>AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH]
           (424004..425659) [1656 bp, 551 aa]
          Length = 551

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 29/75 (38%), Gaps = 3/75 (4%)

Query: 275 ILDLDWSKNGFILTTSMDKTA---RLWHCDRPKALKVFTHPDFVTCAKFHPNDDRFFISG 331
           + ++ WSKN   + TS   +     LW C   + L V     F         D    +SG
Sbjct: 459 VCNMVWSKNTDEIVTSHGYSKFNLTLWDCPTLEPLAVLKGHSFRVLHLTLSTDGTTIVSG 518

Query: 332 CLDHTLRLWSILDNS 346
             D TLR W +   S
Sbjct: 519 AGDETLRYWKLFGKS 533

>Kwal_27.11550
          Length = 407

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 296 RLWHCDRPKALKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI 342
           + WH  +P    V +H D +T  KFHP D    +SG  D  + ++ +
Sbjct: 133 KAWH--QPLRSLVDSHHDDITNIKFHPTDPNVLLSGSTDGYVNIYDL 177

>YDR030C (RAD28) [881] chr4 complement(501749..503269) Protein
           involved in the same pathway as Rad26p, has WD (WD-40)
           repeats [1521 bp, 506 aa]
          Length = 506

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 2/39 (5%)

Query: 271 HTQDILDLDWSK--NGFILTTSMDKTARLWHCDRPKALK 307
           H   I  L W K  NG   T S DKT ++W  +R +A++
Sbjct: 194 HKYGITTLKWYKADNGMFFTGSNDKTVKIWDTNRFEAVQ 232

>KLLA0F08811g complement(819834..821744) some similarities with
           sp|P38915 Saccharomyces cerevisiae YLR055c SPT8
           transcriptional adaptor or co-activator singleton,
           hypothetical start
          Length = 636

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 53/129 (41%), Gaps = 29/129 (22%)

Query: 324 DDRFFISGCLDHTLRLWS---------ILDNSVSFDYYCGDIITAIDTSPRDGKYTAAGT 374
           D+  F++ C+D  +++W           L  +VS   +C     ++     DG    AG 
Sbjct: 473 DENLFLTSCIDGNIQIWDRRQPSSEIIKLGRNVSTPPWCMSACWSV-----DGGKVIAGR 527

Query: 375 FNGHIIILYTRGLEMVSTFHVLEKPNGTTKKVPESGPKITGIEFFKSAPDNDLRIMVTSN 434
            N  + I   R  E+V +   L   +G   KV             K+ P+N   ++  SN
Sbjct: 528 RNAVVEIYDLRKPEVVESKLKLPSISGPVSKV-------------KAMPNNS-HVVAASN 573

Query: 435 DSRIRIFRI 443
           D+ IRIF I
Sbjct: 574 DN-IRIFDI 581

>CAGL0M08624g complement(859796..860809) highly similar to sp|P04803
           Saccharomyces cerevisiae YDR268w MSW1 tryptophanyl-tRNA
           synthetase, mitochondrial, start by similarity
          Length = 337

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 77  VQDFSEKPRNAKQGKKEREQAHSRLNDHIDLTLNNVFGRINREQFHQYLKEPKYL 131
           V   +++P +A + + ++   +  L  H+   +     R+ RE+FHQY+++P++L
Sbjct: 255 VSGITKQPVHAVEQELQKFDNYRDLKAHVSEVIIEEL-RVPREKFHQYMEDPQFL 308

>CAGL0L06952g complement(780793..781836) highly similar to sp|P40217
           Saccharomyces cerevisiae YMR146c TIF34 translation
           initiation factor eIF3, start by similarity
          Length = 347

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/103 (18%), Positives = 48/103 (46%), Gaps = 2/103 (1%)

Query: 271 HTQDILDLDWSKNG-FILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPNDDRFFI 329
           H + +  + +++ G  + T S D +A +W+ +  + L           +    +   + +
Sbjct: 9   HERPLTQVKYNREGDLLFTCSKDISASVWYSNNGERLGTLDGHMGSIWSIDSDHTSLYCV 68

Query: 330 SGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTSPRDGKYTAA 372
           +G  D+T+++W++++      + C   +  ++ SP  GKY  A
Sbjct: 69  TGSADYTIKVWTLMNGQCVQTWNCPVPVKRVEFSPC-GKYILA 110

>Scas_712.34
          Length = 399

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (66%)

Query: 178 VWATKFSRDGKYMATGGKDCTLRVWKV 204
           V+A  F+  G+++AT G D  +RVW V
Sbjct: 296 VFALSFNSTGEFLATSGYDSKVRVWDV 322

>YBR097W (VPS15) [288] chr2 (436908..441272) Serine/threonine protein
            kinase involved in vacuolar protein sorting [4365 bp,
            1454 aa]
          Length = 1454

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 65/164 (39%), Gaps = 12/164 (7%)

Query: 312  PDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSV------SFDYYCGDIITAIDTSPR 365
            P+ +T +   P +  + I+G     +++W++ +  V      S  Y C   +T I   P 
Sbjct: 1080 PNSITSSAVSPGETPYLITGSDQGVIKIWNLKEIIVGEVYSSSLTYDCSSTVTQITMIPN 1139

Query: 366  DGKYTAAGTFNGHIIILYTRGLEMVSTFHVLEKPNGTTKKVPESGPKITGIEFFKSAPDN 425
               + A  + +G II+L     +  S    L         +   G     +       + 
Sbjct: 1140 FDAF-AVSSKDGQIIVLKVNHYQQESEVKFLNCECIRKINLKNFGKNEYAVRMRAFVNEE 1198

Query: 426  DLRIMVTSNDSRIRIFRIKGQSLLEVLKGFENT--HSQISAHLI 467
               ++  +N SR+ IF I+    LE L+  EN+  H  +S+  I
Sbjct: 1199 KSLLVALTNLSRVIIFDIRT---LERLQIIENSPRHGAVSSICI 1239

>AGR180W [4491] [Homologous to ScYLR222C - SH]
           complement(1090647..1093067) [2421 bp, 806 aa]
          Length = 806

 Score = 30.4 bits (67), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 35/82 (42%), Gaps = 15/82 (18%)

Query: 274 DILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKF----HPND----- 324
           ++++ +W +  F+LT S D T + W    P   K    P  V  +++    H  D     
Sbjct: 438 NVMNRNWPE--FLLTASNDLTIKRWKVPNPNDRKAIELPHIVKASEYTRRAHEKDINAIS 495

Query: 325 ----DRFFISGCLDHTLRLWSI 342
               D  F +   D T ++W++
Sbjct: 496 MSPNDSIFATASYDKTCKIWNV 517

>Sklu_2423.1 YLR409C, Contig c2423 869-3703
          Length = 944

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 2/78 (2%)

Query: 307 KVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTSPRD 366
           +++ H + VT   F P D R+ +S  LD T+R W +             + T +  SP +
Sbjct: 586 QLWGHSNRVTAFDFSP-DGRWIVSASLDSTIRTWDLPTGGCIDGVRLDSVATNLKFSP-N 643

Query: 367 GKYTAAGTFNGHIIILYT 384
           G   A     G+ I ++T
Sbjct: 644 GDLLATTHVTGNGISIWT 661

>Scas_693.36
          Length = 375

 Score = 30.0 bits (66), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 14/60 (23%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 249 GPASMDLYAPVFHPLPFRIYQEHTQDILDLDWS--KNGFILTTSMDKTARLWHCDRPKAL 306
           G  S+ L+       P  I+ EH ++++  +W+        ++S D T ++W   R ++L
Sbjct: 81  GDGSLRLFDIDLAKYPIAIFNEHKKEVMSCNWNLINKTMFTSSSWDGTVKIWSPTRKESL 140

>Kwal_26.8628
          Length = 422

 Score = 29.6 bits (65), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 58/140 (41%), Gaps = 26/140 (18%)

Query: 311 HPDFVTCAKFHPNDDRFFISGCLDHTLRLWSI--LDNSVSFDYYCGDIITAIDTSPRDGK 368
           H  +V+  +F  N+     SG  D T  LW I        F  + GD++ A+   P   +
Sbjct: 174 HTCYVSQVEFFENNSIITASG--DMTCALWDIPKAKRIAEFSDHLGDVL-ALALPPPHAQ 230

Query: 369 YT----AAGTFNGHIIILYTRGLEMVSTFHVLEKPNGTTKKVPESGPKITGIEFFKSAPD 424
            +    A+G  +G++ I  TR      +F V E               I+ ++FF    +
Sbjct: 231 TSSPIFASGGSDGYVYIWDTRARAAAQSFFVSES-------------DISTLKFF----N 273

Query: 425 NDLRIMVTSNDSRIRIFRIK 444
           N   I+  ++D   R+F ++
Sbjct: 274 NGYAIVTGADDGVARMFDMR 293

>KLLA0F09053g 842591..843949 similar to sp|Q00362 Saccharomyces
           cerevisiae YGL190c CDC55 ser/thr phosphatase 2A
           regulatory subunit B singleton, start by similarity
          Length = 452

 Score = 29.6 bits (65), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 42/200 (21%), Positives = 76/200 (38%), Gaps = 25/200 (12%)

Query: 196 DCTLRVWKVIASPLERNDLSSATAKPQAKRISMRVPPSPTVGRSVKEEPEQPIGPASMDL 255
           D T+++WK+    ++   L S     +  +   R        R+V     Q +    + L
Sbjct: 107 DKTIKLWKIYEKNIK---LVSDNNLSEGNKDYHRRSAGNGSARAVL--SLQTLKLPKLSL 161

Query: 256 YAPVFHPLPFRIYQE-HTQDILDLDWSKNGFILTTSMDKTARLWHCDRP---------KA 305
           +  +    P +IY   HT  I  +  + +     +S D    LW+ D P         K 
Sbjct: 162 HDRIIAAAPKKIYSNAHTYHINSISLNSDQETFISSDDLRINLWNLDIPDESFNIVDIKP 221

Query: 306 LKVFTHPDFVTCAKFHPNDDRFFISGCLDHTLRLWSILDNSVS------FDYYCGDI--- 356
             +    + +T A+FHP     F+      T++L  +  N++       F+ Y   I   
Sbjct: 222 ANMEELTEVITSAEFHPQQCNAFMYSSSKGTIKLCDMRQNALCDYRAKVFEEYLDPISHN 281

Query: 357 -ITAIDTSPRDGKYTAAGTF 375
             T I +S  D K++  G +
Sbjct: 282 FFTEITSSISDVKFSPDGRY 301

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,834,110
Number of extensions: 916752
Number of successful extensions: 4620
Number of sequences better than 10.0: 235
Number of HSP's gapped: 4433
Number of HSP's successfully gapped: 375
Length of query: 732
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 623
Effective length of database: 12,822,747
Effective search space: 7988571381
Effective search space used: 7988571381
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)