Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.765332532116290.0
Sklu_2430.1032430013470.0
Scas_721.12932330013210.0
YKL120W (OAC1)32430012970.0
CAGL0K11616g32030012861e-180
KLLA0B12826g31930012651e-177
ABL023W3093066919e-90
CAGL0G01166g2952972852e-29
Sklu_2432.52882852651e-26
YLR348C (DIC1)2982852651e-26
ADL049W9122822601e-24
Kwal_47.173218812832582e-24
Sklu_2359.69022832563e-24
YIL134W (FLX1)3113002362e-22
KLLA0E13453g9062922405e-22
Scas_602.88852862405e-22
YPR021C (AGC1)9022842371e-21
CAGL0K02365g9192832325e-21
Kwal_26.86692962002239e-21
Scas_640.253062972212e-20
KLLA0D07073g2972772203e-20
YPL134C (ODC1)3103032203e-20
Kwal_55.208683803012223e-20
CAGL0L02079g2972962194e-20
Scas_702.103022872194e-20
AGL311C3622152198e-20
Sklu_2363.23233052171e-19
Scas_489.42972912151e-19
ADL009W3792902172e-19
Sklu_1149.22963002142e-19
ACR109W2991992133e-19
YPR011C3263072133e-19
YOR222W (ODC2)3071982133e-19
Scas_589.103162042124e-19
YBR291C (CTP1)2992912115e-19
KLLA0E18810g3772942127e-19
Kwal_26.79672972972098e-19
YMR056C (AAC1)3092802072e-18
Sklu_2431.53703242073e-18
KLLA0D15015g3173102054e-18
Sklu_2334.23192062045e-18
YJR095W (SFC1)3222032021e-17
Scas_721.273743282031e-17
CAGL0F04213g3062822001e-17
CAGL0M09020g3482042022e-17
YEL006W3353002012e-17
YBL030C (PET9)3182822002e-17
AEL253W3651932003e-17
Sklu_2037.23103121957e-17
Scas_709.93652931978e-17
YIL006W3732891961e-16
AER184W3052781941e-16
Scas_718.243372821951e-16
CAGL0J01661g3273111932e-16
CAGL0J02002g3612961933e-16
Kwal_23.39653073081903e-16
Scas_667.43082801904e-16
YBR085W (AAC3)3072821896e-16
Kwal_27.124813042821879e-16
KLLA0D09889g3642011881e-15
AAR036W3173091871e-15
Kwal_47.182163332261843e-15
Kwal_23.47313143051833e-15
Kwal_14.22103152991833e-15
Kwal_27.120813693271843e-15
KLLA0E02772g2842751824e-15
CAGL0M05225g3813341773e-14
CAGL0F07711g3682471764e-14
Scas_716.293163111745e-14
Scas_691.43342141721e-13
CAGL0G03135g3073121711e-13
KLLA0E09680g3072881683e-13
Scas_669.63732051684e-13
KLLA0F04697g3073081675e-13
KLLA0E12353g3052781665e-13
KLLA0E23705g3683261676e-13
YGR257C (MTM1)3662781651e-12
CAGL0F08305g3742731642e-12
Kwal_55.213353172741632e-12
Kwal_33.154463053031612e-12
CAGL0J04114g3032821603e-12
Scas_379.23011971594e-12
CAGL0K08250g2971971595e-12
YMR166C3682031605e-12
AGL047C3162901587e-12
KLLA0D14036g4312121597e-12
Sklu_2127.52782751568e-12
YJL133W (MRS3)3141991579e-12
YGR096W (TPC1)3143061561e-11
KLLA0F03212g3052141551e-11
CAGL0G08910g2892901542e-11
YBR192W (RIM2)3773301552e-11
KLLA0F17864g3071891515e-11
Scas_632.92922761515e-11
Scas_662.123083041515e-11
Sklu_2075.33452841516e-11
CAGL0B03883g3062961507e-11
YKR052C (MRS4)3041971499e-11
AFL196W3612021509e-11
CAGL0H03839g2821951481e-10
YOR130C (ORT1)2921901481e-10
KLLA0A09383g3662821482e-10
Sklu_2194.33121911453e-10
YPR058W (YMC1)3073101453e-10
CAGL0L05742g3051991444e-10
Scas_667.223063011436e-10
Kwal_23.35293952051438e-10
Scas_558.22892011418e-10
YBR104W (YMC2)3292971411e-09
Kwal_33.140503143001401e-09
Sklu_2260.53021731382e-09
Scas_582.73292011383e-09
KLLA0B08503g3031861383e-09
KLLA0F08547g3081351373e-09
Kwal_23.57573071741364e-09
Kwal_27.125993043031365e-09
KLLA0D04290g1881861325e-09
Scas_645.93912801341e-08
KLLA0E15532g3261951331e-08
ACR260W3112021321e-08
Kwal_27.114192983061312e-08
Kwal_23.43543432651312e-08
AFR131C3442031294e-08
Sklu_2398.43091781284e-08
Kwal_27.116262992881276e-08
AFR253W3442991278e-08
AGR383W2931991251e-07
Kwal_34.159073121831251e-07
CAGL0D01606g3053071251e-07
Scas_697.473283091251e-07
Sklu_1275.13111841241e-07
YNL083W5452091261e-07
KLLA0E08877g2941971241e-07
Sklu_2374.75133281252e-07
AFR147C3152841232e-07
Sklu_2117.22982971232e-07
CAGL0J09790g3002881232e-07
Scas_718.53241881223e-07
CAGL0K12210g3113081223e-07
YMR241W (YHM2)3141871223e-07
KLLA0A00979g3433231223e-07
AFR542W3101371213e-07
Kwal_23.30425423271224e-07
Scas_687.15*3281371214e-07
YDL198C (YHM1)3002861204e-07
Scas_715.453051951205e-07
Kwal_47.192282811191195e-07
AER366W2931951195e-07
CAGL0K07436g3071381196e-07
CAGL0K10362g3012841196e-07
Sklu_2127.43231521196e-07
CAGL0H10538g2972321196e-07
CAGL0B04543g3172521197e-07
CAGL0J05522g5193241207e-07
KLLA0C11363g5173211191e-06
KLLA0F13464g3002941171e-06
YNL003C (PET8)2841971171e-06
AFR146W2812111161e-06
KLLA0D04950g2742001161e-06
Scas_714.183053071161e-06
Scas_562.123002871162e-06
Scas_328.12271551132e-06
Scas_578.3*5243051162e-06
KLLA0B11319g3551681143e-06
Kwal_55.211063283061134e-06
Sklu_2433.8420891134e-06
Sklu_1926.23051811124e-06
Kwal_33.129883031841124e-06
AGR191W2982951125e-06
Sklu_1119.13072531115e-06
Sklu_2115.42993151116e-06
KLLA0C13431g3283061117e-06
Kwal_56.230113031881107e-06
Scas_705.93233021091e-05
AAL014C2711841091e-05
YPR128C (ANT1)3282961091e-05
Sklu_2435.23443121091e-05
KLLA0B14454g3052571081e-05
AGL064W2962761072e-05
YFR045W2851161072e-05
Kwal_55.213383231631072e-05
YER053C3001711063e-05
CAGL0D04774g3223051063e-05
Kwal_0.2322741961044e-05
Scas_673.173142351045e-05
Sklu_2442.82751991027e-05
AER419W4931851039e-05
Kwal_33.155973052531011e-04
Scas_613.24177179972e-04
CAGL0F00231g3072311002e-04
CAGL0C02013g3291271002e-04
AGL065C335130983e-04
CAGL0K02915g34273973e-04
YHR002W (LEU5)35773973e-04
KLLA0E02750g304204965e-04
Scas_671.1*12377916e-04
KLLA0E18788g38169958e-04
Scas_717.20356134949e-04
Scas_696.9312154920.001
Kwal_26.797235869910.002
YDL119C30778910.002
Kwal_23.2913320309910.002
YJR077C (MIR1)311237900.003
YOR100C (CRC1)327302890.003
ADL264C329281850.013
KLLA0D04312g103105780.020
Scas_198.17232760.021
AER450C308259810.034
CAGL0K06545g51295770.11
Sklu_2436.1849495720.47
ADR036C340309710.58
YDR470C (UGO1)502100710.64
AFR373W46793681.5
CAGL0B02860g21629635.3
Kwal_47.1930326552626.1
YDL135C (RDI1)202144626.2
YIR002C (MPH1)99335637.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.7653
         (321 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.7653                                                          632   0.0  
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                        523   0.0  
Scas_721.129                                                          513   0.0  
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...   504   0.0  
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...   499   e-180
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...   491   e-177
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...   270   9e-90
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...   114   2e-29
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement      106   1e-26
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...   106   1e-26
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....   104   1e-24
Kwal_47.17321                                                         103   2e-24
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                         103   3e-24
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    96   2e-22
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...    97   5e-22
Scas_602.8                                                             97   5e-22
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...    96   1e-21
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...    94   5e-21
Kwal_26.8669                                                           91   9e-21
Scas_640.25                                                            90   2e-20
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    89   3e-20
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    89   3e-20
Kwal_55.20868                                                          90   3e-20
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    89   4e-20
Scas_702.10                                                            89   4e-20
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...    89   8e-20
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          88   1e-19
Scas_489.4                                                             87   1e-19
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    88   2e-19
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         87   2e-19
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...    87   3e-19
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    87   3e-19
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...    87   3e-19
Scas_589.10                                                            86   4e-19
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    86   5e-19
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    86   7e-19
Kwal_26.7967                                                           85   8e-19
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    84   2e-18
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            84   3e-18
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    84   4e-18
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement         83   5e-18
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...    82   1e-17
Scas_721.27                                                            83   1e-17
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    82   1e-17
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    82   2e-17
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    82   2e-17
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    82   2e-17
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    82   3e-17
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         80   7e-17
Scas_709.9                                                             80   8e-17
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    80   1e-16
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    79   1e-16
Scas_718.24                                                            80   1e-16
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    79   2e-16
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    79   3e-16
Kwal_23.3965                                                           78   3e-16
Scas_667.4                                                             78   4e-16
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    77   6e-16
Kwal_27.12481                                                          77   9e-16
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    77   1e-15
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    77   1e-15
Kwal_47.18216                                                          75   3e-15
Kwal_23.4731                                                           75   3e-15
Kwal_14.2210                                                           75   3e-15
Kwal_27.12081                                                          75   3e-15
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    75   4e-15
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    73   3e-14
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    72   4e-14
Scas_716.29                                                            72   5e-14
Scas_691.4                                                             71   1e-13
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    70   1e-13
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...    69   3e-13
Scas_669.6                                                             69   4e-13
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    69   5e-13
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    69   5e-13
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    69   6e-13
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    68   1e-12
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    68   2e-12
Kwal_55.21335                                                          67   2e-12
Kwal_33.15446                                                          67   2e-12
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    66   3e-12
Scas_379.2                                                             66   4e-12
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    66   5e-12
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    66   5e-12
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    65   7e-12
KLLA0D14036g complement(1203522..1204817) some similarities with...    66   7e-12
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement         65   8e-12
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    65   9e-12
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    65   1e-11
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    64   1e-11
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    64   2e-11
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    64   2e-11
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...    63   5e-11
Scas_632.9                                                             63   5e-11
Scas_662.12                                                            63   5e-11
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement                63   6e-11
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...    62   7e-11
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    62   9e-11
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    62   9e-11
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    62   1e-10
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    62   1e-10
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    62   2e-10
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            60   3e-10
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...    60   3e-10
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    60   4e-10
Scas_667.22                                                            60   6e-10
Kwal_23.3529                                                           60   8e-10
Scas_558.2                                                             59   8e-10
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...    59   1e-09
Kwal_33.14050                                                          59   1e-09
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         58   2e-09
Scas_582.7                                                             58   3e-09
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...    58   3e-09
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    57   3e-09
Kwal_23.5757                                                           57   4e-09
Kwal_27.12599                                                          57   5e-09
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    55   5e-09
Scas_645.9                                                             56   1e-08
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    56   1e-08
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    55   1e-08
Kwal_27.11419                                                          55   2e-08
Kwal_23.4354                                                           55   2e-08
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    54   4e-08
Sklu_2398.4 , Contig c2398 9476-10405                                  54   4e-08
Kwal_27.11626                                                          54   6e-08
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    54   8e-08
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    53   1e-07
Kwal_34.15907                                                          53   1e-07
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...    53   1e-07
Scas_697.47                                                            53   1e-07
Sklu_1275.1 , Contig c1275 314-1249                                    52   1e-07
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    53   1e-07
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    52   1e-07
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       53   2e-07
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    52   2e-07
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            52   2e-07
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    52   2e-07
Scas_718.5                                                             52   3e-07
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...    52   3e-07
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    52   3e-07
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    52   3e-07
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    51   3e-07
Kwal_23.3042                                                           52   4e-07
Scas_687.15*                                                           51   4e-07
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    51   4e-07
Scas_715.45                                                            51   5e-07
Kwal_47.19228                                                          50   5e-07
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    50   5e-07
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    50   6e-07
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    50   6e-07
Sklu_2127.4 , Contig c2127 6322-7293                                   50   6e-07
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    50   6e-07
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    50   7e-07
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    51   7e-07
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    50   1e-06
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    50   1e-06
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    50   1e-06
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    49   1e-06
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    49   1e-06
Scas_714.18                                                            49   1e-06
Scas_562.12                                                            49   2e-06
Scas_328.1                                                             48   2e-06
Scas_578.3*                                                            49   2e-06
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    49   3e-06
Kwal_55.21106                                                          48   4e-06
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       48   4e-06
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement          48   4e-06
Kwal_33.12988                                                          48   4e-06
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    48   5e-06
Sklu_1119.1 YJR077C, Contig c1119 366-1289                             47   5e-06
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            47   6e-06
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    47   7e-06
Kwal_56.23011                                                          47   7e-06
Scas_705.9                                                             47   1e-05
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    47   1e-05
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    47   1e-05
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         47   1e-05
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...    46   1e-05
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    46   2e-05
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    46   2e-05
Kwal_55.21338                                                          46   2e-05
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    45   3e-05
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    45   3e-05
Kwal_0.232                                                             45   4e-05
Scas_673.17                                                            45   5e-05
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          44   7e-05
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    44   9e-05
Kwal_33.15597                                                          44   1e-04
Scas_613.24                                                            42   2e-04
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    43   2e-04
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    43   2e-04
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    42   3e-04
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    42   3e-04
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    42   3e-04
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    42   5e-04
Scas_671.1*                                                            40   6e-04
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    41   8e-04
Scas_717.20                                                            41   9e-04
Scas_696.9                                                             40   0.001
Kwal_26.7972                                                           40   0.002
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    40   0.002
Kwal_23.2913                                                           40   0.002
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    39   0.003
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    39   0.003
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    37   0.013
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    35   0.020
Scas_198.1                                                             34   0.021
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    36   0.034
CAGL0K06545g complement(641129..642667) similar to tr|Q03327 Sac...    34   0.11 
Sklu_2436.18 YDR470C, Contig c2436 37947-39431 reverse complement      32   0.47 
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    32   0.58 
YDR470C (UGO1) [1287] chr4 complement(1399694..1401202) Protein ...    32   0.64 
AFR373W [3565] [Homologous to ScYDR470C (UGO1) - SH] complement(...    31   1.5  
CAGL0B02860g complement(278007..278657) some similarities with t...    29   5.3  
Kwal_47.19303                                                          28   6.1  
YDL135C (RDI1) [733] chr4 complement(218680..219288) Rho GDP dis...    28   6.2  
YIR002C (MPH1) [2667] chr9 complement(357412..360393) Protein wi...    29   7.3  

>Kwal_26.7653
          Length = 325

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/321 (95%), Positives = 307/321 (95%)

Query: 1   MSKEIDTXXXXXXXXXXXXXXVSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSA 60
           MSKEIDT              VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSA
Sbjct: 1   MSKEIDTKALAAEADKPAAQKVSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSA 60

Query: 61  DAQRIYKNPMQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYP 120
           DAQRIYKNPMQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYP
Sbjct: 61  DAQRIYKNPMQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYP 120

Query: 121 AMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGL 180
           AMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGL
Sbjct: 121 AMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGL 180

Query: 181 SSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTV 240
           SSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTV
Sbjct: 181 SSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTV 240

Query: 241 SGFGVGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPH 300
           SGFGVGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPH
Sbjct: 241 SGFGVGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPH 300

Query: 301 TILCLTFMEQTMKVVYAVEKQ 321
           TILCLTFMEQTMKVVYAVEKQ
Sbjct: 301 TILCLTFMEQTMKVVYAVEKQ 321

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score =  523 bits (1347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/300 (80%), Positives = 277/300 (92%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG 81
           VSK GSFIAGG+AACIAVTVTNP ELVKTRMQLQGEMSA  QRIY+NP QAL VIFKNEG
Sbjct: 21  VSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGVIFKNEG 80

Query: 82  IRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSG 141
           ++GLQ+GL  AY+YQIGLNGSRLGFYEPIR+VLNKTF+P  DPHK+QNVAVNV +GATSG
Sbjct: 81  VKGLQRGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQNVAVNVTAGATSG 140

Query: 142 IIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAIL 201
           IIGAI+GSPLFL+KTRMQSYSNAI+IG+QTHYTS+ NGL++I++ EG  GL+RGVDAAIL
Sbjct: 141 IIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRGVDAAIL 200

Query: 202 RTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYN 261
           RTGAGSSVQLPIYNT K+FLL++D+MKEGT LHL++STV+G GVG+VMNPWDV+LTRVYN
Sbjct: 201 RTGAGSSVQLPIYNTTKNFLLQNDIMKEGTALHLLSSTVTGLGVGIVMNPWDVVLTRVYN 260

Query: 262 QKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYAVEKQ 321
           QKGN YKGP+DC  KT++IEGIGALYKGF AQ+FRIAPHTILCLTFMEQTMK+VYAVE +
Sbjct: 261 QKGNTYKGPIDCMFKTIKIEGIGALYKGFGAQLFRIAPHTILCLTFMEQTMKLVYAVESR 320

>Scas_721.129
          Length = 323

 Score =  513 bits (1321), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 236/300 (78%), Positives = 273/300 (91%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG 81
           VSK GSFIAGGMAACIAVT TNPIELVK RMQLQGE++A  Q++Y+NP+Q + VIF+NEG
Sbjct: 19  VSKFGSFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRNEG 78

Query: 82  IRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSG 141
           IRGLQKGL  AYIYQIGLNGSRLGFYEPIR+ LN TFYP  + HK+Q V++NV +GA+SG
Sbjct: 79  IRGLQKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSINVAAGASSG 138

Query: 142 IIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAIL 201
           IIGA++GSPLFL+KTRMQSYS+AI+IG+QTHY ++WNGLS+I R EGFKGL+RG+DAAIL
Sbjct: 139 IIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRGIDAAIL 198

Query: 202 RTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYN 261
           RTGAGSSVQLPIYNTAK+FLLK+DLMK+G GLHL AST+SG GV VVMNPWDVILTR+YN
Sbjct: 199 RTGAGSSVQLPIYNTAKNFLLKNDLMKDGPGLHLTASTISGLGVAVVMNPWDVILTRIYN 258

Query: 262 QKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYAVEKQ 321
           QKGNLYKGP+DCFVKTVR EGI ALYKGF+AQI RIAPHTI+CLTFMEQTMK+VY+VE +
Sbjct: 259 QKGNLYKGPVDCFVKTVRTEGISALYKGFQAQILRIAPHTIICLTFMEQTMKLVYSVESK 318

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score =  504 bits (1297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 229/300 (76%), Positives = 270/300 (90%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG 81
           +SK GSF+AGG+AACIAVTVTNPIEL+K RMQLQGEMSA A ++YKNP+Q + VIFKNEG
Sbjct: 20  ISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEG 79

Query: 82  IRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSG 141
           I+GLQKGL+ AYIYQIGLNGSRLGFYEPIRS LN+ F+P  +PHKVQ+V VNV SGA SG
Sbjct: 80  IKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAASG 139

Query: 142 IIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAIL 201
           IIGA++GSPLFL+KTR+QSYS  I+IG+QTHYT +WNGL +I++ EG KGL+RG+DAAIL
Sbjct: 140 IIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAIL 199

Query: 202 RTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYN 261
           RTGAGSSVQLPIYNTAK+ L+K+DLMK+G  LHL AST+SG GV VVMNPWDVILTR+YN
Sbjct: 200 RTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYN 259

Query: 262 QKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYAVEKQ 321
           QKG+LYKGP+DC VKTVRIEG+ ALYKGF AQ+FRIAPHTI+CLTFMEQTMK+VY++E +
Sbjct: 260 QKGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYSIESR 319

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score =  499 bits (1286), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 230/300 (76%), Positives = 267/300 (89%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG 81
           VSK GSF AGG+AACIAVTVTNPIE+VK RMQLQGE+ A  QRIY NP QA+ V+F+NEG
Sbjct: 16  VSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEG 75

Query: 82  IRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSG 141
           IRGLQKGL  AYIYQI LNGSRLGFYEPIR+V+NKTFYP  + HKVQ+V +NV +GA SG
Sbjct: 76  IRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASG 135

Query: 142 IIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAIL 201
           IIGA+MGSPLFL+KTR+QSYSNAI+IG+QTHYT +WNGL +IY  EG KGL+RG+DAAIL
Sbjct: 136 IIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAIL 195

Query: 202 RTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYN 261
           RTGAGSSVQLPIYNTAK+FLL++D+M++G  LHL AST+SG GV VVMNPWDVILTR+YN
Sbjct: 196 RTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYN 255

Query: 262 QKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYAVEKQ 321
           QKG+LYKGP+DC VKTV+IEGI ALYKGFEAQ+FRI PHTILCLTF+EQTMK+V+A E +
Sbjct: 256 QKGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHAFESK 315

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score =  491 bits (1265), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 222/300 (74%), Positives = 266/300 (88%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG 81
           VSK GSF+AGG+AACIAVTVTNP + VKTRMQLQGE+ A+A ++Y NP+QA  VIFKNEG
Sbjct: 18  VSKFGSFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKNEG 77

Query: 82  IRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSG 141
           I GLQKGL+ AY+YQI LNGSRLGFYEPIR +LN  FYP ++ HKVQ++ +NV +GATSG
Sbjct: 78  IAGLQKGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHIGINVAAGATSG 137

Query: 142 IIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAIL 201
           ++GA +GSPLFL+KTRMQSYSNAI IGQQTHYTS +NGL++I+R+EG KGL+RGVDAA+L
Sbjct: 138 VVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRSEGIKGLFRGVDAAML 197

Query: 202 RTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYN 261
           RTG GS+VQLPIYN  K+FLLKHDLM +GTGLHL++ST++GFGVGV MNPWDV+LTRVYN
Sbjct: 198 RTGIGSAVQLPIYNICKNFLLKHDLMNDGTGLHLLSSTIAGFGVGVAMNPWDVVLTRVYN 257

Query: 262 QKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYAVEKQ 321
           QKGNLY GP+DCF+KTVR EG+ ALYKGF AQI RI PHT+LCLTFMEQT+K+VY+VE +
Sbjct: 258 QKGNLYSGPIDCFIKTVRNEGLSALYKGFGAQILRIGPHTVLCLTFMEQTLKLVYSVESR 317

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score =  270 bits (691), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 157/306 (51%), Positives = 211/306 (68%), Gaps = 17/306 (5%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG 81
           VSK GSF A G AAC+AVT TNPIE VKTR+QLQGE+ A   R+Y  P QA+ +I++ EG
Sbjct: 9   VSKLGSFAAAGAAACVAVTFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEG 68

Query: 82  IRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSG 141
           +RGLQ+GL+CAY YQI LNGSRLG Y+P+R+ L          +    +AVN  +GA +G
Sbjct: 69  LRGLQQGLACAYAYQILLNGSRLGLYDPLRAALGGCVLSDRRTYGTAALAVNATAGAAAG 128

Query: 142 IIGAIMGSPLFLIKTRMQSYSNAI------QIGQQTHYTSIWNGLSSIYRAEGFKGLYRG 195
           +IGA +GSPL L+KTRMQ+ +         ++G++         L ++++  G +GLY+G
Sbjct: 129 MIGAALGSPLQLVKTRMQALAPRRVPPLPGRMGRR---------LVALFKDRGVRGLYQG 179

Query: 196 VDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVI 255
           VDAA+LRTG GS+VQL +Y+ AK  L +H  + +G  L+ +AS +S   V + MNP+DV 
Sbjct: 180 VDAALLRTGVGSAVQLAVYSHAKEALSRH--VPDGMALYTLASALSSVAVCIAMNPFDVA 237

Query: 256 LTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVV 315
           +TR+Y+ +G LY+GPLDC  KTVR EG  ALYKG  AQ+ RIAPHTILCLT MEQ ++VV
Sbjct: 238 MTRMYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVV 297

Query: 316 YAVEKQ 321
             VE +
Sbjct: 298 RLVENR 303

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score =  114 bits (285), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 88/297 (29%), Positives = 150/297 (50%), Gaps = 22/297 (7%)

Query: 31  GGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPM-QALKVIFKNEGIRGLQKGL 89
           GG A   AV  T+P++L K R+Q        A  I K  + Q L+ I KNEGI GL  GL
Sbjct: 13  GGAAGIFAVMNTHPLDLTKVRLQ--------AAPIPKPTIVQMLRSILKNEGIVGLYAGL 64

Query: 90  SCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGS 149
           S + + Q     +R G Y+ ++  +       +   K+ N+   + +   SG +G + G+
Sbjct: 65  SASLLRQCTYTTARFGMYDALKEHV-------IPRDKLTNMWYLLGASMVSGALGGLAGN 117

Query: 150 PLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLY-RGVDAAILRTGAGSS 208
              LI  RMQ+ S A+ + ++ +Y +  +G+  IY+AEG K L+  G    ++R    ++
Sbjct: 118 FADLINIRMQNDS-ALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMTA 176

Query: 209 VQLPIYNTAKHFLL-KHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYN---QKG 264
            Q+  Y+  K+FL+ K+++  +    HL +S ++GF    V +P DVI T V N   + G
Sbjct: 177 SQVVTYDMFKNFLVTKYNMDPKKNSTHLTSSLLAGFVATTVCSPADVIKTIVMNAHKKPG 236

Query: 265 NLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYAVEKQ 321
           + +       ++ +  EG   +++G+     R+AP T+L    MEQ  K    + K+
Sbjct: 237 HNHDSSFKILMEAINKEGPSFMFRGWVPSFTRLAPFTMLIFFAMEQLKKYRVGMPKE 293

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score =  106 bits (265), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 77/285 (27%), Positives = 138/285 (48%), Gaps = 21/285 (7%)

Query: 31  GGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGLS 90
           GG+ AC+A   T+P++L K R+Q          R+          I +NEG+ GL  GL+
Sbjct: 18  GGIVACVA---THPLDLAKVRLQTAPAPKPTLVRMASQ-------ILRNEGVPGLYSGLT 67

Query: 91  CAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGAT-SGIIGAIMGS 149
            A + Q     +R G Y+ ++            P +  N  + ++  +  SG +G ++G+
Sbjct: 68  AAILRQCTYTTARFGVYDFVKE--------RYIPKEYLNSMLYLLPCSMFSGAVGGLIGN 119

Query: 150 PLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSV 209
           P  ++  RMQ+ S ++    + +Y +  +GL  I   EG   L+ G    ++R    +S 
Sbjct: 120 PADVVNIRMQNDS-SLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTSS 178

Query: 210 QLPIYNTAKHFLLKH-DLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQKGNLYK 268
           Q+  Y+ AK++L+++  L K+    H  +S ++G     V +P DVI TRV N   + + 
Sbjct: 179 QVVTYDIAKNYLVQNVGLDKDNKSTHFASSLLAGLVATTVCSPADVIKTRVMNAHKHSHD 238

Query: 269 GPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMK 313
             +   +  V+ EG   +++G+     R+ P+TIL    +EQ  K
Sbjct: 239 SAVRILLDAVKQEGPSFMFRGWLPSFVRLGPNTILIFLTVEQLRK 283

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 70/166 (42%), Gaps = 15/166 (9%)

Query: 137 GATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGV 196
           G   GI+  +   PL L K R+Q+              ++    S I R EG  GLY G+
Sbjct: 15  GGFGGIVACVATHPLDLAKVRLQT--------APAPKPTLVRMASQILRNEGVPGLYSGL 66

Query: 197 DAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVIL 256
            AAILR    ++ +  +Y+  K   +  + +     L L  S  SG   G++ NP DV+ 
Sbjct: 67  TAAILRQCTYTTARFGVYDFVKERYIPKEYLNSMLYL-LPCSMFSGAVGGLIGNPADVVN 125

Query: 257 TRVYNQKG------NLYKGPLDCFVKTVRIEGIGALYKGFEAQIFR 296
            R+ N           YK   D   K    EG+  L+ G++  + R
Sbjct: 126 IRMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVR 171

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score =  106 bits (265), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 84/285 (29%), Positives = 137/285 (48%), Gaps = 18/285 (6%)

Query: 31  GGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGLS 90
           GG A   A  VT+P++L K R+Q          R+       L+ I  NEG+ GL  GLS
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRLQAAPMPKPTLFRM-------LESILANEGVVGLYSGLS 72

Query: 91  CAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSP 150
            A + Q      R G Y+    +L +   P     ++ N+A  +     SG IG + G+ 
Sbjct: 73  AAVLRQCTYTTVRFGAYD----LLKENVIPR---EQLTNMAYLLPCSMFSGAIGGLAGNF 125

Query: 151 LFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAE-GFKGLYRGVDAAILRTGAGSSV 209
             ++  RMQ+ S A++  ++ +Y +  +G+  IYR E G K L+ G    ++R    ++ 
Sbjct: 126 ADVVNIRMQNDS-ALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTAS 184

Query: 210 QLPIYNTAKHFLL-KHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQKGNLYK 268
           Q+  Y+  K++L+ K D        HL AS ++G     V +P DV+ TR+ N  G+ ++
Sbjct: 185 QVVTYDVFKNYLVTKLDFDASKNYTHLTASLLAGLVATTVCSPADVMKTRIMNGSGD-HQ 243

Query: 269 GPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMK 313
             L      VR EG   +++G+     R+ P T+L    +EQ  K
Sbjct: 244 PALKILADAVRKEGPSFMFRGWLPSFTRLGPFTMLIFFAIEQLKK 288

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score =  104 bits (260), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 85/282 (30%), Positives = 133/282 (47%), Gaps = 26/282 (9%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           +F  G +A CI   V  PI++VKTRMQ Q + S      YKN +  L  I   EG+RGL 
Sbjct: 527 NFTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFSK-----YKNSIDCLLKILSKEGVRGLY 581

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146
            GL    I        +L   + +R+ L      A    K+ ++   ++SGAT+G    +
Sbjct: 582 SGLGPQLIGVAPEKAIKLTVNDHMRATL------AGRDGKL-SLPCEIISGATAGACQVV 634

Query: 147 MGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAG 206
             +PL ++K R+Q  S+ +    +    +I     S+ +  G  GLYRG  A +LR    
Sbjct: 635 FTNPLEIVKIRLQVKSDYVADAARNSVNAI-----SVIKNLGLIGLYRGAGACLLRDIPF 689

Query: 207 SSVQLPIYNTAKHFLLKHD------LMKEGTGLHLVASTVSGFGVGVVMNPWDVILTR-- 258
           S++  P Y   K  +   D        K  T   LV+  ++G     +  P+DVI TR  
Sbjct: 690 SAIYFPTYAHIKSNVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTTPFDVIKTRLQ 749

Query: 259 VYNQKG-NLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAP 299
           +  +KG ++Y G  D     ++ EGI + +KG  A++ R +P
Sbjct: 750 IDPKKGESVYNGIWDAARTILKEEGIKSFFKGGPARVLRSSP 791

 Score = 80.1 bits (196), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 92/189 (48%), Gaps = 14/189 (7%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           I+G  A    V  TNP+E+VK R+Q++ +  ADA R   N + A+ VI KN G+ GL +G
Sbjct: 623 ISGATAGACQVVFTNPLEIVKIRLQVKSDYVADAAR---NSVNAISVI-KNLGLIGLYRG 678

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRS-VLNKTFYPA-MDPHKVQNVAVNVVSGATSGIIGAI 146
                +  I  +      Y  I+S V N  F P   D     N    +VSG  +G+  A 
Sbjct: 679 AGACLLRDIPFSAIYFPTYAHIKSNVFN--FDPKDSDKRNKLNTWQLLVSGGLAGMPAAF 736

Query: 147 MGSPLFLIKTRMQSYSNAIQIGQ-QTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGA 205
           + +P  +IKTR+Q     I   + ++ Y  IW+   +I + EG K  ++G  A +LR+  
Sbjct: 737 LTTPFDVIKTRLQ-----IDPKKGESVYNGIWDAARTILKEEGIKSFFKGGPARVLRSSP 791

Query: 206 GSSVQLPIY 214
                L  Y
Sbjct: 792 QFGFTLAAY 800

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 1/69 (1%)

Query: 239 TVSGFGVGVVMNPWDVILTRVYNQKG-NLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRI 297
           +V+G    +V+ P D++ TR+  Q+  + YK  +DC +K +  EG+  LY G   Q+  +
Sbjct: 532 SVAGCIGAMVVYPIDMVKTRMQAQRDFSKYKNSIDCLLKILSKEGVRGLYSGLGPQLIGV 591

Query: 298 APHTILCLT 306
           AP   + LT
Sbjct: 592 APEKAIKLT 600

>Kwal_47.17321
          Length = 881

 Score =  103 bits (258), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 80/283 (28%), Positives = 131/283 (46%), Gaps = 26/283 (9%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           +F+ G +A CI  T   PI+LVKTRMQ Q   S      YKN +     IF  EGIRG+ 
Sbjct: 503 NFLLGSVAGCIGATAVYPIDLVKTRMQAQRNFSQ-----YKNSIDCFVKIFSREGIRGIY 557

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146
            GL    +        +L   + +R +L       MD +    + + ++SGA +G    I
Sbjct: 558 SGLGPQLVGVAPEKAIKLTVNDYVRKLL-------MDENNRLTLPLEIISGAAAGACQVI 610

Query: 147 MGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAG 206
             +PL ++K R+Q  S       ++  T++      + ++ G +GLY+G+ A ++R    
Sbjct: 611 FTNPLEIVKIRLQVRSEYADSLPKSQLTAL-----GVVKSLGLRGLYKGLVACLMRDVPF 665

Query: 207 SSVQLPIYNTAKHFLLKHDLMKEG--TGLH----LVASTVSGFGVGVVMNPWDVILTR-- 258
           S++  P Y   K  +  +D   +     LH    L A  ++G     +  P+DVI TR  
Sbjct: 666 SAIYFPTYAHLKRDIFNYDPQDKNKRARLHTWELLTAGGLAGMPAAYLTTPFDVIKTRLQ 725

Query: 259 VYNQKGNL-YKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPH 300
           +  +KG   Y G L      ++ E   + +KG  A++ R +P 
Sbjct: 726 IDPRKGETRYTGILHAARTILKEERFKSFFKGGGARVLRSSPQ 768

 Score = 72.4 bits (176), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 112/240 (46%), Gaps = 20/240 (8%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           I+G  A    V  TNP+E+VK R+Q++ E    A  + K+ + AL V+ K+ G+RGL KG
Sbjct: 599 ISGAAAGACQVIFTNPLEIVKIRLQVRSEY---ADSLPKSQLTALGVV-KSLGLRGLYKG 654

Query: 89  LSCAYIYQIGLNGSRLGFYEPI-RSVLNKTFYPAMDPHKVQNVAVN--VVSGATSGIIGA 145
           L    +  +  +      Y  + R + N   Y   D +K   +     + +G  +G+  A
Sbjct: 655 LVACLMRDVPFSAIYFPTYAHLKRDIFN---YDPQDKNKRARLHTWELLTAGGLAGMPAA 711

Query: 146 IMGSPLFLIKTRMQSYSNAIQIGQ-QTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTG 204
            + +P  +IKTR+Q     I   + +T YT I +   +I + E FK  ++G  A +LR+ 
Sbjct: 712 YLTTPFDVIKTRLQ-----IDPRKGETRYTGILHAARTILKEERFKSFFKGGGARVLRSS 766

Query: 205 AGSSVQLPIYNTAKH-FLLKH---DLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVY 260
                 L  Y   ++ F L+H   +  +E     +V    S F   +  + + V +T  +
Sbjct: 767 PQFGFTLAAYEIFQNMFPLQHSENNESRETNDTPIVTGMFSNFLESLKKSKYHVEVTEFF 826

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 84/194 (43%), Gaps = 25/194 (12%)

Query: 115 NKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYT 174
           N  F+P  D         N + G+ +G IGA    P+ L+KTRMQ+  N  Q      Y 
Sbjct: 491 NFYFFPIFDS------IYNFLLGSVAGCIGATAVYPIDLVKTRMQAQRNFSQ------YK 538

Query: 175 SIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLH 234
           +  +    I+  EG +G+Y G+   ++      +++L + +  +       LM E   L 
Sbjct: 539 NSIDCFVKIFSREGIRGIYSGLGPQLVGVAPEKAIKLTVNDYVRKL-----LMDENNRLT 593

Query: 235 LVASTVSGFGVG----VVMNPWDVILTRVYNQK---GNLYKGPLDCFVKTVRIEGIGALY 287
           L    +SG   G    +  NP +++  R+  +     +L K  L   +  V+  G+  LY
Sbjct: 594 LPLEIISGAAAGACQVIFTNPLEIVKIRLQVRSEYADSLPKSQLTA-LGVVKSLGLRGLY 652

Query: 288 KGFEAQIFRIAPHT 301
           KG  A + R  P +
Sbjct: 653 KGLVACLMRDVPFS 666

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 50/106 (47%), Gaps = 16/106 (15%)

Query: 211 LPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQKG-NLYKG 269
            PI+++  +FLL                +V+G      + P D++ TR+  Q+  + YK 
Sbjct: 495 FPIFDSIYNFLL---------------GSVAGCIGATAVYPIDLVKTRMQAQRNFSQYKN 539

Query: 270 PLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVV 315
            +DCFVK    EGI  +Y G   Q+  +AP   + LT  +   K++
Sbjct: 540 SIDCFVKIFSREGIRGIYSGLGPQLVGVAPEKAIKLTVNDYVRKLL 585

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score =  103 bits (256), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 84/283 (29%), Positives = 128/283 (45%), Gaps = 26/283 (9%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           +F  G +A CI  TV  PI+LVKTRMQ Q   S      YKN +     IF  EGIRG+ 
Sbjct: 521 NFTLGSIAGCIGATVVYPIDLVKTRMQAQRSFSQ-----YKNSIDCFAKIFSREGIRGIY 575

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146
            GL    I        +L   + +R  L       MD H        ++SGA +G    +
Sbjct: 576 SGLGPQLIGVAPEKAIKLTVNDYMRGRL-------MDKHANLKWYFEILSGACAGACQVV 628

Query: 147 MGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAG 206
             +PL ++K R+Q  S       ++  T++      + +  G KGLY+G+ A ++R    
Sbjct: 629 FTNPLEVVKIRLQVRSEYAGDVLKSQVTAL-----GVIKQLGIKGLYKGIAACLMRDVPF 683

Query: 207 SSVQLPIYNTAKHFLLKHD------LMKEGTGLHLVASTVSGFGVGVVMNPWDVILTR-- 258
           S++  P Y   K  + K+D        K  T   LVA  ++G     +  P+DVI TR  
Sbjct: 684 SAIYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTTPFDVIKTRLQ 743

Query: 259 VYNQKGNL-YKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPH 300
           +  +KG   Y+G        ++ E   + +KG  A++ R +P 
Sbjct: 744 IDPRKGETRYEGIFHAARTILKEESFKSFFKGGSARVLRSSPQ 786

 Score = 72.4 bits (176), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 55/191 (28%), Positives = 93/191 (48%), Gaps = 18/191 (9%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           ++G  A    V  TNP+E+VK R+Q++ E + D   + K+ + AL VI K  GI+GL KG
Sbjct: 617 LSGACAGACQVVFTNPLEVVKIRLQVRSEYAGD---VLKSQVTALGVI-KQLGIKGLYKG 672

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVN----VVSGATSGIIG 144
           ++   +  +  +      Y P  + L K  +      K Q   +     +V+G  +G+  
Sbjct: 673 IAACLMRDVPFSA----IYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPA 728

Query: 145 AIMGSPLFLIKTRMQSYSNAIQIGQ-QTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRT 203
           A + +P  +IKTR+Q     I   + +T Y  I++   +I + E FK  ++G  A +LR+
Sbjct: 729 AYLTTPFDVIKTRLQ-----IDPRKGETRYEGIFHAARTILKEESFKSFFKGGSARVLRS 783

Query: 204 GAGSSVQLPIY 214
                  L  Y
Sbjct: 784 SPQFGFTLAAY 794

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 90/212 (42%), Gaps = 25/212 (11%)

Query: 115 NKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYT 174
           N  FYP  D         N   G+ +G IGA +  P+ L+KTRMQ+  +  Q      Y 
Sbjct: 509 NFYFYPIFDS------IYNFTLGSIAGCIGATVVYPIDLVKTRMQAQRSFSQ------YK 556

Query: 175 SIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLH 234
           +  +  + I+  EG +G+Y G+   ++      +++L + +      ++  LM +   L 
Sbjct: 557 NSIDCFAKIFSREGIRGIYSGLGPQLIGVAPEKAIKLTVND-----YMRGRLMDKHANLK 611

Query: 235 LVASTVSGFGVG----VVMNPWDVILTRVY---NQKGNLYKGPLDCFVKTVRIEGIGALY 287
                +SG   G    V  NP +V+  R+       G++ K  +   +  ++  GI  LY
Sbjct: 612 WYFEILSGACAGACQVVFTNPLEVVKIRLQVRSEYAGDVLKSQVTA-LGVIKQLGIKGLY 670

Query: 288 KGFEAQIFRIAPHTILCLTFMEQTMKVVYAVE 319
           KG  A + R  P + +         K V+  +
Sbjct: 671 KGIAACLMRDVPFSAIYFPTYAHLKKDVFKYD 702

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 95.5 bits (236), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 83/300 (27%), Positives = 146/300 (48%), Gaps = 33/300 (11%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRG---- 84
           I+G  A  +   V +P++L+K R+QL    +  AQ+ +  P   +K I ++    G    
Sbjct: 14  ISGLSAGSVTTLVVHPLDLLKVRLQLS---ATSAQKAHYGPFMVIKEIIRSSANSGRSVT 70

Query: 85  --LQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYP--------AMDPHKVQNVAVNV 134
             L +GLS          G   G Y   + ++ K+             + HK+ N  + +
Sbjct: 71  NELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKM-NSLIYL 129

Query: 135 VSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYR 194
            +GA+SG++ AI+ +P+++IKTR+ S S     G Q  YTS++NG+  + R +GF+GL++
Sbjct: 130 SAGASSGLMTAILTNPIWVIKTRIMSTSK----GAQGAYTSMYNGVQQLLRTDGFQGLWK 185

Query: 195 GVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHL-----VASTVSGFGVGVVM 249
           G+  A+     G ++   +Y+T K   L+    + G  +HL     +  T  G  V V +
Sbjct: 186 GLVPALFGVSQG-ALYFAVYDTLKQRKLRRK-RENGLDIHLTNLETIEITSLGKMVSVTL 243

Query: 250 -NPWDVILTRVYNQKGNLYKGPLDCFVK-TVRIEGIGALYKGFEAQIFRIAPHTILCLTF 307
             P+ ++ + + + + N  K  L   +K  +  +G   LYKG  A + R  P T  C+TF
Sbjct: 244 VYPFQLLKSNLQSFRANEQKFRLFPLIKLIIANDGFVGLYKGLSANLVRAIPST--CITF 301

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 87/193 (45%), Gaps = 13/193 (6%)

Query: 30  AGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGL 89
           AG  +  +   +TNPI ++KTR+      S  AQ  Y +    ++ + + +G +GL KGL
Sbjct: 131 AGASSGLMTAILTNPIWVIKTRIM---STSKGAQGAYTSMYNGVQQLLRTDGFQGLWKGL 187

Query: 90  SCAYIYQIGLNGSRLGFYEPIRS-VLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMG 148
             A ++ +         Y+ ++   L +     +D H      + + S     ++   + 
Sbjct: 188 VPA-LFGVSQGALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITS--LGKMVSVTLV 244

Query: 149 SPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSS 208
            P  L+K+ +QS+    +  +Q     ++  +  I   +GF GLY+G+ A ++R    + 
Sbjct: 245 YPFQLLKSNLQSF----RANEQKF--RLFPLIKLIIANDGFVGLYKGLSANLVRAIPSTC 298

Query: 209 VQLPIYNTAKHFL 221
           +   +Y   KH L
Sbjct: 299 ITFCVYENLKHRL 311

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 83/199 (41%), Gaps = 26/199 (13%)

Query: 122 MDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLS 181
           M  H+   +   V+SG ++G +  ++  PL L+K R+Q  + +    Q+ HY   +  + 
Sbjct: 1   MVDHQWTPLQKEVISGLSAGSVTTLVVHPLDLLKVRLQLSATS---AQKAHYGP-FMVIK 56

Query: 182 SIYRAEGFKG------LYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKH-----DLMKEG 230
            I R+    G      LYRG+   +        V   +Y   K  + K      +   +G
Sbjct: 57  EIIRSSANSGRSVTNELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKG 116

Query: 231 TG--------LHLVASTVSGFGVGVVMNPWDVILTRVYN-QKG--NLYKGPLDCFVKTVR 279
            G        ++L A   SG    ++ NP  VI TR+ +  KG    Y    +   + +R
Sbjct: 117 VGNDHKMNSLIYLSAGASSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLR 176

Query: 280 IEGIGALYKGFEAQIFRIA 298
            +G   L+KG    +F ++
Sbjct: 177 TDGFQGLWKGLVPALFGVS 195

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score = 97.1 bits (240), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 84/292 (28%), Positives = 128/292 (43%), Gaps = 26/292 (8%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           +F  G +A CI  TV  PI+LVKTRMQ Q          YKN +  +  IF+ +GIRGL 
Sbjct: 507 NFTLGSIAGCIGATVVYPIDLVKTRMQAQRNSVQ-----YKNSIDCVVKIFQTKGIRGLY 561

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146
            GL    I        +L   + +R          M+  +       ++SGAT+G    +
Sbjct: 562 SGLGPQLIGVAPEKAIKLTVNDFMRQYF-------MNKSRTIKWYQEILSGATAGACQVV 614

Query: 147 MGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAG 206
             +PL ++K R+Q  S+ +    +        G   I R  G +GLY+G  A +LR    
Sbjct: 615 FTNPLEIVKIRLQMRSDYVGENARPQL-----GAVGIIRQLGLRGLYKGAAACLLRDVPF 669

Query: 207 SSVQLPIYNTAKHFLLKHD------LMKEGTGLHLVASTVSGFGVGVVMNPWDVILTR-- 258
           S++  P Y   K  +   D        K  T   L+A  ++G     +  P+DVI TR  
Sbjct: 670 SAIYFPTYAHLKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRLQ 729

Query: 259 VYNQKGN-LYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFME 309
           +  +KG   Y G +      ++ E I + +KG  A++ R +P     L   E
Sbjct: 730 IDPRKGETTYTGVIHAARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAFE 781

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 94/213 (44%), Gaps = 27/213 (12%)

Query: 115 NKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYT 174
           N  FYP  D   + N  +    G+ +G IGA +  P+ L+KTRMQ+  N++Q      Y 
Sbjct: 495 NFYFYPIFD--SIHNFTL----GSIAGCIGATVVYPIDLVKTRMQAQRNSVQ------YK 542

Query: 175 SIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLH 234
           +  + +  I++ +G +GLY G+   ++      +++L + +  + +      M +   + 
Sbjct: 543 NSIDCVVKIFQTKGIRGLYSGLGPQLIGVAPEKAIKLTVNDFMRQY-----FMNKSRTIK 597

Query: 235 LVASTVSGFGVG----VVMNPWDVILTRVYNQKGNLYKG----PLDCFVKTVRIEGIGAL 286
                +SG   G    V  NP +++  R+  Q  + Y G    P    V  +R  G+  L
Sbjct: 598 WYQEILSGATAGACQVVFTNPLEIVKIRL--QMRSDYVGENARPQLGAVGIIRQLGLRGL 655

Query: 287 YKGFEAQIFRIAPHTILCLTFMEQTMKVVYAVE 319
           YKG  A + R  P + +         K V+  +
Sbjct: 656 YKGAAACLLRDVPFSAIYFPTYAHLKKDVFNFD 688

>Scas_602.8
          Length = 885

 Score = 97.1 bits (240), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 84/286 (29%), Positives = 126/286 (44%), Gaps = 31/286 (10%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           +F  G +A CI  T+  PI+ +KTRMQ Q  ++      YKN +  L  IF  EGIRGL 
Sbjct: 501 NFSLGSVAGCIGATLVYPIDFIKTRMQAQRSLTK-----YKNSIDCLVKIFGKEGIRGLY 555

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146
            GL    I        +L   + +R  L       +D      +   V+SGAT+G    +
Sbjct: 556 SGLGPQLIGVAPEKAIKLTVNDFMRKSL-------VDKKGNLQLGAEVLSGATAGACQVV 608

Query: 147 MGSPLFLIKTRMQ---SYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRT 203
             +PL ++K R+Q    Y+NA+    Q     I   L  I       GLY+GV A +LR 
Sbjct: 609 FTNPLEIVKIRLQVKSEYTNAMIPKSQLTAFQIIKELKLI-------GLYKGVGACLLRD 661

Query: 204 GAGSSVQLPIYNTAKHFLLKHDLMKEG------TGLHLVASTVSGFGVGVVMNPWDVILT 257
              S++  P Y   K  + + D   +       T   L A  ++G     +  P+DVI T
Sbjct: 662 VPFSAIYFPTYAHLKKNVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTTPFDVIKT 721

Query: 258 RVYNQKG---NLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPH 300
           R+  + G     Y G L      ++ E   + +KG  A++ R +P 
Sbjct: 722 RLQIEPGVGETRYTGILHAVRTILKEESFRSFFKGGAARVMRSSPQ 767

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 97/198 (48%), Gaps = 21/198 (10%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           ++G  A    V  TNP+E+VK R+Q++ E +     I K+ + A ++I K   + GL KG
Sbjct: 597 LSGATAGACQVVFTNPLEIVKIRLQVKSEYTN--AMIPKSQLTAFQII-KELKLIGLYKG 653

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPH------KVQNVAVNVVSGATSGI 142
           +    +  +  +      Y P  + L K  +   DP+      +++   + + +GA +G+
Sbjct: 654 VGACLLRDVPFSA----IYFPTYAHLKKNVF-QFDPNDKDKRDRLKTWEL-LTAGALAGV 707

Query: 143 IGAIMGSPLFLIKTRMQSYSNAIQIGQ-QTHYTSIWNGLSSIYRAEGFKGLYRGVDAAIL 201
             A + +P  +IKTR+Q     I+ G  +T YT I + + +I + E F+  ++G  A ++
Sbjct: 708 PAAFLTTPFDVIKTRLQ-----IEPGVGETRYTGILHAVRTILKEESFRSFFKGGAARVM 762

Query: 202 RTGAGSSVQLPIYNTAKH 219
           R+       L  Y   K+
Sbjct: 763 RSSPQFGFTLAAYELFKN 780

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 40/78 (51%), Gaps = 4/78 (5%)

Query: 239 TVSGFGVGVVMNPWDVILTRVYNQKG-NLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRI 297
           +V+G     ++ P D I TR+  Q+    YK  +DC VK    EGI  LY G   Q+  +
Sbjct: 506 SVAGCIGATLVYPIDFIKTRMQAQRSLTKYKNSIDCLVKIFGKEGIRGLYSGLGPQLIGV 565

Query: 298 APHTILCLT---FMEQTM 312
           AP   + LT   FM +++
Sbjct: 566 APEKAIKLTVNDFMRKSL 583

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score = 95.9 bits (237), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 81/284 (28%), Positives = 130/284 (45%), Gaps = 27/284 (9%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           +F  G +A CI  TV  PI+ +KTRMQ Q  ++      YKN +  L  I   EGI+GL 
Sbjct: 533 NFSLGSIAGCIGATVVYPIDFIKTRMQAQRSLAQ-----YKNSIDCLLKIISREGIKGLY 587

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146
            GL    I        +L   + +R+ L        D +   ++   ++SGA++G    I
Sbjct: 588 SGLGPQLIGVAPEKAIKLTVNDFMRNRL-------TDKNGKLSLFPEIISGASAGACQVI 640

Query: 147 MGSPLFLIKTRMQSYSNAI-QIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGA 205
             +PL ++K R+Q  S+ + +  QQ + T+     + I +  G +GLY GV A ++R   
Sbjct: 641 FTNPLEIVKIRLQVQSDYVGENIQQANETA-----TQIVKKLGLRGLYNGVAACLMRDVP 695

Query: 206 GSSVQLPIYNTAKHFLLKHDLMKE------GTGLHLVASTVSGFGVGVVMNPWDVILTR- 258
            S++  P Y   K  L   D   +       T   L A  ++G     +  P+DVI TR 
Sbjct: 696 FSAIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRL 755

Query: 259 -VYNQKGNL-YKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPH 300
            +  +KG   Y G        ++ E   + +KG  A++ R +P 
Sbjct: 756 QIDPRKGETKYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQ 799

 Score = 67.8 bits (164), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/200 (26%), Positives = 97/200 (48%), Gaps = 21/200 (10%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGE-MSADAQRIYKNPMQALKVIFKNEGIRGLQK 87
           I+G  A    V  TNP+E+VK R+Q+Q + +  + Q+  +   Q +K +    G+RGL  
Sbjct: 629 ISGASAGACQVIFTNPLEIVKIRLQVQSDYVGENIQQANETATQIVKKL----GLRGLYN 684

Query: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPH-KVQNVAVN----VVSGATSGI 142
           G++   +  +  +      Y P  + L K  +   DP+ K +   +     + +GA +G+
Sbjct: 685 GVAACLMRDVPFSA----IYFPTYAHLKKDLFD-FDPNDKTKRNRLKTWELLTAGAIAGM 739

Query: 143 IGAIMGSPLFLIKTRMQSYSNAIQIGQ-QTHYTSIWNGLSSIYRAEGFKGLYRGVDAAIL 201
             A + +P  +IKTR+Q     I   + +T Y  I++ + +I + E F+  ++G  A +L
Sbjct: 740 PAAFLTTPFDVIKTRLQ-----IDPRKGETKYNGIFHAIRTILKEESFRSFFKGGGARVL 794

Query: 202 RTGAGSSVQLPIYNTAKHFL 221
           R+       L  Y   K F+
Sbjct: 795 RSSPQFGFTLAAYELFKGFI 814

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 246 GVVMNPWDVILTRVYNQKG-NLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILC 304
             V+ P D I TR+  Q+    YK  +DC +K +  EGI  LY G   Q+  +AP   + 
Sbjct: 545 ATVVYPIDFIKTRMQAQRSLAQYKNSIDCLLKIISREGIKGLYSGLGPQLIGVAPEKAIK 604

Query: 305 LT 306
           LT
Sbjct: 605 LT 606

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score = 94.0 bits (232), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 80/283 (28%), Positives = 126/283 (44%), Gaps = 27/283 (9%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           +F  G +A CI  T+  PI+ VKTRMQ Q  +S      YKN +     I   EGIRG+ 
Sbjct: 546 NFSLGSVAGCIGATIVYPIDFVKTRMQAQRSLSQ-----YKNSIDCFLKILSREGIRGVY 600

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146
            GL    I        +L   + +R+ L        D +    +   ++SGA++G    I
Sbjct: 601 SGLGPQLIGVAPEKAIKLTVNDYMRNKL-------KDKNGKLGLLSEIISGASAGACQVI 653

Query: 147 MGSPLFLIKTRMQSYSNAI-QIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGA 205
             +PL ++K R+Q     + +  +    T++      I +  G  GLY+G  A +LR   
Sbjct: 654 FTNPLEIVKIRLQVKGEYVAENAENAKLTAL-----QIIKRLGLPGLYKGAAACLLRDVP 708

Query: 206 GSSVQLPIYNTAKHFLLKHDLMKE------GTGLHLVASTVSGFGVGVVMNPWDVILTR- 258
            S++  P Y   K  L   D   +       T   L A  ++G     +  P+DVI TR 
Sbjct: 709 FSAIYFPTYAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTTPFDVIKTRL 768

Query: 259 -VYNQKGN-LYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAP 299
            +  +KG  +YKG +      +R E   + +KG  A++ R +P
Sbjct: 769 QIDPKKGETIYKGIIHAARTILREESFKSFFKGGAARVLRSSP 811

 Score = 67.8 bits (164), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 57/192 (29%), Positives = 94/192 (48%), Gaps = 19/192 (9%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           I+G  A    V  TNP+E+VK R+Q++GE  A+     K  + AL++I K  G+ GL KG
Sbjct: 642 ISGASAGACQVIFTNPLEIVKIRLQVKGEYVAENAENAK--LTALQII-KRLGLPGLYKG 698

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPH-KVQNVAVN----VVSGATSGII 143
            +   +  +  +      Y P  + L +  +   DP+ K +   +N    + +GA +G+ 
Sbjct: 699 AAACLLRDVPFSA----IYFPTYAHLKRDLF-NFDPNDKNKRSRLNTWELLSAGALAGMP 753

Query: 144 GAIMGSPLFLIKTRMQSYSNAIQIGQ-QTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILR 202
            A + +P  +IKTR+Q     I   + +T Y  I +   +I R E FK  ++G  A +LR
Sbjct: 754 AAYLTTPFDVIKTRLQ-----IDPKKGETIYKGIIHAARTILREESFKSFFKGGAARVLR 808

Query: 203 TGAGSSVQLPIY 214
           +       L  Y
Sbjct: 809 SSPQFGFTLAAY 820

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 84/194 (43%), Gaps = 28/194 (14%)

Query: 115 NKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYT 174
           N  FYP  D         N   G+ +G IGA +  P+  +KTRMQ+  +  Q      Y 
Sbjct: 534 NYYFYPIFDS------LYNFSLGSVAGCIGATIVYPIDFVKTRMQAQRSLSQ------YK 581

Query: 175 SIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLH 234
           +  +    I   EG +G+Y G+   ++      +++L + +      +++ L  +   L 
Sbjct: 582 NSIDCFLKILSREGIRGVYSGLGPQLIGVAPEKAIKLTVND-----YMRNKLKDKNGKLG 636

Query: 235 LVASTVSGFGVG----VVMNPWDVILTRVYNQKG-----NLYKGPLDCFVKTVRIEGIGA 285
           L++  +SG   G    +  NP +++  R+   KG     N     L   ++ ++  G+  
Sbjct: 637 LLSEIISGASAGACQVIFTNPLEIVKIRL-QVKGEYVAENAENAKLTA-LQIIKRLGLPG 694

Query: 286 LYKGFEAQIFRIAP 299
           LYKG  A + R  P
Sbjct: 695 LYKGAAACLLRDVP 708

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 42/79 (53%), Gaps = 4/79 (5%)

Query: 239 TVSGFGVGVVMNPWDVILTRVYNQKG-NLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRI 297
           +V+G     ++ P D + TR+  Q+  + YK  +DCF+K +  EGI  +Y G   Q+  +
Sbjct: 551 SVAGCIGATIVYPIDFVKTRMQAQRSLSQYKNSIDCFLKILSREGIRGVYSGLGPQLIGV 610

Query: 298 APHTILCLT---FMEQTMK 313
           AP   + LT   +M   +K
Sbjct: 611 APEKAIKLTVNDYMRNKLK 629

>Kwal_26.8669
          Length = 296

 Score = 90.5 bits (223), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 93/200 (46%), Gaps = 15/200 (7%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG 81
           ++++ S ++G  A C    V  P ELVK R+Q       D    YK P+  ++ I   EG
Sbjct: 106 LTQSLSILSGASAGCCEAFVVVPFELVKIRLQ-------DVSSSYKGPIDVVRKIIAQEG 158

Query: 82  IRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSG 141
           +  +  GL          N    G    +R++L +         K Q    ++++G+  G
Sbjct: 159 VLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLPEA------KSKSQQTRNDLIAGSIGG 212

Query: 142 IIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAIL 201
            IG++M +P  ++K+R+Q+   A+  G    Y   W  + +IY+ EGF+ LY+G    +L
Sbjct: 213 TIGSLMSTPFDVVKSRIQN--TAVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVL 270

Query: 202 RTGAGSSVQLPIYNTAKHFL 221
           R G G  + L ++     F 
Sbjct: 271 RLGPGGGILLVVFTGCMDFF 290

 Score = 82.4 bits (202), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 68/277 (24%), Positives = 122/277 (44%), Gaps = 20/277 (7%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK 87
           F AG +A    + V  P+++VKTRMQLQ       Q  YK  +  +K I   EG   L K
Sbjct: 13  FAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQ--YKGVVDCIKQIVAKEGASRLYK 70

Query: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIM 147
           G+S   + +     ++    +  + +  + F       K+   +++++SGA++G   A +
Sbjct: 71  GISSPVLMEAPKRATKFACNDEFQKIYKREF----GVEKLTQ-SLSILSGASAGCCEAFV 125

Query: 148 GSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGS 207
             P  L+K R+Q  S++        Y    + +  I   EG   +Y G+++ + R G  +
Sbjct: 126 VVPFELVKIRLQDVSSS--------YKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWN 177

Query: 208 SVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQK---- 263
           +    I    +  L +     + T   L+A ++ G    ++  P+DV+ +R+ N      
Sbjct: 178 AGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAG 237

Query: 264 -GNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAP 299
               Y           + EG  ALYKGF  ++ R+ P
Sbjct: 238 GARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGP 274

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 42/94 (44%), Gaps = 7/94 (7%)

Query: 234 HLVASTVSGFGVGVVMNPWDVILTRVYNQK----GNLYKGPLDCFVKTVRIEGIGALYKG 289
              A  V+G    +VM P DV+ TR+  Q     G  YKG +DC  + V  EG   LYKG
Sbjct: 12  QFAAGAVAGISEILVMYPLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKG 71

Query: 290 FEAQIFRIAPH---TILCLTFMEQTMKVVYAVEK 320
             + +   AP       C    ++  K  + VEK
Sbjct: 72  ISSPVLMEAPKRATKFACNDEFQKIYKREFGVEK 105

>Scas_640.25
          Length = 306

 Score = 89.7 bits (221), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 80/297 (26%), Positives = 129/297 (43%), Gaps = 25/297 (8%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQ---GEMSADAQRIYKNPMQALKVIFKNEGIRG 84
           F+AG +A    + V  P+++VKTRMQLQ   G   A A   YK  +  L  I K EG   
Sbjct: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATH-YKGVIDCLSQIVKKEGPMH 75

Query: 85  LQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIG 144
           + KG+S   + +      +    +    +    F       K     ++V+SGA++GI  
Sbjct: 76  MYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVF-----GTKQLTQQISVLSGASAGITE 130

Query: 145 AIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTG 204
           A++  P  L+K R+Q  ++  +   +         L  I + +G KGLY GV++ + R  
Sbjct: 131 ALVIVPFELVKIRLQDVNSKFKGPVEV--------LKHIIKQDGLKGLYSGVESTVWRNA 182

Query: 205 AGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMN-PWDVILTRVYNQK 263
             ++    +    +  L      +E T   L A  V G   GV+ N P+DV+ +R+ +  
Sbjct: 183 VWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGG-TFGVMFNTPFDVVKSRIQSDG 241

Query: 264 GNL------YKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKV 314
             +      Y       +K    EG  ALYKGF  ++ R+ P   + L      M V
Sbjct: 242 NEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPGGAVLLVVFTNVMNV 298

 Score = 83.6 bits (205), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 84/188 (44%), Gaps = 14/188 (7%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           S ++G  A      V  P ELVK R+Q       D    +K P++ LK I K +G++GL 
Sbjct: 119 SVLSGASAGITEALVIVPFELVKIRLQ-------DVNSKFKGPVEVLKHIIKQDGLKGLY 171

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146
            G+          N    G    +R +L       +   K +    ++ +G   G  G +
Sbjct: 172 SGVESTVWRNAVWNAGYFGVIFQVRELL------PVAKSKQEKTRNDLCAGFVGGTFGVM 225

Query: 147 MGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAG 206
             +P  ++K+R+QS  N I I     Y   W  +  IY  EGF+ LY+G    +LR G G
Sbjct: 226 FNTPFDVVKSRIQSDGNEI-INGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGPG 284

Query: 207 SSVQLPIY 214
            +V L ++
Sbjct: 285 GAVLLVVF 292

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 89.4 bits (220), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 74/277 (26%), Positives = 123/277 (44%), Gaps = 20/277 (7%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK 87
           F+AG +A    + V  P+++VKT MQLQ  +S  +   YK     LK I   EG   L K
Sbjct: 13  FMAGAVAGVSEILVMYPLDMVKTVMQLQ--VSGGSGPQYKGVFDCLKQIAAKEGPSRLYK 70

Query: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIM 147
           G+S   + +     ++    +  + +    F       K+    ++++SGA++GI  + +
Sbjct: 71  GISSPILMEAPKRATKFACNDEFQKIYKDLF----GAEKLTQ-PLSILSGASAGICESFV 125

Query: 148 GSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGS 207
             P  L+K R+Q  S        + +TS    + +I   EG   +Y G+++ + R G  +
Sbjct: 126 VVPFELVKIRLQDVS--------SKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWN 177

Query: 208 SVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQK---- 263
           +    I    +  L K     E T   L+A TV G    ++  P+DV+ +RV N      
Sbjct: 178 AGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPG 237

Query: 264 -GNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAP 299
               Y           + EG  ALYKGF  ++ R+ P
Sbjct: 238 VPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGP 274

 Score = 80.5 bits (197), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 88/195 (45%), Gaps = 15/195 (7%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           S ++G  A      V  P ELVK R+Q       D    + +P+  +K I + EGI  + 
Sbjct: 111 SILSGASAGICESFVVVPFELVKIRLQ-------DVSSKFTSPIAVVKNIVEKEGILAMY 163

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146
            GL          N    G    +R++L K         K +    ++++G   G + ++
Sbjct: 164 NGLESTMWRHGIWNAGYFGIIFQVRALLPKA------STKSEQTRNDLLAGTVGGTLSSL 217

Query: 147 MGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAG 206
           + +P  ++K+R+Q+   A+  G    Y   W  L++IY+ EGFK LY+G    +LR G G
Sbjct: 218 LSTPFDVVKSRVQN--TAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGPG 275

Query: 207 SSVQLPIYNTAKHFL 221
             + L ++     F 
Sbjct: 276 GGILLVVFTGVMDFF 290

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 89.4 bits (220), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 81/303 (26%), Positives = 129/303 (42%), Gaps = 23/303 (7%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRI--------YKNPMQALKVIFKN 79
           F AG +A    + V  P+++VKTRMQLQ         +        Y   M  L  I K 
Sbjct: 15  FTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKIVKK 74

Query: 80  EGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGAT 139
           EG   L KG++   + +      +    +  ++   K F P  +    Q +A+   SGA+
Sbjct: 75  EGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIF-PTPNGEMTQKIAI--YSGAS 131

Query: 140 SGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAA 199
           +G + A + +P  L+K R+Q  ++  +   +    S+  G        G   L+ G++A 
Sbjct: 132 AGAVEAFVVAPFELVKIRLQDVNSQFKTPIEVVKNSVVKG--------GVLSLFNGLEAT 183

Query: 200 ILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMN-PWDVILTR 258
           I R    ++    I    +  L       E T   L+A  + G  VG ++N P+DV+ +R
Sbjct: 184 IWRHVLWNAGYFGIIFQIRKLLPAAKTSTEKTRNDLIAGAIGG-TVGCLLNTPFDVVKSR 242

Query: 259 VYNQKGNL--YKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVY 316
           +    G L  Y   L   +   R EG  ALYKGF  ++ R+AP   L L      M    
Sbjct: 243 IQRSSGPLRKYNWSLPSVLLVYREEGFKALYKGFAPKVMRLAPGGGLLLVVFTNVMDFFR 302

Query: 317 AVE 319
            V+
Sbjct: 303 EVK 305

>Kwal_55.20868
          Length = 380

 Score = 90.1 bits (222), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 83/301 (27%), Positives = 133/301 (44%), Gaps = 35/301 (11%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           ++G MA  +A     P+++ KTR+Q QG + ++    YK  +  L  I ++EG RGL KG
Sbjct: 80  LSGAMAGFLAGVTVCPLDVAKTRLQAQG-LHSNPSNYYKGILGTLTTIIRDEGARGLYKG 138

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMG 148
           L    +            YE  RS   K  YP + P    +   +  S  T+G +  I+ 
Sbjct: 139 LVPIIMGYFPTWMIYFSVYE--RS---KKLYPRIFPS--FDFISHSASALTAGTVSTILT 191

Query: 149 SPLFLIKTR--MQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAG 206
           +P++++KTR  +Q++ N       THYTS ++    +Y  EG +  Y G+  ++L     
Sbjct: 192 NPVWVVKTRLMLQTHVNK----NSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLLGL-FH 246

Query: 207 SSVQLPIYNTAKHFLLKHDLMK--EGTGLHL----VASTVSGFGVGVVMNPWDVILTRVY 260
            ++  PIY   K +L     M   E   L+L    +AS+ S      +  P +++ TR+ 
Sbjct: 247 VAIHFPIYEKLKVWLHCTPSMSRTEDHNLNLARLIIASSASKMVASTLTYPHEILRTRM- 305

Query: 261 NQKGNLYKGPLDCFVKTVR------------IEGIGALYKGFEAQIFRIAPHTILCLTFM 308
            Q       PL    KT R             EG+   Y GF A + R  P + + L   
Sbjct: 306 -QLKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSF 364

Query: 309 E 309
           E
Sbjct: 365 E 365

 Score = 67.8 bits (164), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/210 (24%), Positives = 107/210 (50%), Gaps = 18/210 (8%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG 81
           +S + S +  G  + I   +TNP+ +VKTR+ LQ  ++ ++   Y +   A   ++  EG
Sbjct: 174 ISHSASALTAGTVSTI---LTNPVWVVKTRLMLQTHVNKNSTH-YTSTFDAFHKMYTTEG 229

Query: 82  IRGLQKGL--SCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAM---DPHKVQNVAVNVVS 136
           +R    GL  S   ++ + ++      YE ++  L+ T  P+M   + H + N+A  +++
Sbjct: 230 LRTFYAGLLPSLLGLFHVAIH---FPIYEKLKVWLHCT--PSMSRTEDHNL-NLARLIIA 283

Query: 137 GATSGIIGAIMGSPLFLIKTRMQ--SY-SNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLY 193
            + S ++ + +  P  +++TRMQ  +Y ++ +   Q+T    +   +   Y++EG +G Y
Sbjct: 284 SSASKMVASTLTYPHEILRTRMQLKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRGFY 343

Query: 194 RGVDAAILRTGAGSSVQLPIYNTAKHFLLK 223
            G  A + RT   S++ L  +   + +L K
Sbjct: 344 SGFTANLARTLPASAITLVSFEYFRKYLTK 373

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 77/185 (41%), Gaps = 19/185 (10%)

Query: 128 QNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAE 187
            +  +  +SGA +G +  +   PL + KTR+Q  +  +      +Y  I   L++I R E
Sbjct: 73  DDTEITALSGAMAGFLAGVTVCPLDVAKTRLQ--AQGLHSNPSNYYKGILGTLTTIIRDE 130

Query: 188 GFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLK----HDLMKEGTGLHLVASTVSGF 243
           G +GLY+G+   I+       +   +Y  +K    +     D +       L A TVS  
Sbjct: 131 GARGLYKGLVPIIMGYFPTWMIYFSVYERSKKLYPRIFPSFDFISHSASA-LTAGTVS-- 187

Query: 244 GVGVVMNPWDVILTRVY-----NQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQ---IF 295
              ++ NP  V+ TR+      N+    Y    D F K    EG+   Y G       +F
Sbjct: 188 --TILTNPVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLLGLF 245

Query: 296 RIAPH 300
            +A H
Sbjct: 246 HVAIH 250

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 43/91 (47%), Gaps = 5/91 (5%)

Query: 229 EGTGLHLVASTVSGFGVGVVMNPWDVILTRV-----YNQKGNLYKGPLDCFVKTVRIEGI 283
           + T +  ++  ++GF  GV + P DV  TR+     ++   N YKG L      +R EG 
Sbjct: 73  DDTEITALSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGA 132

Query: 284 GALYKGFEAQIFRIAPHTILCLTFMEQTMKV 314
             LYKG    I    P  ++  +  E++ K+
Sbjct: 133 RGLYKGLVPIIMGYFPTWMIYFSVYERSKKL 163

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 89.0 bits (219), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 72/296 (24%), Positives = 131/296 (44%), Gaps = 15/296 (5%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG 81
           V  T SF+AG +A  +  ++T P E  KTR+QL  + S+ A R   NP+  +    K +G
Sbjct: 8   VDPTKSFVAGALAGAVEASITYPFEFAKTRLQLI-DKSSKASR---NPLVLIYNTAKTQG 63

Query: 82  IRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSG 141
           +  +  G     +       +R   Y+ IR++L       +   +       V++G  +G
Sbjct: 64  VGAIYVGCPAFIVGNTAKAATRFLGYDTIRNLLKDKKTGELSGPR------GVLAGLGAG 117

Query: 142 IIGAIMG-SPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAI 200
           ++ +++  +P   IKT +     +++   Q +  S+     S+ + EGF+GLY GV    
Sbjct: 118 LLESVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGGVLPVS 177

Query: 201 LRTGAGSSVQLPIYNTAKHFLLKHDLMKEG----TGLHLVASTVSGFGVGVVMNPWDVIL 256
           +R  A  +V+L  YN  K  +  +    +     +GL  +    SG        P D + 
Sbjct: 178 MRQAANQAVRLGCYNKIKVLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMPIDTVK 237

Query: 257 TRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTM 312
           TR+ +   + Y   L+CF    + EG+   +KG   ++ R+     +  T  E  +
Sbjct: 238 TRMQSLTASKYSSTLNCFTTIYKEEGLKTFWKGATPRLGRLILSGGIVFTIYENVL 293

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 86/197 (43%), Gaps = 21/197 (10%)

Query: 30  AGGMAACIAVTVTNPIELVKT-----RMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRG 84
           AG + + +AVT   P E +KT     +  ++ +   + + + +N +     + K+EG RG
Sbjct: 116 AGLLESVVAVT---PFEAIKTVLIDDKQSVRPKYQNNGRSMARNYIS----LVKDEGFRG 168

Query: 85  LQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIG 144
           L  G+    + Q      RLG Y  I+ ++    Y      K     +  + GA SG++ 
Sbjct: 169 LYGGVLPVSMRQAANQAVRLGCYNKIKVLVQD--YTGAPKDKPLTSGLTFIVGAFSGVVT 226

Query: 145 AIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTG 204
                P+  +KTRMQS +        + Y+S  N  ++IY+ EG K  ++G    + R  
Sbjct: 227 VYATMPIDTVKTRMQSLT-------ASKYSSTLNCFTTIYKEEGLKTFWKGATPRLGRLI 279

Query: 205 AGSSVQLPIYNTAKHFL 221
               +   IY     +L
Sbjct: 280 LSGGIVFTIYENVLLYL 296

>Scas_702.10
          Length = 302

 Score = 89.0 bits (219), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 76/287 (26%), Positives = 130/287 (45%), Gaps = 21/287 (7%)

Query: 31  GGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGLS 90
           GG A   A  +T+P++L K R+Q          R+       L  I +NE + GL  GLS
Sbjct: 16  GGAAGIFACVMTHPLDLAKVRLQAAPLPKPTLGRM-------LTTILRNENVMGLYSGLS 68

Query: 91  CAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSP 150
            A + Q      R G Y+ ++  L       +    + ++   +     SG IG ++G+ 
Sbjct: 69  AAVLRQCTYTTVRFGAYDLMKENL-------IPQGHINDMVYLLPCSMFSGAIGGLVGNF 121

Query: 151 LFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEG-FKGLYRGVDAAILRTGAGSSV 209
             ++  RMQ+ S A++   + +Y +  +G+  IY  EG  K L  G    ++R    ++ 
Sbjct: 122 ADVVNIRMQNDS-ALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVRGVLMTAS 180

Query: 210 QLPIYNTAKHFL---LKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQKGNL 266
           Q+  Y+  K++L   L  D  K  T  HL AS ++G     + +P DVI TR+ N     
Sbjct: 181 QVVTYDVFKNYLVTKLSFDPKKNST--HLSASLLAGLVATTICSPADVIKTRIMNAHKTE 238

Query: 267 YKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMK 313
            +  +      ++ EG   +++G+     R+ P T+L    +EQ  K
Sbjct: 239 SESAIKILTSAIKKEGPSFMFRGWLPIFTRLGPFTMLIFFAIEQLKK 285

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score = 89.0 bits (219), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 70/215 (32%), Positives = 100/215 (46%), Gaps = 20/215 (9%)

Query: 22  VSKTGSFIAG-GMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNE 80
           VS   +F+AG G     AV V NP+E+VK R+Q Q    A  Q+ Y+N +QA  +I K E
Sbjct: 153 VSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEE 212

Query: 81  GIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVS--GA 138
           GI  L +G+S     Q    G+    Y  +   L +        H  QN+     S  G 
Sbjct: 213 GIGALYRGVSLTAARQATNQGANFTVYSKLMERLQEY-------HGSQNLPSWETSLIGL 265

Query: 139 TSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDA 198
            SG IG    +PL  IKTR+Q   +   +      T+I   L    + EGF+ LY+G+  
Sbjct: 266 VSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWVRITTIGRQL---VQEEGFRALYKGITP 322

Query: 199 AILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGL 233
            ++R   G +V   +Y     F+ +H    EG GL
Sbjct: 323 RVMRVAPGQAVTFTVY----EFVRRH---LEGLGL 350

 Score = 63.9 bits (154), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 60/224 (26%), Positives = 94/224 (41%), Gaps = 13/224 (5%)

Query: 99  LNGSRLGFYEPIRSVLNKTFYPA--MDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKT 156
           +   R    +P  +V  +  YP   M   K  N AVN+V+G T+G+  A+   PL  IK 
Sbjct: 25  IGARRRSVADPCSAVCQQP-YPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKV 83

Query: 157 RMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNT 216
           RMQ Y  A    + T         ++IY  EG    Y+G+ A ++      +++   Y  
Sbjct: 84  RMQIYRRA---NEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEF 140

Query: 217 AKHFLLKHDLMKEGTGLHLVASTVSGFGVGV-VMNPWDVILTRVYNQ------KGNLYKG 269
            +  L         TG   +A   +G    V V+NP +V+  R+  Q      +   Y+ 
Sbjct: 141 YRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRN 200

Query: 270 PLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMK 313
            +      V+ EGIGALY+G      R A +     T   + M+
Sbjct: 201 AIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLME 244

 Score = 60.8 bits (146), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 72/298 (24%), Positives = 118/298 (39%), Gaps = 33/298 (11%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNP--MQALKVIFKNEGIRG 84
           + +AGG A        +P++ +K RMQ+       A    K P  ++    I+  EG+  
Sbjct: 60  NLVAGGTAGLFEALCCHPLDTIKVRMQIY----RRANEGTKPPGFLRTGANIYSGEGLLA 115

Query: 85  LQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIG 144
             KGL    I  I     R   YE  R++L      A     V +     ++G  +G+  
Sbjct: 116 FYKGLGAVVIGIIPKMAIRFSSYEFYRTLL------ADRQTGVVSTGNTFLAGVGAGVTE 169

Query: 145 AIMG-SPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRT 203
           A++  +P+ ++K R+Q+  +     +Q  Y +       I + EG   LYRGV     R 
Sbjct: 170 AVLVVNPMEVVKIRLQA-QHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQ 228

Query: 204 GAGSSVQLPIYNTAKHFLLKHDLMK-----EGTGLHLVASTVSGFGVGVVMNPWDVILTR 258
                    +Y+     L ++   +     E + + LV+  +  F       P D I TR
Sbjct: 229 ATNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNA----PLDTIKTR 284

Query: 259 VYNQKGNLYKGPLDCFVKTVRI-------EGIGALYKGFEAQIFRIAPHTILCLTFME 309
           +   K       L  +V+   I       EG  ALYKG   ++ R+AP   +  T  E
Sbjct: 285 LQKDKSTRN---LSNWVRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 88.2 bits (217), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 86/305 (28%), Positives = 135/305 (44%), Gaps = 53/305 (17%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           +F+AGG+A  ++ TV +P E VK  +Q+Q   +A  Q I    + A++ +++ EG  GL 
Sbjct: 25  AFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQGI----VGAVRQVYREEGTPGLF 80

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPH-----------KVQNVAVNVV 135
           +G         GLN  R+  Y  ++ V+    Y A   H           ++QN    + 
Sbjct: 81  RG--------NGLNCIRIFPYSAVQFVV----YEACKKHFFHVDGSKGREQLQNWQ-RLF 127

Query: 136 SGATSGIIGAIMGSPLFLIKTRMQ-SYSNAIQIGQ-QTHYTS----IWNGLSSIYRAE-G 188
           SGA  G    +   PL L++TR+    +N  ++ + + H  S    +W+ L   Y+ E G
Sbjct: 128 SGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGG 187

Query: 189 FKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTG------LHLVASTVSG 242
            KGLYRGV    L      ++   +Y   K F      M EGT         L    +SG
Sbjct: 188 IKGLYRGVWPTSLGVVPYVALNFAVYEQFKEF------MPEGTDNTLANFYKLSIGALSG 241

Query: 243 FGVGVVMNPWDVILTRVY------NQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFR 296
                V  P+D++  R        N+ G  YK  +D  +   + EG    YKG  A +F+
Sbjct: 242 GVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFK 301

Query: 297 IAPHT 301
           + P T
Sbjct: 302 VIPST 306

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 87/203 (42%), Gaps = 29/203 (14%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGE-----MSADAQRIYKNP--MQALKVIFKNE 80
             +G +    +V  T P++LV+TR+ +Q         + A  I K P     L   +K E
Sbjct: 126 LFSGALCGGCSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEE 185

Query: 81  G-IRGLQKGL---SCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVS 136
           G I+GL +G+   S   +  + LN      YE  +  +         P    N   N   
Sbjct: 186 GGIKGLYRGVWPTSLGVVPYVALN---FAVYEQFKEFM---------PEGTDNTLANFYK 233

Query: 137 ---GATSGIIGAIMGSPLFLIKTRMQSYS-NAIQIGQQTHYTSIWNGLSSIYRAEGFKGL 192
              GA SG +   +  P  L++ R Q  +    ++G    Y S+ + L +I + EGF+G 
Sbjct: 234 LSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELG--FRYKSVMDALITIGKTEGFRGY 291

Query: 193 YRGVDAAILRTGAGSSVQLPIYN 215
           Y+G+ A + +    ++V   +Y 
Sbjct: 292 YKGLTANLFKVIPSTAVSWLVYE 314

>Scas_489.4
          Length = 297

 Score = 87.4 bits (215), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 70/291 (24%), Positives = 125/291 (42%), Gaps = 15/291 (5%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           SFIAG +A  I  ++T P E  KTR+QL  + S  +    +NP+  +    K +G   + 
Sbjct: 13  SFIAGALAGAIEASITYPFEFAKTRLQLIDKTSTAS----RNPLVLIYNTAKTQGTGAIY 68

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146
            G     +      G R   ++ I+++L       +   +       VV+G  +G++ ++
Sbjct: 69  VGCPAFIVGNTAKAGIRFLGFDTIKNMLRDPVTGELSGPR------GVVAGLGAGLLESV 122

Query: 147 MG-SPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGA 205
           +  +P   IKT +     A++   Q +   +     S+ R +G  GLYRGV    +R  A
Sbjct: 123 VAVTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRGVLPVSMRQAA 182

Query: 206 GSSVQLPIYNTAKHFLLKHDLMKE----GTGLHLVASTVSGFGVGVVMNPWDVILTRVYN 261
             +V+L  YN  K  +  +    +     +GL  +    SG        P D + TR+ +
Sbjct: 183 NQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTTMPIDTVKTRMQS 242

Query: 262 QKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTM 312
                Y   ++CF K  + EG+   +KG   ++ R+     +  T  E  +
Sbjct: 243 LDATKYTSTVNCFAKIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYENVL 293

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 84/193 (43%), Gaps = 13/193 (6%)

Query: 30  AGGMAACIAVTVTNPIELVKTRM-QLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           AG + + +AVT   P E +KT +   +  +    Q   +  ++    + +++GI GL +G
Sbjct: 116 AGLLESVVAVT---PFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMGLYRG 172

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMG 148
           +    + Q      RLG Y  I++++    Y      +  +  +  + GA SG++     
Sbjct: 173 VLPVSMRQAANQAVRLGCYNKIKTMVQD--YTNAPKDRPLSSGLTFIVGAFSGVVTVYTT 230

Query: 149 SPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSS 208
            P+  +KTRMQS          T YTS  N  + I++ EG K  ++G    + R      
Sbjct: 231 MPIDTVKTRMQSL-------DATKYTSTVNCFAKIFKEEGLKTFWKGATPRLGRLILSGG 283

Query: 209 VQLPIYNTAKHFL 221
           +   IY     FL
Sbjct: 284 IVFTIYENVLVFL 296

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 88.2 bits (217), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 69/290 (23%), Positives = 129/290 (44%), Gaps = 22/290 (7%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           ++G +A  ++  +  P+++ KTR+Q QG  +   +R Y+  +  L  I ++EG+ GL KG
Sbjct: 89  VSGALAGFVSGIMVCPLDVAKTRLQAQG--AGSGERYYRGIVGTLSAILRDEGVAGLYKG 146

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMG 148
           L+   +            YE       K  YP+  P        +  S  T+G I   + 
Sbjct: 147 LAPIVLGYFPTWMLYFSVYEKC-----KQRYPSYLP---GGFVSHAASALTAGAISTALT 198

Query: 149 SPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSS 208
           +P++++KTR+   S+  +    T+Y S  +    +YR+EG K  Y G+  ++       +
Sbjct: 199 NPIWVVKTRLMIQSDVSR--DSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLFGL-FHVA 255

Query: 209 VQLPIYNTAKHFLLKHDLMKEGTGLH---------LVASTVSGFGVGVVMNPWDVILTRV 259
           +  P+Y   K +L ++    +G  L          +VAS +S     V+  P +++ TR+
Sbjct: 256 IHFPVYEKLKIWLHRNTPAADGQRLDHNKLQLDRLIVASCLSKVVASVITYPHEILRTRM 315

Query: 260 YNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFME 309
             +   +    L+   +    EG    Y GF   + R  P +++ L   E
Sbjct: 316 QVRHSGVPPSLLNLLGRIRASEGYVGFYSGFATNLVRTVPASVITLVSFE 365

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 99/194 (51%), Gaps = 18/194 (9%)

Query: 34  AACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGL--SC 91
           A  I+  +TNPI +VKTR+ +Q ++S D+   Y++ + A + ++++EG++    GL  S 
Sbjct: 190 AGAISTALTNPIWVVKTRLMIQSDVSRDSTN-YRSTLDAFRKMYRSEGLKVFYSGLVPSL 248

Query: 92  AYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVN----VVSGATSGIIGAIM 147
             ++ + ++      YE ++  L++   PA D  ++ +  +     +V+   S ++ +++
Sbjct: 249 FGLFHVAIH---FPVYEKLKIWLHRN-TPAADGQRLDHNKLQLDRLIVASCLSKVVASVI 304

Query: 148 GSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGS 207
             P  +++TRMQ   + +         S+ N L  I  +EG+ G Y G    ++RT   S
Sbjct: 305 TYPHEILRTRMQVRHSGVP-------PSLLNLLGRIRASEGYVGFYSGFATNLVRTVPAS 357

Query: 208 SVQLPIYNTAKHFL 221
            + L  +   + +L
Sbjct: 358 VITLVSFEYFRKYL 371

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 76/174 (43%), Gaps = 10/174 (5%)

Query: 127 VQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRA 186
           + +  V  VSGA +G +  IM  PL + KTR+Q+         + +Y  I   LS+I R 
Sbjct: 81  LDDTQVTAVSGALAGFVSGIMVCPLDVAKTRLQAQGAG---SGERYYRGIVGTLSAILRD 137

Query: 187 EGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVG 246
           EG  GLY+G+   +L       +   +Y   K     +  +  G   H  ++  +G    
Sbjct: 138 EGVAGLYKGLAPIVLGYFPTWMLYFSVYEKCKQRYPSY--LPGGFVSHAASALTAGAIST 195

Query: 247 VVMNPWDVILTRVY-----NQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIF 295
            + NP  V+ TR+      ++    Y+  LD F K  R EG+   Y G    +F
Sbjct: 196 ALTNPIWVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLF 249

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 87.0 bits (214), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 72/300 (24%), Positives = 131/300 (43%), Gaps = 17/300 (5%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG 81
           V  + SFIAG +A  +  +VT P E  KTR+QL  +    A +  +NP+  +    K +G
Sbjct: 7   VDPSKSFIAGCLAGAVEASVTYPFEFAKTRLQLLDK----ASKASRNPLVLIYNTAKTQG 62

Query: 82  IRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQ-NVAVNVVSGATS 140
           I  +  G     +      G R   ++ I+++L        DP   + +    V++G  +
Sbjct: 63  IGSVYVGCPAFIVGNTAKAGVRFLGFDTIKNLLR-------DPKTGELSGPRGVIAGLGA 115

Query: 141 GIIGAIMG-SPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAA 199
           G++ +++  +P   IKT +     +       +   +    +++ R +G  GLYRGV   
Sbjct: 116 GLLESVVAVTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLPV 175

Query: 200 ILRTGAGSSVQLPIYNTAKHFLLKHDLMKE----GTGLHLVASTVSGFGVGVVMNPWDVI 255
            +R  A  +V+L  YN  K  +  +    +     +GL  V    SG        P D +
Sbjct: 176 SMRQAANQAVRLGCYNKIKVMVQDYTNAPKDKPLSSGLTFVVGAFSGIVTVYTTMPIDTV 235

Query: 256 LTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVV 315
            TR+ +     Y   ++CF    + EG+ A +KG   ++ R+     +  T  E+ + V+
Sbjct: 236 KTRMQSLDSKRYSSTINCFTTIFKEEGLKAFWKGATPRLGRLFLSGGIVFTVYEKVLTVL 295

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score = 86.7 bits (213), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 59/199 (29%), Positives = 93/199 (46%), Gaps = 15/199 (7%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG 81
           +S+  S +AG  A C+   V  P ELVK R+Q       DA   YK P+  ++ I   EG
Sbjct: 108 LSQPLSMLAGASAGCVEAFVVVPFELVKIRLQ-------DASSSYKGPVDVVRKIVAREG 160

Query: 82  IRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSG 141
           +  +  GL          NG   G     R++L     PA   +K Q +  +++S +   
Sbjct: 161 VLAMYNGLESTLWRHALWNGGYFGIIFQARALL-----PAAH-NKTQCITNDLISDSIGC 214

Query: 142 IIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAIL 201
            IG ++ +P  ++K+R+Q+   A+  G    Y      L +IYR EGF+ LY+G    +L
Sbjct: 215 SIGCMLSTPFDVVKSRIQN--TAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVL 272

Query: 202 RTGAGSSVQLPIYNTAKHF 220
           R G G  + L ++     F
Sbjct: 273 RLGPGGGILLVVFTGVLDF 291

 Score = 77.4 bits (189), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 68/280 (24%), Positives = 127/280 (45%), Gaps = 26/280 (9%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK 87
           F AG +A    + V  P+++VKTRMQLQ +  A     Y   +  LK I   EG+  L K
Sbjct: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPH--YTGVVDCLKKIVAGEGVGRLYK 72

Query: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVA--VNVVSGATSGIIGA 145
           G+S   + +     ++    +  + +  + F        V+ ++  +++++GA++G + A
Sbjct: 73  GISSPILMEAPKRATKFACNDEFQKLYKQAF-------GVEKLSQPLSMLAGASAGCVEA 125

Query: 146 IMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGA 205
            +  P  L+K R+Q  S++        Y    + +  I   EG   +Y G+++ + R   
Sbjct: 126 FVVVPFELVKIRLQDASSS--------YKGPVDVVRKIVAREGVLAMYNGLESTLWRHAL 177

Query: 206 GSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMN-PWDVILTRVYNQK- 263
            +     I   A+  L       +     L++ ++ G  +G +++ P+DV+ +R+ N   
Sbjct: 178 WNGGYFGIIFQARALLPAAHNKTQCITNDLISDSI-GCSIGCMLSTPFDVVKSRIQNTAV 236

Query: 264 ----GNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAP 299
                  Y   L   +   R EG  ALYKGF  ++ R+ P
Sbjct: 237 IPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 43/94 (45%), Gaps = 7/94 (7%)

Query: 234 HLVASTVSGFGVGVVMNPWDVILTRVYNQ----KGNLYKGPLDCFVKTVRIEGIGALYKG 289
              A  V+G    +VM P DV+ TR+  Q     G  Y G +DC  K V  EG+G LYKG
Sbjct: 14  QFFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKG 73

Query: 290 FEAQIFRIAPH---TILCLTFMEQTMKVVYAVEK 320
             + I   AP       C    ++  K  + VEK
Sbjct: 74  ISSPILMEAPKRATKFACNDEFQKLYKQAFGVEK 107

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 86.7 bits (213), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 82/307 (26%), Positives = 133/307 (43%), Gaps = 38/307 (12%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           +F+AGG+A  ++ TV +P E VK  +Q+Q   ++  + I+     +++ ++  EG +GL 
Sbjct: 25  AFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFS----SIRQVYHEEGTKGLF 80

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVL-----NKTFYPAMDPHKVQNVAVN---VVSGA 138
           +G         GLN  R+  Y  ++ V+      K F+  ++ +  Q    N   + SGA
Sbjct: 81  RG--------NGLNCIRIFPYSAVQFVVYEACKKKLFH--VNGNNGQEQLTNTQRLFSGA 130

Query: 139 TSGIIGAIMGSPLFLIKTRMQ------SYSNAIQIGQQTHYTSIWNGLSSIYRAEG-FKG 191
             G    +   PL LIKTR+       S  N  +    +    IW  LS  YR EG  +G
Sbjct: 131 LCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRG 190

Query: 192 LYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGV---V 248
           LYRGV    L      ++   +Y   + F +     +     +L   T+     GV   +
Sbjct: 191 LYRGVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTI 250

Query: 249 MNPWDVILTRVY------NQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTI 302
             P+D++  R        N+ G  Y    D  V   R EG+   YKG  A +F++ P T 
Sbjct: 251 TYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTA 310

Query: 303 LCLTFME 309
           +     E
Sbjct: 311 VSWLVYE 317

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 57/206 (27%), Positives = 99/206 (48%), Gaps = 22/206 (10%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQ-GEMSA----DAQRIYKNP--MQALK 74
           ++ T    +G +    +V  T P++L+KTR+ +Q   +S+     A+ I K P   Q L 
Sbjct: 120 LTNTQRLFSGALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLS 179

Query: 75  VIFKNEG-IRGLQKGL---SCAYIYQIGLNGSRLGFYEPIRSV-LNKTFYPAMDPHKVQN 129
             ++ EG +RGL +G+   S   +  + LN      YE +R   +N +      P    N
Sbjct: 180 ETYRLEGGLRGLYRGVWPTSLGVVPYVALN---FAVYEQLREFGVNSS---DAQPSWKSN 233

Query: 130 VAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYS-NAIQIGQQTHYTSIWNGLSSIYRAEG 188
           +   +  GA SG +   +  P  L++ R Q  +    ++G    YTS+W+ L +I RAEG
Sbjct: 234 L-YKLTIGAISGGVAQTITYPFDLLRRRFQVLAMGGNELG--FRYTSVWDALVTIGRAEG 290

Query: 189 FKGLYRGVDAAILRTGAGSSVQLPIY 214
             G Y+G+ A + +    ++V   +Y
Sbjct: 291 VSGYYKGLAANLFKVVPSTAVSWLVY 316

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 82/201 (40%), Gaps = 23/201 (11%)

Query: 128 QNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAE 187
           Q+  +  ++G  +G +   + SP   +K  +Q     +Q    ++   I++ +  +Y  E
Sbjct: 20  QDSNIAFLAGGVAGAVSRTVVSPFERVKILLQ-----VQSSTTSYNRGIFSSIRQVYHEE 74

Query: 188 GFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLK---HDLMKEGTGLHLVASTVSGFG 244
           G KGL+RG     +R    S+VQ  +Y   K  L     ++  ++ T    + S     G
Sbjct: 75  GTKGLFRGNGLNCIRIFPYSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGG 134

Query: 245 VGVVMN-PWDVILTRVYNQKGNLYK-------------GPLDCFVKTVRIE-GIGALYKG 289
             VV   P D+I TR+  Q  NL               G      +T R+E G+  LY+G
Sbjct: 135 CSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRG 194

Query: 290 FEAQIFRIAPHTILCLTFMEQ 310
                  + P+  L     EQ
Sbjct: 195 VWPTSLGVVPYVALNFAVYEQ 215

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 86.7 bits (213), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 90/198 (45%), Gaps = 21/198 (10%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           S  AG  A      V  P EL+K RMQ       D +  Y  PM  LK   KNEGI GL 
Sbjct: 121 SIAAGASAGMTEAAVIVPFELIKIRMQ-------DVKSSYLGPMDCLKKTIKNEGIMGLY 173

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146
           KG+          NG   G++  I  V N          K +N   ++++GA  G +G +
Sbjct: 174 KGIESTMWRNALWNG---GYFGVIYQVRNSMPVAKTKGQKTRN---DLIAGAIGGTVGTM 227

Query: 147 MGSPLFLIKTRMQS---YSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRT 203
           + +P  ++K+R+QS    S+A++      Y      L  IYR EGF+ LY+G    + R 
Sbjct: 228 LNTPFDVVKSRIQSVDAVSSAVK-----KYNWCLPSLLVIYREEGFRALYKGFVPKVCRL 282

Query: 204 GAGSSVQLPIYNTAKHFL 221
             G S+ L ++    +F 
Sbjct: 283 APGGSLMLVVFTGMMNFF 300

 Score = 85.5 bits (210), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 128/290 (44%), Gaps = 27/290 (9%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQ------GEMSADAQRIYKNPMQALKVIFKNEG 81
           FI+G +A    +TV  P+++VKTR QL+        +    +R Y   +  LK I K EG
Sbjct: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVER-YNGVIDCLKKIVKKEG 74

Query: 82  IRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSG 141
              L +G+S   + +     ++    +  + +    F       K     +++ +GA++G
Sbjct: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQK-----ISIAAGASAG 129

Query: 142 IIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAIL 201
           +  A +  P  LIK RMQ          ++ Y    + L    + EG  GLY+G+++ + 
Sbjct: 130 MTEAAVIVPFELIKIRMQDV--------KSSYLGPMDCLKKTIKNEGIMGLYKGIESTMW 181

Query: 202 RTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMN-PWDVILTRVY 260
           R    +     +    ++ +       + T   L+A  + G  VG ++N P+DV+ +R+ 
Sbjct: 182 RNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGG-TVGTMLNTPFDVVKSRIQ 240

Query: 261 NQKG-----NLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCL 305
           +          Y   L   +   R EG  ALYKGF  ++ R+AP   L L
Sbjct: 241 SVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLML 290

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 37/92 (40%), Gaps = 11/92 (11%)

Query: 234 HLVASTVSGFGVGVVMNPWDVILTR-----------VYNQKGNLYKGPLDCFVKTVRIEG 282
             ++  V+G     VM P DV+ TR              ++   Y G +DC  K V+ EG
Sbjct: 15  QFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEG 74

Query: 283 IGALYKGFEAQIFRIAPHTILCLTFMEQTMKV 314
              LY+G  + +   AP         +Q  K+
Sbjct: 75  FSRLYRGISSPMLMEAPKRATKFACNDQYQKI 106

>Scas_589.10
          Length = 316

 Score = 86.3 bits (212), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 55/204 (26%), Positives = 90/204 (44%), Gaps = 14/204 (6%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG 81
           V+ T + +AG  A      +  P ELVK R+Q       DAQ  Y++P++  + I +N+G
Sbjct: 120 VTSTVTLLAGTFAGITESLIVVPFELVKIRLQ-------DAQSDYRSPIRCTRTIIENQG 172

Query: 82  IRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSG 141
           + G+  G           N S  G    ++  + +    A    K Q +  + + GA +G
Sbjct: 173 LFGIYAGFESTIWRNTIWNASYFGLIFQVKKFIPR----AKSTTKFQGIRNDFLVGAIAG 228

Query: 142 IIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAIL 201
            +   +  P  ++KTRMQ    + +      Y   W  +  IYR EG KG+Y+G+   I 
Sbjct: 229 CMSCFLSVPFDVVKTRMQ---GSKKTSSGMCYGWAWQSVFLIYRTEGIKGIYKGILPIIC 285

Query: 202 RTGAGSSVQLPIYNTAKHFLLKHD 225
           R G G  + L ++N         D
Sbjct: 286 RYGPGGGLLLVVFNGVNELFRMSD 309

 Score = 82.0 bits (201), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 97/182 (53%), Gaps = 10/182 (5%)

Query: 123 DPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSN-------AIQIGQQTHYTS 175
           DP K+  +    +SGA +G+   IM  PL ++KTR Q   N       ++ + +Q  ++S
Sbjct: 7   DPVKLPFI-YQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSS 65

Query: 176 IWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTG-LH 234
           I + LS I + EGFK LY+G+   +L      +V+       +  ++K   +KE T  + 
Sbjct: 66  ILSCLSKILKEEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVTSTVT 125

Query: 235 LVASTVSGFGVGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQI 294
           L+A T +G    +++ P++++  R+ + + + Y+ P+ C    +  +G+  +Y GFE+ I
Sbjct: 126 LLAGTFAGITESLIVVPFELVKIRLQDAQSD-YRSPIRCTRTIIENQGLFGIYAGFESTI 184

Query: 295 FR 296
           +R
Sbjct: 185 WR 186

 Score = 75.5 bits (184), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 69/288 (23%), Positives = 121/288 (42%), Gaps = 31/288 (10%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQ---GEMSADAQRIYKNP-----MQALKVIFKN 79
           FI+G +A      +  P+++VKTR QLQ     ++  +  + K P     +  L  I K 
Sbjct: 17  FISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILKE 76

Query: 80  EGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNV--AVNVVSG 137
           EG + L KG+S   + ++     +    E  + ++ K F       K++ V   V +++G
Sbjct: 77  EGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKF-------KLKEVTSTVTLLAG 129

Query: 138 ATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVD 197
             +GI  +++  P  L+K R+Q          Q+ Y S      +I   +G  G+Y G +
Sbjct: 130 TFAGITESLIVVPFELVKIRLQD--------AQSDYRSPIRCTRTIIENQGLFGIYAGFE 181

Query: 198 AAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLH--LVASTVSGFGVGVVMNPWDVI 255
           + I R    ++    +    K F+ +     +  G+    +   ++G     +  P+DV+
Sbjct: 182 STIWRNTIWNASYFGLIFQVKKFIPRAKSTTKFQGIRNDFLVGAIAGCMSCFLSVPFDVV 241

Query: 256 LTRVYNQK----GNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAP 299
            TR+   K    G  Y           R EGI  +YKG    I R  P
Sbjct: 242 KTRMQGSKKTSSGMCYGWAWQSVFLIYRTEGIKGIYKGILPIICRYGP 289

 Score = 29.6 bits (65), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 36/96 (37%), Gaps = 14/96 (14%)

Query: 234 HLVASTVSGFGVGVVMNPWDVILTRVYNQ--------------KGNLYKGPLDCFVKTVR 279
             ++  V+G    ++M P DV+ TR   Q              K   +   L C  K ++
Sbjct: 16  QFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILK 75

Query: 280 IEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVV 315
            EG   LYKG    +    P   +     EQ  +++
Sbjct: 76  EEGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIM 111

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 85.9 bits (211), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 70/291 (24%), Positives = 124/291 (42%), Gaps = 15/291 (5%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           SF+AG +A      +T P E  KTR+QL  +    A +  +NP+  +    K +GI  + 
Sbjct: 15  SFLAGSLAGAAEACITYPFEFAKTRLQLIDK----ASKASRNPLVLIYKTAKTQGIGSIY 70

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146
            G     I      G R   ++ I+ +L  +    +   +       V++G  +G++ ++
Sbjct: 71  VGCPAFIIGNTAKAGIRFLGFDTIKDMLRDSETGELSGTR------GVIAGLGAGLLESV 124

Query: 147 MG-SPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGA 205
              +P   IKT +     +       +   +    SS+ R +GF GLYRGV    +R  A
Sbjct: 125 AAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQAA 184

Query: 206 GSSVQLPIYNTAKHFLLKH-DLMKE---GTGLHLVASTVSGFGVGVVMNPWDVILTRVYN 261
             +V+L  YN  K  +  + D  K+    +GL  +    SG        P D + TR+ +
Sbjct: 185 NQAVRLGCYNKIKTLIQDYTDSPKDKPLSSGLTFLVGAFSGIVTVYSTMPLDTVKTRMQS 244

Query: 262 QKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTM 312
                Y   ++CF    + EG+   +KG   ++ R+     +  T  E+ +
Sbjct: 245 LDSTKYSSTMNCFATIFKEEGLKTFWKGATPRLGRLVLSGGIVFTIYEKVL 295

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 86.3 bits (212), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 71/294 (24%), Positives = 130/294 (44%), Gaps = 15/294 (5%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           SF+AG +A  I  ++T P E  KTR+QL  +    A +  +NP+  +    KN GI  + 
Sbjct: 93  SFLAGSIAGAIEASITYPFEFAKTRLQLVDK----ASKASRNPLVLIYNTGKNYGISSIY 148

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146
            G     +      G R   ++ I+++L       +   +       VV+G  +G++ ++
Sbjct: 149 VGCPAFIVGNTAKAGIRFLGFDTIKNLLRDKKTGELSGFR------GVVAGLGAGLLESV 202

Query: 147 MG-SPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGA 205
           +  +P   IKT +     A     Q +   + +  + +   +GF GLYRGV    +R  A
Sbjct: 203 VAVTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQAA 262

Query: 206 GSSVQLPIYNTAKHFLLKH-DLMKE---GTGLHLVASTVSGFGVGVVMNPWDVILTRVYN 261
             +V+L  YN  K  +  + ++ K+    +GL  +    SG        P D + TR+ +
Sbjct: 263 NQAVRLGCYNKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTTMPIDTVKTRMQS 322

Query: 262 QKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVV 315
                Y   ++CF    + EG+   +KG   ++ R+     +  T  E+ + V+
Sbjct: 323 LNAGQYSSTINCFATIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYEKVLTVL 376

>Kwal_26.7967
          Length = 297

 Score = 85.1 bits (209), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 133/297 (44%), Gaps = 17/297 (5%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           SF+AG +A  +  ++T P E  KTR+QL  + S+ A R   NP+  +    K +G+  + 
Sbjct: 12  SFLAGSLAGAVEASITYPFEFAKTRLQLV-DKSSTASR---NPLTLIYRTAKVQGLGAVY 67

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQ-NVAVNVVSGATSGIIGA 145
            G     +      G R   ++ I+++L        DP   + +    +V+G  +G++ +
Sbjct: 68  VGCPAFIVGNTAKAGVRFLGFDAIKNILR-------DPTTGELSGPRGIVAGLGAGLLES 120

Query: 146 IMG-SPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTG 204
           ++  +P   IKT +     +       +   +    SS+   +GF GLYRGV    +R  
Sbjct: 121 VVAVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSMRQA 180

Query: 205 AGSSVQLPIYNTAKHFLLKH-DLMKE---GTGLHLVASTVSGFGVGVVMNPWDVILTRVY 260
           A  +V+L  YN  K  +  + +  K+    +G+  V    SG        P D + TR+ 
Sbjct: 181 ANQAVRLGCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKTRMQ 240

Query: 261 NQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYA 317
           +   + Y   ++CF    R EG+   +KG   ++ R+     +  T  E+ + V+ A
Sbjct: 241 SLDSSKYSSTINCFATVFREEGLKTFWKGATPRLGRLILSGGIVFTIYEKVLVVLGA 297

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 84.3 bits (207), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 79/280 (28%), Positives = 121/280 (43%), Gaps = 20/280 (7%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEM----SADAQRIYKNPMQALKVIFKNEGI 82
            F+ GG++A IA T   PIE VK  MQ Q EM    S D +  YK  +   K    +EGI
Sbjct: 16  DFLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTR--YKGILDCFKRTATHEGI 73

Query: 83  RGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGI 142
               +G +   +           F + I+S+L+   Y        +  A N+ SG  +G 
Sbjct: 74  VSFWRGNTANVLRYFPTQALNFAFKDKIKSLLS---YDRERDGYAKWFAGNLFSGGAAGG 130

Query: 143 IGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILR 202
           +  +    L   +TR+ + +   +   Q  +  + +      + +G  GLYRG   ++L 
Sbjct: 131 LSLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGFVPSVLG 190

Query: 203 TGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGF----GVGVVMNPWDVILTR 258
                 +   +Y++ K  LL   L  EG+    VAS + G+    G      P D +  R
Sbjct: 191 IIVYRGLYFGLYDSFKPVLLTGAL--EGS---FVASFLLGWVITMGASTASYPLDTVRRR 245

Query: 259 VYNQKGNL--YKGPLDCFVKTVRIEGIGALYKGFEAQIFR 296
           +    G    Y G LDC  K V+ EG  +L+KG  A IFR
Sbjct: 246 MMMTSGQTIKYDGALDCLRKIVQKEGAYSLFKGCGANIFR 285

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 73/174 (41%), Gaps = 13/174 (7%)

Query: 129 NVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQ-QTHYTSIWNGLSSIYRAE 187
           +  V+ + G  S  I     +P+  +K  MQ+    ++ G   T Y  I +        E
Sbjct: 12  HFGVDFLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTATHE 71

Query: 188 GFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVG- 246
           G    +RG  A +LR     ++     +  K  LL +D  ++G       +  SG   G 
Sbjct: 72  GIVSFWRGNTANVLRYFPTQALNFAFKDKIKS-LLSYDRERDGYAKWFAGNLFSGGAAGG 130

Query: 247 ---VVMNPWDVILTRVY-NQKGN------LYKGPLDCFVKTVRIEGIGALYKGF 290
              + +   D   TR+  + +G+       + G LD + KT++ +G+  LY+GF
Sbjct: 131 LSLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGLLGLYRGF 184

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 24/44 (54%)

Query: 267 YKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQ 310
           YKG LDCF +T   EGI + ++G  A + R  P   L   F ++
Sbjct: 57  YKGILDCFKRTATHEGIVSFWRGNTANVLRYFPTQALNFAFKDK 100

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 84.3 bits (207), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 76/324 (23%), Positives = 142/324 (43%), Gaps = 46/324 (14%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQL-----------------QGEMSADAQRIYKNPM 70
           F+AGG+       VT P ++VKTR+Q                  Q  + A   R +K   
Sbjct: 56  FVAGGIGGMAGAVVTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETF 115

Query: 71  QALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNV 130
             +  +++NEG R L KGL    +  I         Y   + + +KT     +      V
Sbjct: 116 GIISNVYRNEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKTLNNGQEA-----V 170

Query: 131 AVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFK 190
            +++++ AT+G   +   +P++L+KTR+Q      + G    Y + W+ L ++ + EG  
Sbjct: 171 WIHLMAAATAGWATSTATNPIWLVKTRLQ----LDKAGTTKKYKNSWDCLKNVVQKEGIL 226

Query: 191 GLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVAST----------- 239
           GLY+G+ A+ L +  G  +Q  +Y   KH + +  + K G    +  ST           
Sbjct: 227 GLYKGLSASYLGSVEG-ILQWVLYEQMKHIIKQRSMEKFGNISEVEKSTSDKIKEWCQRS 285

Query: 240 ----VSGFGVGVVMNPWDVILTRVYN---QKGNL-YKGPLDCFVKTVRIEGIGALYKGFE 291
               ++ F   ++  P +V+ TR+     + G L Y G +      ++ EG+ ++Y G  
Sbjct: 286 GSAGLAKFVASIITYPHEVVRTRLRQAPLENGKLKYTGLVQSIRVIIKEEGLASMYGGLT 345

Query: 292 AQIFRIAPHTILCLTFMEQTMKVV 315
             + R  P++I+     E  ++++
Sbjct: 346 PHLLRTVPNSIIMFGTWELVIRLL 369

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 83.6 bits (205), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 80/310 (25%), Positives = 131/310 (42%), Gaps = 36/310 (11%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG 81
           VS   S IAG ++   A   T P++ VK R QLQ  +  D    YK     ++ I K EG
Sbjct: 16  VSWYNSVIAGSVSGVFARMATAPMDTVKIRYQLQ-PVQEDK---YKGIASTVRTIMKEEG 71

Query: 82  IRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSG 141
           +R L KG   A    +     + G Y    +V +  F     P   Q     +  GA +G
Sbjct: 72  LRALWKGNIPATAMYVVYGAVQFGSYSWFNNVWSAKF-----PRFSQQ-GQTLTVGALAG 125

Query: 142 IIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAIL 201
           +  +++  PL L++TR+ +        + +H TS+      ++  EG +G + G+  A+ 
Sbjct: 126 MTSSVVSYPLDLLRTRLIA-------NRTSHRTSVAEECRQMWLNEGVRGFFTGISTAMT 178

Query: 202 RTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVAST--VSGFGVGVVMNPWDVILTR- 258
                +++    Y T       H+  KE     + AS+  ++GF    ++ P D +  R 
Sbjct: 179 TVTLSTAIMFLTYETVNIVCENHE--KEFWSRPVSASSGIIAGFVSKTMVFPIDTLRRRM 236

Query: 259 -VYNQKGNL-------------YKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILC 304
            V N K  +             YK       K +R EG+ ALY+G    + +  P T + 
Sbjct: 237 QVMNSKRTVHFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALYRGLTMGLCKSVPTTAIS 296

Query: 305 LTFMEQTMKV 314
           L   E+TM +
Sbjct: 297 LFVYERTMDL 306

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score = 83.2 bits (204), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 63/206 (30%), Positives = 95/206 (46%), Gaps = 18/206 (8%)

Query: 22  VSKTGSFIAG-GMAACIAVTVTNPIELVKTRMQ---LQGEMSADAQRIYKNPMQALKVIF 77
           VS   +F+AG G     AV V NP+E+VK R+Q   L  E +A  +  Y+N +QA  +I 
Sbjct: 107 VSTGNTFLAGVGAGTTEAVLVVNPMEVVKIRLQAQHLHPETAASPR--YRNALQACYLIV 164

Query: 78  KNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVS- 136
           K EGI  L +G+S     Q    G+    Y  ++  L        + HK   +     S 
Sbjct: 165 KEEGIGALYRGVSLTAARQATNQGANFTVYSKLKEFLQ-------EHHKTDALPSWETSC 217

Query: 137 -GATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRG 195
            G  SG IG    +PL  IKTR+Q   +   +   +   +I   L    + EGF+ LY+G
Sbjct: 218 IGLISGAIGPFSNAPLDTIKTRLQKDKSTANMSGWSRIVTIGKQL---IKEEGFRALYKG 274

Query: 196 VDAAILRTGAGSSVQLPIYNTAKHFL 221
           +   ++R   G +V   +Y   +  L
Sbjct: 275 ITPRVMRVAPGQAVTFTVYEFVREHL 300

 Score = 73.9 bits (180), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 73/295 (24%), Positives = 118/295 (40%), Gaps = 25/295 (8%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNP--MQALKVIFKNEGIRG 84
           + IAGG A        +P++ +K RMQ+    + +     K P  ++  + I+  EG+  
Sbjct: 13  NLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEG---IKPPGFIKTGRNIYTEEGLLA 69

Query: 85  LQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIG 144
           L KGL    I  I     R   YE  RS L      A       +     ++G  +G   
Sbjct: 70  LYKGLGAVVIGIIPKMAIRFSSYEFYRSAL------ADKQTGSVSTGNTFLAGVGAGTTE 123

Query: 145 AIMG-SPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRT 203
           A++  +P+ ++K R+Q+     +      Y +       I + EG   LYRGV     R 
Sbjct: 124 AVLVVNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAARQ 183

Query: 204 GAGSSVQLPIYNTAKHFLLKH---DLMK--EGTGLHLVASTVSGFGVGVVMNPWDVILTR 258
                    +Y+  K FL +H   D +   E + + L++  +  F       P D I TR
Sbjct: 184 ATNQGANFTVYSKLKEFLQEHHKTDALPSWETSCIGLISGAIGPFSNA----PLDTIKTR 239

Query: 259 VYNQKGNLYKGPLDCFV----KTVRIEGIGALYKGFEAQIFRIAPHTILCLTFME 309
           +   K           V    + ++ EG  ALYKG   ++ R+AP   +  T  E
Sbjct: 240 LQKDKSTANMSGWSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYE 294

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 76/172 (44%), Gaps = 10/172 (5%)

Query: 126 KVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYR 185
           K  N AVN+++G T+G+  A+   PL  IK RMQ Y  +   G +           +IY 
Sbjct: 6   KSSNPAVNLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKP--PGFIKTGRNIYT 63

Query: 186 AEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGV 245
            EG   LY+G+ A ++      +++   Y   +  L         TG   +A   +G   
Sbjct: 64  EEGLLALYKGLGAVVIGIIPKMAIRFSSYEFYRSALADKQTGSVSTGNTFLAGVGAGTTE 123

Query: 246 GV-VMNPWDVILTRVYNQK-------GNLYKGPLDCFVKTVRIEGIGALYKG 289
            V V+NP +V+  R+  Q           Y+  L      V+ EGIGALY+G
Sbjct: 124 AVLVVNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRG 175

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 82.4 bits (202), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 92/203 (45%), Gaps = 9/203 (4%)

Query: 22  VSKTGSFIAG-GMAACIAVTVTNPIELVKTRMQLQ--GEMSADAQRIYKNPMQALKVIFK 78
           VS   +F+AG G     AV V NP+E+VK R+Q Q       +A   Y N + A   I K
Sbjct: 108 VSTGNTFVAGVGAGITEAVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVK 167

Query: 79  NEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGA 138
            EG+  L +G+S     Q    G+    Y  ++  L    Y  MD   V         G 
Sbjct: 168 EEGVSALYRGVSLTAARQATNQGANFTVYSKLKEFLQN--YHQMD---VLPSWETSCIGL 222

Query: 139 TSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDA 198
            SG IG    +PL  IKTR+Q    +I + +Q+    I    + + + EGF+ LY+G+  
Sbjct: 223 ISGAIGPFSNAPLDTIKTRLQK-DKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITP 281

Query: 199 AILRTGAGSSVQLPIYNTAKHFL 221
            ++R   G +V   +Y   +  L
Sbjct: 282 RVMRVAPGQAVTFTVYEYVREHL 304

 Score = 74.3 bits (181), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 71/297 (23%), Positives = 124/297 (41%), Gaps = 25/297 (8%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           + +AGG A        +P++ +K RMQ+   ++          ++  + I++ EG   L 
Sbjct: 13  NLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLALY 72

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVL-NKTFYPAMDPHKVQNVAVNVVSGATSGIIGA 145
           KGL    I  I     R   YE  R++L NK          + +     V+G  +GI  A
Sbjct: 73  KGLGAVVIGIIPKMAIRFSSYEFYRTLLVNKE-------SGIVSTGNTFVAGVGAGITEA 125

Query: 146 IMG-SPLFLIKTRMQS-YSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRT 203
           ++  +P+ ++K R+Q+ +    +      Y +  +   +I + EG   LYRGV     R 
Sbjct: 126 VLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQ 185

Query: 204 GAGSSVQLPIYNTAKHFLLKHDLMK-----EGTGLHLVASTVSGFGVGVVMNPWDVILTR 258
                    +Y+  K FL  +  M      E + + L++  +  F       P D I TR
Sbjct: 186 ATNQGANFTVYSKLKEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNA----PLDTIKTR 241

Query: 259 VYN------QKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFME 309
           +        +K +  K  +    + ++ EG  ALYKG   ++ R+AP   +  T  E
Sbjct: 242 LQKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYE 298

 Score = 62.8 bits (151), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 79/173 (45%), Gaps = 10/173 (5%)

Query: 126 KVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYR 185
           K  + A+N+++G T+G+  A+   PL  IK RMQ Y     I        I  G  +IY+
Sbjct: 6   KASHPAINLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTG-RTIYQ 64

Query: 186 AEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGV 245
            EGF  LY+G+ A ++      +++   Y   +  L+  +     TG   VA   +G   
Sbjct: 65  KEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLVNKESGIVSTGNTFVAGVGAGITE 124

Query: 246 GV-VMNPWDVILTRVYNQK--------GNLYKGPLDCFVKTVRIEGIGALYKG 289
            V V+NP +V+  R+  Q         G  Y   +      V+ EG+ ALY+G
Sbjct: 125 AVLVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRG 177

>Scas_721.27
          Length = 374

 Score = 82.8 bits (203), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 82/328 (25%), Positives = 142/328 (43%), Gaps = 50/328 (15%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMS-----------ADAQRIYKNPMQA---- 72
           F+AGG+       VT P +LVKTR+Q     S           A   +I  + +QA    
Sbjct: 56  FVAGGIGGMAGAVVTCPFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGTHF 115

Query: 73  ------LKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHK 126
                 L  ++K EG R L KGL    +  I         Y   + + +K F    +   
Sbjct: 116 KETFGILGNVYKREGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKAFNNGQE--- 172

Query: 127 VQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRA 186
                ++++S AT+G   +   +P+++IKTR+Q      + G    Y + W+ L ++ ++
Sbjct: 173 --TPLIHLMSAATAGWATSTATNPIWMIKTRVQ----LDKAGTTRKYKNSWDCLKTVLKS 226

Query: 187 EGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVAST------- 239
           EG  GLYRG+ A+ L +  G  +Q  +Y   KH + +  + K G    L  S        
Sbjct: 227 EGIYGLYRGLSASYLGSIEG-ILQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEW 285

Query: 240 --------VSGFGVGVVMNPWDVILTRVYN---QKGN-LYKGPLDCFVKTVRIEGIGALY 287
                   V+ F   +V  P +V+ TR+     + G   Y G +  F   ++ EG+ ++Y
Sbjct: 286 CQRSGSAGVAKFIASIVTYPHEVVRTRLRQMPMENGKPKYTGLVQSFRVIIKEEGLASMY 345

Query: 288 KGFEAQIFRIAPHTILCLTFMEQTMKVV 315
            G    + R  P++I+     E  ++++
Sbjct: 346 SGLTPHLMRTVPNSIIMFGTWELVIRLL 373

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 81.6 bits (200), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 124/282 (43%), Gaps = 25/282 (8%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEM--SADAQRIYKNPMQALKVIFKNEGIRG 84
            F+ GG++A +A T  +PIE VK  +Q Q EM         YK  +   +   + EGI  
Sbjct: 14  DFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQRTARQEGIIS 73

Query: 85  LQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIG 144
             +G +   I           F + I+++    F    +    +  A N+ SG  +G + 
Sbjct: 74  FWRGNTANVIRYFPTQALNFAFKDQIKAM----FGFKKEEGYAKWFAGNLASGGIAGGLS 129

Query: 145 AIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYR----AEGFKGLYRGVDAAI 200
            +    L   +TR+ + + + + G +  +    NGL  +Y+    ++G  GLYRG   ++
Sbjct: 130 LMFVYSLDYARTRLAADAKSSKKGGERQF----NGLVDVYKKTIASDGVAGLYRGFLPSV 185

Query: 201 LRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGF----GVGVVMNPWDVIL 256
           +       +   +Y++ K  LL   L  EG+    +AS + G+    G      P D + 
Sbjct: 186 IGIVVYRGLYFGLYDSCKPLLLTGSL--EGS---FIASFLLGWVVTTGASTASYPLDTVR 240

Query: 257 TRVYNQKGNL--YKGPLDCFVKTVRIEGIGALYKGFEAQIFR 296
            R+    G    YKG +DC  K V  EG+ +L+KG  A I R
Sbjct: 241 RRMMMTSGQAVKYKGAMDCLQKIVAAEGVSSLFKGCGANILR 282

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 87/201 (43%), Gaps = 18/201 (8%)

Query: 25  TGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADA-QRIYKNPMQALKVIFKNEGIR 83
            G+  +GG+A  +++     ++  +TR+    + S    +R +   +   K    ++G+ 
Sbjct: 116 AGNLASGGIAGGLSLMFVYSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVA 175

Query: 84  GLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVN--VVSGATSG 141
           GL +G   + I  +   G   G Y+  + +L      +++   + +  +   V +GA++ 
Sbjct: 176 GLYRGFLPSVIGIVVYRGLYFGLYDSCKPLL---LTGSLEGSFIASFLLGWVVTTGASTA 232

Query: 142 IIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAIL 201
                   PL  ++ RM   S     GQ   Y    + L  I  AEG   L++G  A IL
Sbjct: 233 ------SYPLDTVRRRMMMTS-----GQAVKYKGAMDCLQKIVAAEGVSSLFKGCGANIL 281

Query: 202 RTGAGSSVQLPIYNTAKHFLL 222
           R  AG+ V + +Y+  +  L 
Sbjct: 282 RGVAGAGV-ISLYDQLQMILF 301

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 267 YKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYAVEKQ 321
           YKG +DCF +T R EGI + ++G  A + R  P   L   F +Q +K ++  +K+
Sbjct: 55  YKGIVDCFQRTARQEGIISFWRGNTANVIRYFPTQALNFAFKDQ-IKAMFGFKKE 108

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 72/175 (41%), Gaps = 16/175 (9%)

Query: 129 NVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTH-YTSIWNGLSSIYRAE 187
           N A++ + G  S  +     SP+  +K  +Q+    I+ G   H Y  I +      R E
Sbjct: 10  NFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQRTARQE 69

Query: 188 GFKGLYRGVDAAILRTGAGSSVQLPIYNTAKH-FLLKHDLMKEGTGLHLVASTVSGFGVG 246
           G    +RG  A ++R     ++     +  K  F  K +   EG       +  SG   G
Sbjct: 70  GIISFWRGNTANVIRYFPTQALNFAFKDQIKAMFGFKKE---EGYAKWFAGNLASGGIAG 126

Query: 247 ----VVMNPWDVILTRV-----YNQKG--NLYKGPLDCFVKTVRIEGIGALYKGF 290
               + +   D   TR+      ++KG    + G +D + KT+  +G+  LY+GF
Sbjct: 127 GLSLMFVYSLDYARTRLAADAKSSKKGGERQFNGLVDVYKKTIASDGVAGLYRGF 181

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 82.4 bits (202), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 61/204 (29%), Positives = 98/204 (48%), Gaps = 11/204 (5%)

Query: 22  VSKTGSFIAG-GMAACIAVTVTNPIELVKTRMQLQGEMSAD---AQRIYKNPMQALKVIF 77
           VS + +FIAG G     AV V NP+E+VK R+Q Q  ++ +   A+  Y N +QA   I 
Sbjct: 135 VSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQ-HLNPNHDLAKPKYTNAVQAGYTII 193

Query: 78  KNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSG 137
           K EGI  L +G+S     Q    G+    Y  +R  L +       P   +   + ++SG
Sbjct: 194 KEEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLP-SWETSCIGLISG 252

Query: 138 ATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVD 197
           A    IG    +PL  IKTR+Q    +     ++ +  I +  + + + EGF+ LY+G+ 
Sbjct: 253 A----IGPFSNAPLDTIKTRLQK-DKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGIT 307

Query: 198 AAILRTGAGSSVQLPIYNTAKHFL 221
             ++R   G +V   +Y   +  L
Sbjct: 308 PRVMRVAPGQAVTFTVYEFVRRHL 331

 Score = 70.9 bits (172), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 75/322 (23%), Positives = 128/322 (39%), Gaps = 49/322 (15%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSA------------------------DA 62
           + +AGG A        +P++ +K RMQ+    +A                        DA
Sbjct: 14  NLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGGDA 73

Query: 63  QRIYKNP--MQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYP 120
               K P  ++  + I+  EG   L KGL    I  I     R   YE  R++L      
Sbjct: 74  TAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLL------ 127

Query: 121 AMDPHKVQNVAVNVVSGATSGIIGAIMG-SPLFLIKTRMQS-YSNAIQIGQQTHYTSIWN 178
           A     V + +   ++G  +G+  A++  +P+ ++K R+Q+ + N      +  YT+   
Sbjct: 128 ADKQTGVVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQ 187

Query: 179 GLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMK-----EGTGL 233
              +I + EG   LYRGV     R          +Y+  + FL ++   +     E + +
Sbjct: 188 AGYTIIKEEGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLPSWETSCI 247

Query: 234 HLVASTVSGFGVGVVMNPWDVILTRVYNQKGNLYKGP------LDCFVKTVRIEGIGALY 287
            L++  +  F       P D I TR+   K   +KG            + ++ EG  ALY
Sbjct: 248 GLISGAIGPFSNA----PLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALY 303

Query: 288 KGFEAQIFRIAPHTILCLTFME 309
           KG   ++ R+AP   +  T  E
Sbjct: 304 KGITPRVMRVAPGQAVTFTVYE 325

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 80/201 (39%), Gaps = 46/201 (22%)

Query: 129 NVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTS------------- 175
           N  VN+V+G T+G+  A+   PL  IK RMQ Y            +              
Sbjct: 10  NPVVNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVG 69

Query: 176 -------------IWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLL 222
                        I  G  +IY  EGF  LY+G+ A ++      +++   Y        
Sbjct: 70  GGDATAAIKPPGFIRTG-RNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYE-----FY 123

Query: 223 KHDLMKEGTGLHLVAST-VSGFGVGV-----VMNPWDVILTRVYNQKGNL--------YK 268
           +  L  + TG+   ++T ++G G GV     V+NP +V+  R+  Q  N         Y 
Sbjct: 124 RTLLADKQTGVVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYT 183

Query: 269 GPLDCFVKTVRIEGIGALYKG 289
             +      ++ EGI ALY+G
Sbjct: 184 NAVQAGYTIIKEEGISALYRG 204

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 82.0 bits (201), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 79/300 (26%), Positives = 125/300 (41%), Gaps = 29/300 (9%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQG--EMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           I+G ++  ++  +  P ++ KTR+Q QG   M+  +Q  YK        IFK+EG  GL 
Sbjct: 43  ISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQH-YKGFFGTFATIFKDEGAAGLY 101

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146
           KGL    +  I         Y+  R      F     PH       N  S  T+G I  +
Sbjct: 102 KGLQPTVLGYIPTLMIYFSVYDFCRKYSVDIF-----PH--SPFLSNASSAITAGAISTV 154

Query: 147 MGSPLFLIKTRMQSYSNAIQIG---QQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRT 203
             +P++++KTR+      +Q G     THY    +    I + EG K LY G+  A+L  
Sbjct: 155 ATNPIWVVKTRLM-----LQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGLVPALLGM 209

Query: 204 GAGSSVQLPIYNTAKHFL-------LKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVIL 256
               ++Q P+Y   K          +  D+        ++AS +S      V  P +++ 
Sbjct: 210 -LNVAIQFPLYENLKIRFGYSESTDVSTDVTSSNFQKLILASMLSKMVASTVTYPHEILR 268

Query: 257 TRVYNQKG--NLYKGPLDCFVK-TVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMK 313
           TR+  +    N  +  L   +K T R EG    Y GF   + R  P  ++ L   E + K
Sbjct: 269 TRMQLKSDLPNTVQRHLLPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSFEYSKK 328

 Score = 70.9 bits (172), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 79/167 (47%), Gaps = 12/167 (7%)

Query: 132 VNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKG 191
           V  +SGA SG + A++  P  + KTR+Q+        Q  HY   +   ++I++ EG  G
Sbjct: 40  VAAISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAG 99

Query: 192 LYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKH--DLMKEGTGLHLVASTVSGFGVGVV- 248
           LY+G+   +L    G    L IY +   F  K+  D+      L   +S ++   +  V 
Sbjct: 100 LYKGLQPTVL----GYIPTLMIYFSVYDFCRKYSVDIFPHSPFLSNASSAITAGAISTVA 155

Query: 249 MNPWDVILTRVYNQKG-----NLYKGPLDCFVKTVRIEGIGALYKGF 290
            NP  V+ TR+  Q G       YKG +D F K ++ EG  ALY G 
Sbjct: 156 TNPIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQEGAKALYAGL 202

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 87/190 (45%), Gaps = 9/190 (4%)

Query: 34  AACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGLSCAY 93
           A  I+   TNPI +VKTR+ LQ  +   +   YK  +   + I + EG + L  GL  A 
Sbjct: 148 AGAISTVATNPIWVVKTRLMLQTGIGKYSTH-YKGTIDTFRKIIQQEGAKALYAGLVPAL 206

Query: 94  IYQIGLNGSRLGFYE--PIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPL 151
           +  + +   +   YE   IR   +++   + D     N    +++   S ++ + +  P 
Sbjct: 207 LGMLNV-AIQFPLYENLKIRFGYSESTDVSTDVTS-SNFQKLILASMLSKMVASTVTYPH 264

Query: 152 FLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQL 211
            +++TRMQ  S+     Q+ H   +   +   YR EGF G Y G    ++RT   + V L
Sbjct: 265 EILRTRMQLKSDLPNTVQR-HLLPL---IKITYRQEGFAGFYSGFATNLVRTVPAAVVTL 320

Query: 212 PIYNTAKHFL 221
             +  +K +L
Sbjct: 321 VSFEYSKKYL 330

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 81.6 bits (200), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 121/282 (42%), Gaps = 25/282 (8%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEM--SADAQRIYKNPMQALKVIFKNEGIRG 84
            F+ GG++A +A T  +PIE VK  +Q Q EM       R Y   +   K     EG+  
Sbjct: 26  DFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVIS 85

Query: 85  LQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIG 144
             +G +   I           F + I+++    F    +    +  A N+ SG  +G + 
Sbjct: 86  FWRGNTANVIRYFPTQALNFAFKDKIKAM----FGFKKEEGYAKWFAGNLASGGAAGALS 141

Query: 145 AIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYR----AEGFKGLYRGVDAAI 200
            +    L   +TR+ + S + + G    +    NGL  +Y+    ++G  GLYRG   ++
Sbjct: 142 LLFVYSLDYARTRLAADSKSSKKGGARQF----NGLIDVYKKTLKSDGVAGLYRGFLPSV 197

Query: 201 LRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGF----GVGVVMNPWDVIL 256
           +       +   +Y++ K  LL   L  EG+    +AS + G+    G      P D + 
Sbjct: 198 VGIVVYRGLYFGMYDSLKPLLLTGSL--EGS---FLASFLLGWVVTTGASTCSYPLDTVR 252

Query: 257 TRVYNQKGNL--YKGPLDCFVKTVRIEGIGALYKGFEAQIFR 296
            R+    G    Y G  DC  K V  EG+G+L+KG  A I R
Sbjct: 253 RRMMMTSGQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILR 294

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/200 (22%), Positives = 88/200 (44%), Gaps = 18/200 (9%)

Query: 26  GSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADA-QRIYKNPMQALKVIFKNEGIRG 84
           G+  +GG A  +++     ++  +TR+    + S     R +   +   K   K++G+ G
Sbjct: 129 GNLASGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAG 188

Query: 85  LQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVN--VVSGATSGI 142
           L +G   + +  +   G   G Y+ ++ +L      +++   + +  +   V +GA++  
Sbjct: 189 LYRGFLPSVVGIVVYRGLYFGMYDSLKPLL---LTGSLEGSFLASFLLGWVVTTGAST-- 243

Query: 143 IGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILR 202
                  PL  ++ RM   S     GQ   Y   ++ L  I  AEG   L++G  A ILR
Sbjct: 244 ----CSYPLDTVRRRMMMTS-----GQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILR 294

Query: 203 TGAGSSVQLPIYNTAKHFLL 222
             AG+ V + +Y+  +  L 
Sbjct: 295 GVAGAGV-ISMYDQLQMILF 313

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 267 YKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYAVEKQ 321
           Y G LDCF +T   EG+ + ++G  A + R  P   L   F ++ +K ++  +K+
Sbjct: 67  YAGILDCFKRTATQEGVISFWRGNTANVIRYFPTQALNFAFKDK-IKAMFGFKKE 120

 Score = 35.8 bits (81), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 38/175 (21%), Positives = 70/175 (40%), Gaps = 16/175 (9%)

Query: 129 NVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQ-QTHYTSIWNGLSSIYRAE 187
           N  ++ + G  S  +     SP+  +K  +Q+    ++ G     Y  I +        E
Sbjct: 22  NFLIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQE 81

Query: 188 GFKGLYRGVDAAILRTGAGSSVQLPIYNTAKH-FLLKHDLMKEGTGLHLVASTVSGFGVG 246
           G    +RG  A ++R     ++     +  K  F  K +   EG       +  SG   G
Sbjct: 82  GVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFGFKKE---EGYAKWFAGNLASGGAAG 138

Query: 247 VV----MNPWDVILTRV-----YNQKGNL--YKGPLDCFVKTVRIEGIGALYKGF 290
            +    +   D   TR+      ++KG    + G +D + KT++ +G+  LY+GF
Sbjct: 139 ALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGF 193

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 81.6 bits (200), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 63/193 (32%), Positives = 96/193 (49%), Gaps = 30/193 (15%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQ-RIYKNPMQALKVIFKNEGIRGLQ 86
           F+AG  A     T TNPI LVKTR+QL  + +AD + R YKN    LK + +NEGI GL 
Sbjct: 167 FLAGATAGWATSTATNPIWLVKTRLQL--DKAADGRSRRYKNSWDCLKGVMRNEGILGLY 224

Query: 87  KGLSCAYIYQIGLNGSRLGF--YEPIRSVL--------------NKTFYPAMDPHKVQNV 130
           KGLS +Y   +G   S L +  YE ++ ++              NKT Y      KV+  
Sbjct: 225 KGLSASY---LGSVESILQWVLYEQMKHIIRQRSIEEFGDISEENKTTY-----MKVKEW 276

Query: 131 AVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFK 190
                S   + +  +I+  P  +++TR++    A +   +  YT ++   S I + EGF 
Sbjct: 277 CQRSGSAGAAKLFASILTYPHEVVRTRLR---QAPKENGKLKYTGLFQSFSLIIKEEGFA 333

Query: 191 GLYRGVDAAILRT 203
            +Y G+   ++RT
Sbjct: 334 SMYSGLTPHLMRT 346

 Score = 73.6 bits (179), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 74/312 (23%), Positives = 137/312 (43%), Gaps = 52/312 (16%)

Query: 42  TNPIELVKTRMQ-------LQGEMSADAQRIYKNPMQ------ALKVIFKNEGIRGLQKG 88
           T P ++VKTR+Q        + + +A    +Y+  M        ++ ++  EG R L KG
Sbjct: 67  TCPFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKG 126

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMD-PHKVQNVA-----VNVVSGATSGI 142
           L           G  L    P RS+   T+    D   ++ N       ++ ++GAT+G 
Sbjct: 127 L-----------GPNLVGVIPARSINFFTYGVTKDTASRLLNDGQEAPWIHFLAGATAGW 175

Query: 143 IGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILR 202
             +   +P++L+KTR+Q    A   G+   Y + W+ L  + R EG  GLY+G+ A+ L 
Sbjct: 176 ATSTATNPIWLVKTRLQLDKAA--DGRSRRYKNSWDCLKGVMRNEGILGLYKGLSASYLG 233

Query: 203 TGAGSSVQLPIYNTAKHFLLKH------DLMKEGTGLHLV---------ASTVSGFGVGV 247
           +   S +Q  +Y   KH + +       D+ +E    ++          ++  +     +
Sbjct: 234 S-VESILQWVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAAKLFASI 292

Query: 248 VMNPWDVILTRVY---NQKGNL-YKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTIL 303
           +  P +V+ TR+     + G L Y G    F   ++ EG  ++Y G    + R  P++I+
Sbjct: 293 LTYPHEVVRTRLRQAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVPNSII 352

Query: 304 CLTFMEQTMKVV 315
                E  +K++
Sbjct: 353 MFGTWELVIKLL 364

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 79.7 bits (195), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 83/312 (26%), Positives = 133/312 (42%), Gaps = 57/312 (18%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQL-------QGEMSADAQRIYKNPMQALKVIFKNEG 81
           I+G  A  I    T+P++LVK R+QL       QG      +RI K+  Q     F  E 
Sbjct: 13  ISGLTAGTITTVSTHPLDLVKVRLQLLATNKKPQGYYDV-VKRIVKDSKQH---SFFRET 68

Query: 82  IRGLQKGL---SCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGA 138
            RGL   L   S A+    GL  +   +     +   K F   M+  K     + +++ A
Sbjct: 69  YRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLMYLLAAA 128

Query: 139 TSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDA 198
            SG+  +++ +P+++IKTR+ S S          Y S  +G+  +YR EG  G +RG+  
Sbjct: 129 MSGVATSVLTNPIWVIKTRIMSTS----FVDSRSYRSTVDGIKKLYRIEGLAGFWRGLVP 184

Query: 199 AILRTGAGSSVQLPIYNTAKH--FLLKH-DLMKEGTGL--------------------HL 235
           ++     G+ +   +Y+T K+  F  KH D  K+ + L                     L
Sbjct: 185 SLFGVSQGA-IYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLSKMVSVTAVYPLQL 243

Query: 236 VASTVSGFGVGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIF 295
           + S +  F V  V+NP              ++K     +V+    +G+  LYKG  A + 
Sbjct: 244 LKSNLQSFEVSTVINP---------KTSHRVWKLITTIYVR----DGVTGLYKGLLANLI 290

Query: 296 RIAPHTILCLTF 307
           R  P T  C+TF
Sbjct: 291 RAVPST--CITF 300

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 93/196 (47%), Gaps = 11/196 (5%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK 87
            +A  M+      +TNPI ++KTR+      S    R Y++ +  +K +++ EG+ G  +
Sbjct: 124 LLAAAMSGVATSVLTNPIWVIKTRIM---STSFVDSRSYRSTVDGIKKLYRIEGLAGFWR 180

Query: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPA--MDPHKVQNVAVNVVSGATSGIIGA 145
           GL  +         S+   Y  +   L   ++ A  +D  K  +    +   + S ++  
Sbjct: 181 GLVPSL-----FGVSQGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITSLSKMVSV 235

Query: 146 IMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGA 205
               PL L+K+ +QS+  +  I  +T +  +W  +++IY  +G  GLY+G+ A ++R   
Sbjct: 236 TAVYPLQLLKSNLQSFEVSTVINPKTSH-RVWKLITTIYVRDGVTGLYKGLLANLIRAVP 294

Query: 206 GSSVQLPIYNTAKHFL 221
            + +   +Y   +H+L
Sbjct: 295 STCITFCVYENFRHWL 310

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 89/204 (43%), Gaps = 20/204 (9%)

Query: 134 VVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLY 193
           ++SG T+G I  +   PL L+K R+Q    A     Q +Y  +   +    +   F+  Y
Sbjct: 12  MISGLTAGTITTVSTHPLDLVKVRLQLL--ATNKKPQGYYDVVKRIVKDSKQHSFFRETY 69

Query: 194 RGVDAAILRTGAGSSVQLPIYNTAKHFLLK---------HDLM---KEGTGL-HLVASTV 240
           RG+   +L       +   +Y  +K ++ +         ++ M   KE T L +L+A+ +
Sbjct: 70  RGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLMYLLAAAM 129

Query: 241 SGFGVGVVMNPWDVILTRVYNQ---KGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRI 297
           SG    V+ NP  VI TR+ +        Y+  +D   K  RIEG+   ++G    +F +
Sbjct: 130 SGVATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGIKKLYRIEGLAGFWRGLVPSLFGV 189

Query: 298 APHTILCLTFMEQTMKVVYAVEKQ 321
           +   I    +   T+K  Y   K 
Sbjct: 190 SQGAIYFTVY--DTLKYHYFAAKH 211

>Scas_709.9
          Length = 365

 Score = 80.5 bits (197), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 129/293 (44%), Gaps = 24/293 (8%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           ++G +A  ++  +  P+++ KTR+Q QG  S +    Y+  +  +  I  +EG+RGL KG
Sbjct: 69  LSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIE-NPYYRGVLGTMSTIVVDEGVRGLYKG 127

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMG 148
           L    +            YE       K  YP + P+   +   +  S  T+G    ++ 
Sbjct: 128 LIPIILGYFPTWMIYFSVYE-----FAKDLYPRVLPN--SDFISHSCSAITAGAASTVLT 180

Query: 149 SPLFLIKTRMQSYSNAIQIGQ-QTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGS 207
           +P++++KTR+   +    +G+ +THY    +    I   EG + LY G+  ++       
Sbjct: 181 NPIWVVKTRLMLQT---PLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMFGL-LHV 236

Query: 208 SVQLPIYNTAKHFLLKHDLM----KEGTGLHL----VASTVSGFGVGVVMNPWDVILTRV 259
           ++  P+Y   K+ L    +      +   LHL    +AS+ S     ++  P +++ TR+
Sbjct: 237 AIHFPVYEKLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILRTRM 296

Query: 260 YNQKGNLYKGP---LDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFME 309
             +   L       LD   +T R EG+   Y GF   + R  P + + L   E
Sbjct: 297 QLKSDKLLISKHKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSFE 349

 Score = 69.3 bits (168), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 103/208 (49%), Gaps = 19/208 (9%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG 81
           +S + S I  G A+ +   +TNPI +VKTR+ LQ  +  +++  Y+  + A K I   EG
Sbjct: 163 ISHSCSAITAGAASTV---LTNPIWVVKTRLMLQTPL-GESRTHYRGTIDAFKKIITQEG 218

Query: 82  IRGLQKGLSCAYIYQIGLNGSRLGF--YEPIRSVLNKTFYPAMDPHKVQNVAVN----VV 135
           +R L  GL  +     GL    + F  YE +++ L+         H  Q  +++    ++
Sbjct: 219 VRTLYTGLVPS---MFGLLHVAIHFPVYEKLKNRLHCD--TITGGHNSQEHSLHLTRLII 273

Query: 136 SGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRG 195
           + + S ++ +I+  P  +++TRMQ  S+ + I +      + + +   YR EG  G Y G
Sbjct: 274 ASSASKMLASILTYPHEILRTRMQLKSDKLLISKH----KLLDLIKRTYRYEGLLGFYSG 329

Query: 196 VDAAILRTGAGSSVQLPIYNTAKHFLLK 223
               +LRT   S++ L  +   ++ LLK
Sbjct: 330 FATNLLRTVPASAITLVSFEYFRNALLK 357

 Score = 68.2 bits (165), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 112/249 (44%), Gaps = 23/249 (9%)

Query: 52  MQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIR 111
           MQ  G+ + D + +   P ++LK    NE +   +   S +++YQ  L    L  +EP +
Sbjct: 1   MQHDGKNTDDMKNL---PQESLK----NEHLLT-EDAKSASHLYQNML----LQSHEPEK 48

Query: 112 SVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQT 171
            + +      +    + +  +  +SGA +G +  I+  PL + KTR+Q+    IQ  +  
Sbjct: 49  HIASTVIQSKL---HLSDPKITALSGALAGFLSGIIVCPLDVTKTRLQA--QGIQSIENP 103

Query: 172 HYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGT 231
           +Y  +   +S+I   EG +GLY+G+   IL       +   +Y  AK  L    L     
Sbjct: 104 YYRGVLGTMSTIVVDEGVRGLYKGLIPIILGYFPTWMIYFSVYEFAKD-LYPRVLPNSDF 162

Query: 232 GLHLVASTVSGFGVGVVMNPWDVILTRVYNQ-----KGNLYKGPLDCFVKTVRIEGIGAL 286
             H  ++  +G    V+ NP  V+ TR+  Q         Y+G +D F K +  EG+  L
Sbjct: 163 ISHSCSAITAGAASTVLTNPIWVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTL 222

Query: 287 YKGFEAQIF 295
           Y G    +F
Sbjct: 223 YTGLVPSMF 231

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 80.1 bits (196), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 69/289 (23%), Positives = 123/289 (42%), Gaps = 19/289 (6%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           ++G  A  ++     P+++ KTR+Q QG  +      Y+  M  L  I ++EG RGL KG
Sbjct: 82  LSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKG 141

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMG 148
           L    +            YE      +K F+  + P    +      +  T+G     + 
Sbjct: 142 LVPIVLGYFPTWMIYFSVYE-----FSKKFFHGIFPQF--DFVAQSCAAITAGAASTTLT 194

Query: 149 SPLFLIKTRMQSYSNAIQIGQQ-THYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGS 207
           +P++++KTR+   SN   +G+  THY   ++    ++  EGFK LY G+  ++L      
Sbjct: 195 NPIWVVKTRLMLQSN---LGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLGL-FHV 250

Query: 208 SVQLPIYNTAKHFLLKHDLMKEGTGLHL----VASTVSGFGVGVVMNPWDVILTRVY--- 260
           ++  PIY   K     +        ++L    +AS+VS      V  P +++ TR+    
Sbjct: 251 AIHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHEILRTRMQLKS 310

Query: 261 NQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFME 309
           +   ++ +        T   EG+   Y GF   + R  P + + L   E
Sbjct: 311 DIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFE 359

 Score = 60.8 bits (146), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 83/187 (44%), Gaps = 20/187 (10%)

Query: 127 VQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRA 186
           + +  +  +SGA +G +  +   PL + KTR+Q+     +  +  +Y  I   LS+I R 
Sbjct: 74  LSSTQITALSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRF-ENPYYRGIMGTLSTIVRD 132

Query: 187 EGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVG 246
           EG +GLY+G+   +L       +   +Y  +K F   H +  +      VA + +    G
Sbjct: 133 EGPRGLYKGLVPIVLGYFPTWMIYFSVYEFSKKFF--HGIFPQ---FDFVAQSCAAITAG 187

Query: 247 ----VVMNPWDVILTRVYNQKGNL------YKGPLDCFVKTVRIEGIGALYKGFEAQ--- 293
                + NP  V+ TR+  Q  NL      YKG  D F K    EG  ALY G       
Sbjct: 188 AASTTLTNPIWVVKTRLMLQ-SNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLLG 246

Query: 294 IFRIAPH 300
           +F +A H
Sbjct: 247 LFHVAIH 253

 Score = 32.3 bits (72), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 41/98 (41%), Gaps = 6/98 (6%)

Query: 230 GTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQ------KGNLYKGPLDCFVKTVRIEGI 283
            T +  ++   +GF  GV + P DV  TR+  Q      +   Y+G +      VR EG 
Sbjct: 76  STQITALSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGP 135

Query: 284 GALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYAVEKQ 321
             LYKG    +    P  ++  +  E + K  + +  Q
Sbjct: 136 RGLYKGLVPIVLGYFPTWMIYFSVYEFSKKFFHGIFPQ 173

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 79.3 bits (194), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 71/278 (25%), Positives = 120/278 (43%), Gaps = 16/278 (5%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEM--SADAQRIYKNPMQALKVIFKNEGIRG 84
           +F+ GG++A ++ T   PIE VK  +Q Q EM       R Y   +   K    +EG+  
Sbjct: 12  NFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDRRYNGIVDCFKRTAASEGVIS 71

Query: 85  LQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIG 144
             +G +   I           F + I+++    F   +D +  +  A N+ SG  +G + 
Sbjct: 72  FWRGNTANVIRYFPTQALNFAFKDKIKAMFG--FRKEVDGY-AKWFAGNLASGGAAGGLS 128

Query: 145 AIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYR----AEGFKGLYRGVDAAI 200
            +    L   +TR+ + S + + G +  +    NGL  +Y+    ++G  GLYRG   ++
Sbjct: 129 LLFVYSLDYARTRLAADSKSAKKGGERQF----NGLVDVYKKTLASDGIAGLYRGFLPSV 184

Query: 201 LRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVY 260
           +       +   +Y++ K  LL  +L        L+   V+  G      P D +  R+ 
Sbjct: 185 VGIVVYRGLYFGMYDSLKPLLLTGNLESSFIASFLLGWAVTT-GASTASYPLDTVRRRMM 243

Query: 261 NQKGNL--YKGPLDCFVKTVRIEGIGALYKGFEAQIFR 296
              G    Y G  D F K V  EG+ +L+KG  A I R
Sbjct: 244 MTSGQAVKYDGAFDAFRKIVAAEGVKSLFKGCGANILR 281

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 85/194 (43%), Gaps = 18/194 (9%)

Query: 25  TGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADA-QRIYKNPMQALKVIFKNEGIR 83
            G+  +GG A  +++     ++  +TR+    + +    +R +   +   K    ++GI 
Sbjct: 115 AGNLASGGAAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGIA 174

Query: 84  GLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVN--VVSGATSG 141
           GL +G   + +  +   G   G Y+ ++ +L       ++   + +  +   V +GA++ 
Sbjct: 175 GLYRGFLPSVVGIVVYRGLYFGMYDSLKPLL---LTGNLESSFIASFLLGWAVTTGASTA 231

Query: 142 IIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAIL 201
                   PL  ++ RM   S     GQ   Y   ++    I  AEG K L++G  A IL
Sbjct: 232 ------SYPLDTVRRRMMMTS-----GQAVKYDGAFDAFRKIVAAEGVKSLFKGCGANIL 280

Query: 202 RTGAGSSVQLPIYN 215
           R  AG+ V + +Y+
Sbjct: 281 RGVAGAGV-ISLYD 293

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 267 YKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYAVEKQ 321
           Y G +DCF +T   EG+ + ++G  A + R  P   L   F ++ +K ++   K+
Sbjct: 53  YNGIVDCFKRTAASEGVISFWRGNTANVIRYFPTQALNFAFKDK-IKAMFGFRKE 106

>Scas_718.24
          Length = 337

 Score = 79.7 bits (195), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 123/282 (43%), Gaps = 25/282 (8%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEM--SADAQRIYKNPMQALKVIFKNEGIRG 84
            F+ GG++A +A T  +PIE VK  +Q Q EM         YK  +   +   + EGI  
Sbjct: 45  DFLMGGVSAAVAKTAASPIERVKLLIQNQNEMLKQGTLDTKYKGIVDCFRRTAQQEGIIS 104

Query: 85  LQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIG 144
             +G +   I           F + I+ +     +   D +  +  A N+ SG  +G + 
Sbjct: 105 FWRGNTANVIRYFPTQALNFAFKDKIKLMFG---FKKEDGYG-KWFAGNLASGGAAGGLS 160

Query: 145 AIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYR----AEGFKGLYRGVDAAI 200
            +    L   +TR+ + S + + G    +    NGL  +Y+    ++G  GLYRG   ++
Sbjct: 161 LLFVYSLDFARTRLAADSKSSKKGGSRQF----NGLIDVYKKTLKSDGVAGLYRGFLPSV 216

Query: 201 LRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGF----GVGVVMNPWDVIL 256
           +       +   +Y++ K  LL   L  EG+    +AS + G+    G      P D + 
Sbjct: 217 VGIIVYRGLYFGLYDSIKPVLLTGSL--EGS---FLASFLLGWVVTTGASTCSYPLDTVR 271

Query: 257 TRVYNQKGNL--YKGPLDCFVKTVRIEGIGALYKGFEAQIFR 296
            ++    G    YKG  DCF K V  EG+ +L+KG  A I R
Sbjct: 272 RKMMMTSGQAVKYKGAFDCFKKIVAAEGVASLFKGCGANILR 313

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 87/200 (43%), Gaps = 18/200 (9%)

Query: 26  GSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADA-QRIYKNPMQALKVIFKNEGIRG 84
           G+  +GG A  +++     ++  +TR+    + S     R +   +   K   K++G+ G
Sbjct: 148 GNLASGGAAGGLSLLFVYSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAG 207

Query: 85  LQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVN--VVSGATSGI 142
           L +G   + +  I   G   G Y+ I+ VL      +++   + +  +   V +GA++  
Sbjct: 208 LYRGFLPSVVGIIVYRGLYFGLYDSIKPVL---LTGSLEGSFLASFLLGWVVTTGAST-- 262

Query: 143 IGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILR 202
                  PL  ++ +M   S     GQ   Y   ++    I  AEG   L++G  A ILR
Sbjct: 263 ----CSYPLDTVRRKMMMTS-----GQAVKYKGAFDCFKKIVAAEGVASLFKGCGANILR 313

Query: 203 TGAGSSVQLPIYNTAKHFLL 222
             AG+ V + +Y+  +  L 
Sbjct: 314 GVAGAGV-ISMYDQLQMILF 332

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 267 YKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYAVEKQ 321
           YKG +DCF +T + EGI + ++G  A + R  P   L   F ++ +K+++  +K+
Sbjct: 86  YKGIVDCFRRTAQQEGIISFWRGNTANVIRYFPTQALNFAFKDK-IKLMFGFKKE 139

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 79.0 bits (193), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 83/311 (26%), Positives = 130/311 (41%), Gaps = 42/311 (13%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           +F+AGG+A  I+ TV +P E VK  +Q+Q   +A  + ++     A+  ++K E I+GL 
Sbjct: 26  AFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLF----DAIGQVYKEENIKGLF 81

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVL----NKTFYPAMDPHKVQ--NVAVNVVSGATS 140
           +G         GLN  R+  Y  ++ V+     K  +      K +  N    + SGA  
Sbjct: 82  RG--------NGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQLNNWQRLFSGALC 133

Query: 141 GIIGAIMGSPLFLIKTRMQ---------SYSNAIQIGQQTHYTSIWNGLSSIYRAE-GFK 190
           G    +   PL L++TR+          S S A  I +      +W  LS  Y  E G  
Sbjct: 134 GGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKP---PGVWKLLSKAYAEEGGIM 190

Query: 191 GLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHD----LMKEGTGLHLVASTVSGFGVG 246
           GLYRGV    L      ++   +Y   K F+   +     M++     L    +SG    
Sbjct: 191 GLYRGVWPTSLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSL-YKLSMGAISGGVAQ 249

Query: 247 VVMNPWDVILTRVY------NQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPH 300
            +  P+D++  R        N+ G  Y    D  V   + EG    YKG  A +F++ P 
Sbjct: 250 TITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPS 309

Query: 301 TILCLTFMEQT 311
           T +     E T
Sbjct: 310 TAVSWLVYELT 320

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 79.0 bits (193), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 74/296 (25%), Positives = 138/296 (46%), Gaps = 31/296 (10%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRI-YKNPMQALKVIFKNEGIRGLQK 87
           I+G +A  ++  V  P+++ KTR+Q QG  +   + + Y+  +  +  I ++EG+RGL K
Sbjct: 73  ISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRGLYK 132

Query: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGA----TSGII 143
           GL              +G++ P   +    +    D  +  +   + VS +    T+G +
Sbjct: 133 GLVPII----------MGYF-PTWMIYFSVYEFCKDNLRTNSSNWSFVSHSFSAITAGAV 181

Query: 144 GAIMGSPLFLIKTRMQSYSNAIQIGQQ-THYTSIWNGLSSIYRAEGFKGLYRGVDAAILR 202
             ++ +P++++KTR+   ++   IG   THY   ++    I   EG K LY G+  ++L 
Sbjct: 182 STVVTNPIWVVKTRLMLQTH---IGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPSLLG 238

Query: 203 TGAGSSVQLPIYNTAK--HFLLKHDLMKEGTGLHL----VASTVSGFGVGVVMNPWDVIL 256
                ++  P+Y   K      + D     + ++L    +AS+VS     V+  P +++ 
Sbjct: 239 L-LHVAIHFPVYERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILR 297

Query: 257 TRVYNQKGNL--YKGPLDCFVKTVRI-EGIGALYKGFEAQIFRIAPHTILCLTFME 309
           TR+   K +L  ++  L   +K   I EGI   Y GF   +FR  P + + L   E
Sbjct: 298 TRL-QLKSDLPSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFE 352

 Score = 65.5 bits (158), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 79/168 (47%), Gaps = 14/168 (8%)

Query: 132 VNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKG 191
           +N +SGA +G++  I+  PL + KTR+Q+     +  +  +Y      +++I R EG +G
Sbjct: 70  INAISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRG 129

Query: 192 LYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVG----V 247
           LY+G+   I+    G      IY +   F  K +L    +    V+ + S    G    V
Sbjct: 130 LYKGLVPIIM----GYFPTWMIYFSVYEF-CKDNLRTNSSNWSFVSHSFSAITAGAVSTV 184

Query: 248 VMNPWDVILTRVYNQ-----KGNLYKGPLDCFVKTVRIEGIGALYKGF 290
           V NP  V+ TR+  Q         Y+G  D F K +  EG+ ALY G 
Sbjct: 185 VTNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGL 232

 Score = 60.5 bits (145), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 93/209 (44%), Gaps = 19/209 (9%)

Query: 23  SKTGSFIAGGMAA----CIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFK 78
           S   SF++   +A     ++  VTNPI +VKTR+ LQ  + ++    Y+    A K I  
Sbjct: 163 SSNWSFVSHSFSAITAGAVSTVVTNPIWVVKTRLMLQTHIGSNTTH-YQGTYDAFKKIIN 221

Query: 79  NEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVN----V 134
            EG++ L  GL  + +   GL    + F  P+   L  +F             +N    +
Sbjct: 222 QEGVKALYAGLVPSLL---GLLHVAIHF--PVYERLKVSFKCYQRDESSNESKINLKRLI 276

Query: 135 VSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYR 194
           ++ + S ++ +++  P  +++TR+Q  S+       +H   +   +   Y  EG  G Y 
Sbjct: 277 LASSVSKMVASVLSYPHEILRTRLQLKSDL-----PSHQRRLIPLIKITYIQEGIFGFYS 331

Query: 195 GVDAAILRTGAGSSVQLPIYNTAKHFLLK 223
           G    + RT   S++ L  +   ++FL K
Sbjct: 332 GFGTNLFRTLPASAITLVSFEYVRNFLNK 360

>Kwal_23.3965
          Length = 307

 Score = 77.8 bits (190), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 77/308 (25%), Positives = 136/308 (44%), Gaps = 41/308 (13%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           S +AG ++   A  VT P++ +K R+QLQ  ++ +AQ  Y   +   K + + EG+R L 
Sbjct: 17  SLVAGCLSGISARIVTAPLDTLKIRLQLQ--LANEAQ--YGGILVTFKRLVRQEGVRALW 72

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146
           KG   A    I    ++   Y    ++LNK    +  P ++    V    GA SG   AI
Sbjct: 73  KGNVPAMAMYILYGSTQFTSY----AILNKLLSKSQLPAQIHTGMV----GALSGTCSAI 124

Query: 147 MGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAG 206
              P  +++TR  +             +++ +    I+R EGF+G ++GV ++I+     
Sbjct: 125 ASYPCDVLRTRFIA-------NHSRELSTMLSTAQEIWRHEGFRGFFKGVSSSIVSIAVA 177

Query: 207 SSVQLPIYNTAKHFLLKHDLMKEGTGLHLV---ASTVSGFGVGVVMNPWDVILTRV---- 259
           +S  L  Y + K F  +    ++ + + L+   AS ++G     ++ P D +  R     
Sbjct: 178 TSSILATYESVKIF-CEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVID 236

Query: 260 YNQKGN------LYKGP--------LDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCL 305
           + Q G+       YK          L   +  V  EG+ ALY G+   I +  P T++ L
Sbjct: 237 WQQLGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSL 296

Query: 306 TFMEQTMK 313
              E  ++
Sbjct: 297 GVYEWCLR 304

>Scas_667.4
          Length = 308

 Score = 77.8 bits (190), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 122/280 (43%), Gaps = 21/280 (7%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEM----SADAQRIYKNPMQALKVIFKNEGI 82
            F+ GG++A +A T  +PIE VK  +Q Q EM    S D++  YK  ++  +   K EGI
Sbjct: 16  DFLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDSK--YKGIIECFQRTAKTEGI 73

Query: 83  RGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGI 142
               +G +   I           F + I+++    F    +    +  A N+ SG  +G 
Sbjct: 74  IAFWRGNTANVIRYFPTQALNFAFKDKIKAM----FGFKKEEGYGKWFAGNLASGGAAGG 129

Query: 143 IGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILR 202
           +  +    L   +TR+ + + + + G    Y  + +        +G  GLYRG   +++ 
Sbjct: 130 LSLLFVYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMAGLYRGFLPSVVG 189

Query: 203 TGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGF----GVGVVMNPWDVILTR 258
                 +   +Y++ K  +L   L  EG+    +AS + G+    G      P D +  R
Sbjct: 190 IIVYRGLYFGLYDSLKPAVLTGSL--EGS---FLASFLLGWIVTTGASTASYPLDTVRRR 244

Query: 259 VYNQKGNL--YKGPLDCFVKTVRIEGIGALYKGFEAQIFR 296
           +    G    Y G  DCF K V  EG+ +L+KG  A I R
Sbjct: 245 MMMTSGQAVKYDGAFDCFRKVVAAEGVSSLFKGCGANILR 284

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 79/187 (42%), Gaps = 15/187 (8%)

Query: 25  TGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADA-QRIYKNPMQALKVIFKNEGIR 83
            G+  +GG A  +++     ++  +TR+    + S     R YK  +   K     +G+ 
Sbjct: 118 AGNLASGGAAGGLSLLFVYSLDYARTRLAADAKSSKKGGSRQYKGLIDVYKQTLATDGMA 177

Query: 84  GLQKGLSCAYIYQIGLNGSRLGFYEPIR-SVLNKTFYPAMDPHKVQNVAVNVVSGATSGI 142
           GL +G   + +  I   G   G Y+ ++ +VL  +   +     +  +   V +GA++  
Sbjct: 178 GLYRGFLPSVVGIIVYRGLYFGLYDSLKPAVLTGSLEGSFLASFL--LGWIVTTGASTA- 234

Query: 143 IGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILR 202
                  PL  ++ RM   S     GQ   Y   ++    +  AEG   L++G  A ILR
Sbjct: 235 -----SYPLDTVRRRMMMTS-----GQAVKYDGAFDCFRKVVAAEGVSSLFKGCGANILR 284

Query: 203 TGAGSSV 209
             AG+ V
Sbjct: 285 GVAGAGV 291

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 267 YKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYAVEKQ 321
           YKG ++CF +T + EGI A ++G  A + R  P   L   F ++ +K ++  +K+
Sbjct: 57  YKGIIECFQRTAKTEGIIAFWRGNTANVIRYFPTQALNFAFKDK-IKAMFGFKKE 110

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 77.4 bits (189), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 124/282 (43%), Gaps = 25/282 (8%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEM--SADAQRIYKNPMQALKVIFKNEGIRG 84
           +F+ GG++A IA T  +PIE VK  +Q Q EM       + Y   +   K   K EG+  
Sbjct: 15  NFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKRTAKQEGLIS 74

Query: 85  LQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIG 144
             +G +   I           F + I+ +    F    +    +  A N+ SG  +G + 
Sbjct: 75  FWRGNTANVIRYFPTQALNFAFKDKIKLM----FGFKKEEGYGKWFAGNLASGGAAGALS 130

Query: 145 AIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYR----AEGFKGLYRGVDAAI 200
            +    L   +TR+ + + + + G    +    NGL+ +Y+    ++G  GLYRG   ++
Sbjct: 131 LLFVYSLDFARTRLAADAKSSKKGGARQF----NGLTDVYKKTLKSDGIAGLYRGFMPSV 186

Query: 201 LRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGF----GVGVVMNPWDVIL 256
           +       +   ++++ K  +L   L  +G+    +AS + G+    G      P D + 
Sbjct: 187 VGIVVYRGLYFGMFDSLKPLVLTGSL--DGS---FLASFLLGWVVTTGASTCSYPLDTVR 241

Query: 257 TRVYNQKGNL--YKGPLDCFVKTVRIEGIGALYKGFEAQIFR 296
            R+    G    Y G +DC  K V  EG+G+L+KG  A I R
Sbjct: 242 RRMMMTSGQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILR 283

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 73/175 (41%), Gaps = 16/175 (9%)

Query: 129 NVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQ-QTHYTSIWNGLSSIYRAE 187
           N A+N + G  S  I     SP+  +K  +Q+    I+ G     Y+ I +      + E
Sbjct: 11  NFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKRTAKQE 70

Query: 188 GFKGLYRGVDAAILRTGAGSSVQLPIYNTAK-HFLLKHDLMKEGTGLHLVASTVSGFGVG 246
           G    +RG  A ++R     ++     +  K  F  K +   EG G     +  SG   G
Sbjct: 71  GLISFWRGNTANVIRYFPTQALNFAFKDKIKLMFGFKKE---EGYGKWFAGNLASGGAAG 127

Query: 247 VV----MNPWDVILTRV-----YNQKGNL--YKGPLDCFVKTVRIEGIGALYKGF 290
            +    +   D   TR+      ++KG    + G  D + KT++ +GI  LY+GF
Sbjct: 128 ALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGF 182

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 87/200 (43%), Gaps = 18/200 (9%)

Query: 26  GSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADA-QRIYKNPMQALKVIFKNEGIRG 84
           G+  +GG A  +++     ++  +TR+    + S     R +       K   K++GI G
Sbjct: 118 GNLASGGAAGALSLLFVYSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAG 177

Query: 85  LQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVN--VVSGATSGI 142
           L +G   + +  +   G   G ++ ++ ++      ++D   + +  +   V +GA++  
Sbjct: 178 LYRGFMPSVVGIVVYRGLYFGMFDSLKPLV---LTGSLDGSFLASFLLGWVVTTGAST-- 232

Query: 143 IGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILR 202
                  PL  ++ RM   S     GQ   Y    + L  I  +EG   L++G  A ILR
Sbjct: 233 ----CSYPLDTVRRRMMMTS-----GQAVKYNGAIDCLKKIVASEGVGSLFKGCGANILR 283

Query: 203 TGAGSSVQLPIYNTAKHFLL 222
           + AG+ V + +Y+  +  L 
Sbjct: 284 SVAGAGV-ISMYDQLQMILF 302

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 267 YKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYAVEKQ 321
           Y G +DCF +T + EG+ + ++G  A + R  P   L   F ++ +K+++  +K+
Sbjct: 56  YSGIVDCFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDK-IKLMFGFKKE 109

>Kwal_27.12481
          Length = 304

 Score = 76.6 bits (187), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 119/282 (42%), Gaps = 25/282 (8%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEM--SADAQRIYKNPMQALKVIFKNEGIRG 84
            F+ GG++A ++ T   PIE VK  +Q Q EM       R Y    +  K    NEGI  
Sbjct: 13  DFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIGECFKRTAANEGIAS 72

Query: 85  LQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIG 144
             +G +   I           F + I+++    F    +    +  A N+ SG  +G + 
Sbjct: 73  FWRGNTANVIRYFPTQALNFAFKDKIKAM----FGFKKEEGYAKWFAGNLASGGAAGGLS 128

Query: 145 AIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYR----AEGFKGLYRGVDAAI 200
            +    L   +TR+ + S   + G +  +    NGL  +Y+    ++G  GLYRG   ++
Sbjct: 129 LMFVYSLDYARTRLAADSKGAKKGGERQF----NGLVDVYKKTLASDGIAGLYRGFLPSV 184

Query: 201 LRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGF----GVGVVMNPWDVIL 256
           +       +    Y++ K  LL   L  EG+    +AS + G+    G      P D + 
Sbjct: 185 VGIVVYRGLYFGGYDSLKPLLLTGSL--EGS---FLASFLLGWAVTTGASTASYPLDTVR 239

Query: 257 TRVYNQKGNL--YKGPLDCFVKTVRIEGIGALYKGFEAQIFR 296
            R+    G    Y G  D F K V  EGI +L+KG  A I R
Sbjct: 240 RRMMMTSGQAVKYNGAFDAFRKIVAAEGIKSLFKGCGANILR 281

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 44/201 (21%), Positives = 88/201 (43%), Gaps = 18/201 (8%)

Query: 25  TGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADA-QRIYKNPMQALKVIFKNEGIR 83
            G+  +GG A  +++     ++  +TR+    + +    +R +   +   K    ++GI 
Sbjct: 115 AGNLASGGAAGGLSLMFVYSLDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIA 174

Query: 84  GLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVN--VVSGATSG 141
           GL +G   + +  +   G   G Y+ ++ +L      +++   + +  +   V +GA++ 
Sbjct: 175 GLYRGFLPSVVGIVVYRGLYFGGYDSLKPLL---LTGSLEGSFLASFLLGWAVTTGASTA 231

Query: 142 IIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAIL 201
                   PL  ++ RM   S     GQ   Y   ++    I  AEG K L++G  A IL
Sbjct: 232 SY------PLDTVRRRMMMTS-----GQAVKYNGAFDAFRKIVAAEGIKSLFKGCGANIL 280

Query: 202 RTGAGSSVQLPIYNTAKHFLL 222
           R  AG+ V + +Y+  +  L 
Sbjct: 281 RGVAGAGV-ISMYDQLQMILF 300

 Score = 34.7 bits (78), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 267 YKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYAVEKQ 321
           Y G  +CF +T   EGI + ++G  A + R  P   L   F ++ +K ++  +K+
Sbjct: 54  YTGIGECFKRTAANEGIASFWRGNTANVIRYFPTQALNFAFKDK-IKAMFGFKKE 107

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 77.0 bits (188), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 64/201 (31%), Positives = 101/201 (50%), Gaps = 19/201 (9%)

Query: 30  AGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRI---YKNPMQALKVIFKNEGIRGLQ 86
           AG +   I+  V  P E++KTR+QLQG  +    R    YKN   A+  I + EG   L 
Sbjct: 156 AGFLGDFISSFVYVPSEVLKTRLQLQGRYNNPFFRSGYNYKNLTDAVTTIVRREGWPTLF 215

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIR----SVLNKTFYPAMDPHKVQNVAVNVVSGATSGI 142
            G        +  +G +  FYE  R    +V NKTF   +      +++  +++GA +G 
Sbjct: 216 FGYKATLSRDLPFSGLQFAFYEKFRQLAFAVENKTFDEDL------SLSNEIITGAAAGG 269

Query: 143 IGAIMGSPLFLIKTRMQSY-----SNAIQ-IGQQTHYTSIWNGLSSIYRAEGFKGLYRGV 196
           +  I+ +PL ++KTR+Q+       N+ Q + QQT   SI  G+ ++Y+ EG  GL+ GV
Sbjct: 270 LAGIITTPLDVVKTRIQTQLPDIPENSSQNLKQQTLTNSITKGMMTVYKTEGLAGLFSGV 329

Query: 197 DAAILRTGAGSSVQLPIYNTA 217
               + T   SS+ L +Y  A
Sbjct: 330 GPRFIWTSIQSSIMLLLYQVA 350

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 102/230 (44%), Gaps = 29/230 (12%)

Query: 45  IELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRL 104
           ++ VKTR Q      A +   YKN + A + I   EG+R   KGL   Y      +G+ L
Sbjct: 76  LDTVKTRQQ-----GAPSTVKYKNMIGAYRTIILEEGLR---KGLYGGY------SGAML 121

Query: 105 GFYEPIRSVLNKTFYPAMDPHKVQNVAVN-VVSGATSGIIGAIMGS----PLFLIKTRMQ 159
           G + P  ++   T Y       +    +N   S  T+G +G  + S    P  ++KTR+Q
Sbjct: 122 GSF-PSAAIFFAT-YEYTKRKMIGEWGINETFSHLTAGFLGDFISSFVYVPSEVLKTRLQ 179

Query: 160 ---SYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNT 216
               Y+N        +Y ++ + +++I R EG+  L+ G  A + R    S +Q   Y  
Sbjct: 180 LQGRYNNPF-FRSGYNYKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPFSGLQFAFYEK 238

Query: 217 AKH--FLLKHDLMKEGTGL--HLVASTVSGFGVGVVMNPWDVILTRVYNQ 262
            +   F +++    E   L   ++    +G   G++  P DV+ TR+  Q
Sbjct: 239 FRQLAFAVENKTFDEDLSLSNEIITGAAAGGLAGIITTPLDVVKTRIQTQ 288

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 76.6 bits (187), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 132/309 (42%), Gaps = 38/309 (12%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG 81
           VS   + +AG ++  +A +VT P++ VK R QLQ      ++  Y   +   + + + EG
Sbjct: 22  VSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQLQ----LASEHKYHGILHTFRTVAREEG 77

Query: 82  IRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSG 141
           +R L KG   A    +     + G Y    + LN     A  P +  ++AV    GA +G
Sbjct: 78  VRALWKGNVPASAMYVLYGSLQFGTY----AWLNTAAASAGLPPQAHSLAV----GALAG 129

Query: 142 IIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAIL 201
           ++ +++  PL L++TR+ +  +A       H+ S+      I+  EG  G +RG   AI 
Sbjct: 130 LVSSLLTYPLDLLRTRLVANRSA-------HFFSLRRQARVIWDTEGPAGFFRGGAWAIA 182

Query: 202 RTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRV-- 259
            T   + +   IY T       + L      L   AS  +G      + P D +  R+  
Sbjct: 183 ATTLTTGLIFGIYETCTIAADTYGL----PWLAAAASPTAGLVSKAAVFPLDTVRRRLQI 238

Query: 260 --------YNQKGNLYKGP-----LDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLT 306
                   + +    Y        L   V  VR EGI +LYKG    + +  P T++ L 
Sbjct: 239 VDAKHIPFFTRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLW 298

Query: 307 FMEQTMKVV 315
             ++ ++++
Sbjct: 299 VYQRCLRLL 307

>Kwal_47.18216
          Length = 333

 Score = 75.5 bits (184), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 97/226 (42%), Gaps = 44/226 (19%)

Query: 22  VSKTGSFIAG-GMAACIAVTVTNPIELVKTRMQ--------LQGEMSAD----------- 61
           VS   +F+AG G     AV V NP+E+VK R+Q        L+ +++             
Sbjct: 107 VSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSA 166

Query: 62  --------AQRIYKNPMQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSV 113
                   A   Y+N +QA  VI K EG R L +G+S     Q    G+    Y  ++S 
Sbjct: 167 TTATENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSR 226

Query: 114 LNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHY 173
           L +     M P    ++      G  SG +G    +PL  IKTR+Q         + T  
Sbjct: 227 LQEYHQTDMLPSWETSLI-----GLISGALGPFSNAPLDTIKTRLQK-------DKSTSK 274

Query: 174 TSIWNGLSSI----YRAEGFKGLYRGVDAAILRTGAGSSVQLPIYN 215
            S W+ + +I     R EGF+ LY+G+   ++R   G +V   +Y 
Sbjct: 275 DSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVTFTVYE 320

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 75/319 (23%), Positives = 121/319 (37%), Gaps = 47/319 (14%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           + +AGG A        +P++ +K RMQ+        QR  +  +   + I   EG   L 
Sbjct: 13  NLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRA-RGFIGTARDISTQEGFLALY 71

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146
           KGL    I  I     R   YE  R++L      A     V +     V+G  +GI  A+
Sbjct: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLL------ADRQTGVVSTGNTFVAGVGAGITEAV 125

Query: 147 MG-SPLFLIKTRMQS--------------------------YSNAIQIGQQTHYTSIWNG 179
           M  +P+ ++K R+Q+                           +    +     Y +    
Sbjct: 126 MVVNPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNAIQA 185

Query: 180 LSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKH---DLMK--EGTGLH 234
              I + EG + LYRGV     R          +Y+T K  L ++   D++   E + + 
Sbjct: 186 AYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPSWETSLIG 245

Query: 235 LVASTVSGFGVGVVMNPWDVILTRVYNQKGNL----YKGPLDCFVKTVRIEGIGALYKGF 290
           L++  +  F       P D I TR+   K       +   L    + +R EG  ALYKG 
Sbjct: 246 LISGALGPFSNA----PLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGI 301

Query: 291 EAQIFRIAPHTILCLTFME 309
             ++ R+AP   +  T  E
Sbjct: 302 TPRVMRVAPGQAVTFTVYE 320

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 69/138 (50%), Gaps = 13/138 (9%)

Query: 131 AVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFK 190
           A+N+V+G T+G+  A+   PL  IK RMQ YS A + GQ+            I   EGF 
Sbjct: 11  AINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRAR--GFIGTARDISTQEGFL 68

Query: 191 GLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVAST-VSGFGVGV-- 247
            LY+G+ A ++    G   ++ I  T+  F  +  L    TG+    +T V+G G G+  
Sbjct: 69  ALYKGLGAVVI----GIIPKMAIRFTSYEF-FRTLLADRQTGVVSTGNTFVAGVGAGITE 123

Query: 248 ---VMNPWDVILTRVYNQ 262
              V+NP +V+  R+  Q
Sbjct: 124 AVMVVNPMEVVKIRLQAQ 141

>Kwal_23.4731
          Length = 314

 Score = 75.1 bits (183), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 81/305 (26%), Positives = 144/305 (47%), Gaps = 44/305 (14%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQL--QGEMSADAQRIYKNPMQALKV---IFKNEGIR 83
           IAG  A  +    T+P++LVK R+QL      S   + + K  ++  K    +F+ E  R
Sbjct: 18  IAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVIKTIIRDSKADSNVFR-EAYR 76

Query: 84  GLQKGL---SCAYIYQIGLNG------SRLGFYE---PIRSVLNKTFYPAMDPHKVQNVA 131
           GL   L   S A+    GL         R G  +   P +S   K    AM P      +
Sbjct: 77  GLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKD--KAMGP------S 128

Query: 132 VNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKG 191
           + + S A SG+  AI+ +P+++IKTR+ S S+         Y + W+G+  +Y  EGF G
Sbjct: 129 LYLASAALSGLGTAILTNPIWVIKTRIMSTSSQ----ASERYKTTWDGIRKVYAHEGFSG 184

Query: 192 LYRGVDAAILRTGAGSSVQLPIYNTAKH-FLLKHDLMKE---GTGLHLVASTVSGFGVGV 247
            +RG+  ++     G ++   IY++ +H +  +  + ++   G   ++  ++VS      
Sbjct: 185 FWRGLVPSLFGVAQG-AIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSVSKMLSVT 243

Query: 248 VMNPWDVILTRVYN----QKGNLYKGPLDCFVKTV-RIEGIGALYKGFEAQIFRIAPHTI 302
            + P+ ++ + + +    +K + Y+      VK++ + EG+  LYKG  A + R  P T 
Sbjct: 244 AVYPFQLLKSNLQSFAAVEKRDSYR--FWNLVKSIHQKEGLQGLYKGLSANLLRAIPST- 300

Query: 303 LCLTF 307
            C+TF
Sbjct: 301 -CITF 304

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 90/183 (49%), Gaps = 14/183 (7%)

Query: 41  VTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGLSCAYIYQIGLN 100
           +TNPI ++KTR+      S+ A   YK     ++ ++ +EG  G  +GL  + ++ +   
Sbjct: 144 LTNPIWVIKTRIM---STSSQASERYKTTWDGIRKVYAHEGFSGFWRGLVPS-LFGVAQG 199

Query: 101 GSRLGFYEPIRS--VLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRM 158
                 Y+ +R      +          ++N+A+  VS   S  + A+   P  L+K+ +
Sbjct: 200 AIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSVSKMLS--VTAVY--PFQLLKSNL 255

Query: 159 QSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAK 218
           QS++    + ++  Y   WN + SI++ EG +GLY+G+ A +LR    + +   IY   +
Sbjct: 256 QSFA---AVEKRDSY-RFWNLVKSIHQKEGLQGLYKGLSANLLRAIPSTCITFCIYENLR 311

Query: 219 HFL 221
           H+L
Sbjct: 312 HWL 314

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 76/188 (40%), Gaps = 28/188 (14%)

Query: 133 NVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYR-----AE 187
            +++G  +G +  I   PL L+K R+Q   N       TH       + +I R     + 
Sbjct: 16  EIIAGLAAGTLTTIATHPLDLVKLRLQLLVNT------THSHGYKEVIKTIIRDSKADSN 69

Query: 188 GFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDL--MKE------------GTGL 233
            F+  YRG+   ++       +   +Y   K  + ++ +  MK             G  L
Sbjct: 70  VFREAYRGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSL 129

Query: 234 HLVASTVSGFGVGVVMNPWDVILTRVY---NQKGNLYKGPLDCFVKTVRIEGIGALYKGF 290
           +L ++ +SG G  ++ NP  VI TR+    +Q    YK   D   K    EG    ++G 
Sbjct: 130 YLASAALSGLGTAILTNPIWVIKTRIMSTSSQASERYKTTWDGIRKVYAHEGFSGFWRGL 189

Query: 291 EAQIFRIA 298
              +F +A
Sbjct: 190 VPSLFGVA 197

>Kwal_14.2210
          Length = 315

 Score = 75.1 bits (183), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 73/299 (24%), Positives = 126/299 (42%), Gaps = 28/299 (9%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           +F AGG+A  ++ TV +P E VK  +Q+Q    A    +++    A+K ++  EG+ GL 
Sbjct: 20  AFCAGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNHGLFR----AVKQVYLEEGVPGLL 75

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSV---LNKTFYPAMDPHKVQNVAVNVVSGATSGII 143
           +G         GLN  R+  Y  ++ +     K  +   +P  V      +VSGA  G  
Sbjct: 76  RG--------NGLNCIRIFPYSAVQFLVYEFCKKQWFQQNPDTVVLNWHRLVSGALCGGC 127

Query: 144 GAIMGSPLFLIKTRMQ-SYSNAIQIGQQTHYTS-----IWNGLSSIYRAEG-FKGLYRGV 196
             +   PL L++TR+    +N  ++ +    ++     +W  L   Y  EG   GLYRGV
Sbjct: 128 SVLATYPLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGV 187

Query: 197 DAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVIL 256
               +      ++   +Y   + ++         +   L    +SG     +  P+D++ 
Sbjct: 188 WPTSIGVVPYVALNFAVYEQLREYIPASFDPASASLYKLSIGAISGGVAQTITYPFDLLR 247

Query: 257 TRVY------NQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFME 309
            R        ++ G  YK   D  +   R EG    YKG  A +F++ P T +     E
Sbjct: 248 RRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKVVPSTAVSWVVYE 306

 Score = 66.6 bits (161), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 97/208 (46%), Gaps = 27/208 (12%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNP----------MQALKVIF 77
            ++G +    +V  T P++LV+TR+ +Q   +A+  R++K             + L+  +
Sbjct: 118 LVSGALCGGCSVLATYPLDLVRTRLSIQ---TANLARLHKAKAASAAKPPGVWELLRKTY 174

Query: 78  KNEG-IRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVS 136
             EG I GL +G+    I  +         YE +R  +  +F    DP       +++  
Sbjct: 175 TQEGGIFGLYRGVWPTSIGVVPYVALNFAVYEQLREYIPASF----DPASASLYKLSI-- 228

Query: 137 GATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQT---HYTSIWNGLSSIYRAEGFKGLY 193
           GA SG +   +  P  L++ R Q     + +GQ     HY S+ + L +I R EGFKG Y
Sbjct: 229 GAISGGVAQTITYPFDLLRRRFQ----VLAMGQSELGFHYKSVPDALITIGRTEGFKGYY 284

Query: 194 RGVDAAILRTGAGSSVQLPIYNTAKHFL 221
           +G+ A + +    ++V   +Y T + ++
Sbjct: 285 KGLTANLFKVVPSTAVSWVVYETVRDYM 312

>Kwal_27.12081
          Length = 369

 Score = 75.5 bits (184), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 78/327 (23%), Positives = 138/327 (42%), Gaps = 49/327 (14%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQ--------------RIYKNPMQAL 73
           F+AGG        VT P ++VKTR+Q     S  A               R ++     +
Sbjct: 56  FVAGGAGGMAGAIVTCPFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGII 115

Query: 74  KVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVN 133
             ++K EG R L KGL    +  I         Y   + + ++ F    +        ++
Sbjct: 116 SNLYKLEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKQIYSRAFNNGEEA-----PWIH 170

Query: 134 VVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLY 193
           ++S AT+G   +   +P++LIKTR+Q      + G    Y + W+ L  I + EGF GLY
Sbjct: 171 LISAATAGWATSTATNPIWLIKTRLQ----LDKAGHTRQYKNSWDCLKHIIQKEGFFGLY 226

Query: 194 RGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLV----------------- 236
           +G+ A+ L +  G  +Q  +Y   K  +    + K G   H+                  
Sbjct: 227 KGLSASYLGSVEG-ILQWLLYEQMKQMIKMRSIEKFG---HISEGEKNTSEKIKEWCQRS 282

Query: 237 -ASTVSGFGVGVVMNPWDVILTRVYN---QKGNL-YKGPLDCFVKTVRIEGIGALYKGFE 291
            ++ ++ F   +V  P +V+ TR+     +   L Y G +  F   ++ EG+ ++Y G  
Sbjct: 283 GSAGLAKFLASIVTYPHEVVRTRLRQAPLENDKLKYTGLIQSFRVIIKEEGLASMYGGLT 342

Query: 292 AQIFRIAPHTILCLTFMEQTMKVVYAV 318
             + R  P++I+     E  +K++  V
Sbjct: 343 PHLLRTVPNSIIMFGTWELVIKLLSDV 369

 Score = 65.9 bits (159), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 97/213 (45%), Gaps = 25/213 (11%)

Query: 104 LGFYEPIRSVLNKTFYPAMDPHKVQNVA------VNVVSGATSGIIGAIMGSPLFLIKTR 157
           LG  E   ++ N  F P     +V +V+      V+ V+G   G+ GAI+  P  ++KTR
Sbjct: 20  LGSDEDASNLKNPRFTPRKGSKQVSSVSAEVKPWVHFVAGGAGGMAGAIVTCPFDVVKTR 79

Query: 158 MQS--------------YSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRT 203
           +QS               SN +  G + H+   +  +S++Y+ EGF+ L++G+   ++  
Sbjct: 80  LQSDVFQSTYANLSHNKSSNVVSSGIR-HFRETFGIISNLYKLEGFRSLFKGLGPNLVGV 138

Query: 204 GAGSSVQLPIYNTAKHFLLK-HDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQ 262
               S+    Y T K    +  +  +E   +HL+++  +G+      NP  +I TR+   
Sbjct: 139 IPARSINFFTYGTTKQIYSRAFNNGEEAPWIHLISAATAGWATSTATNPIWLIKTRLQLD 198

Query: 263 KG---NLYKGPLDCFVKTVRIEGIGALYKGFEA 292
           K      YK   DC    ++ EG   LYKG  A
Sbjct: 199 KAGHTRQYKNSWDCLKHIIQKEGFFGLYKGLSA 231

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 74.7 bits (182), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 63/275 (22%), Positives = 118/275 (42%), Gaps = 26/275 (9%)

Query: 31  GGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGI-RGLQKGL 89
           G +A  I   +  P + VK R+Q Q         +Y      ++  + +EGI +G  +G+
Sbjct: 14  GSVAGAIGKVIEYPFDTVKVRLQTQ------PAHLYPTTWSCIRSTYTDEGIWKGFYQGI 67

Query: 90  SCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGS 149
           +         N      +    + L++  +  + P     +   + SGA +G   + + +
Sbjct: 68  ASPLFGAALENAVLFVSFNQCTNFLDE--FTQLKP-----LTKTIYSGAFAGACASFILT 120

Query: 150 PLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSV 209
           P+ L+K ++Q  + +  + Q T +TS+W  + S+ + +G  GL++G  +  +R   G +V
Sbjct: 121 PVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGGAV 180

Query: 210 QLPIYNTAK-HFLLKHDLMKEGTGLHLVASTVSGFGVGVVMN----PWDVILTRVYNQKG 264
               Y   K  F   H   KE     L+   VSG   GV+ N    P D + +    +  
Sbjct: 181 WFTTYEIMKMKFASLHPAEKENHTWELL---VSGASAGVLFNASVFPADTVKSVCQTEHV 237

Query: 265 NLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAP 299
           ++    ++   K +R  GI   Y+G    + R AP
Sbjct: 238 SI----VNALKKVLRTHGITGFYRGLGITLIRAAP 268

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 86/196 (43%), Gaps = 18/196 (9%)

Query: 25  TGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRI-YKNPMQALKVIFKNEGIR 83
           T +  +G  A   A  +  P+ELVK ++Q+    ++ +Q   + +    +K + K +G+ 
Sbjct: 102 TKTIYSGAFAGACASFILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLL 161

Query: 84  GLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNV-VSGATSGI 142
           GL +G    ++ +          YE     + K  + ++ P + +N    + VSGA++G+
Sbjct: 162 GLWQGQLSTFVRECLGGAVWFTTYE-----IMKMKFASLHPAEKENHTWELLVSGASAGV 216

Query: 143 IGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILR 202
           +      P           ++ ++   QT + SI N L  + R  G  G YRG+   ++R
Sbjct: 217 LFNASVFP-----------ADTVKSVCQTEHVSIVNALKKVLRTHGITGFYRGLGITLIR 265

Query: 203 TGAGSSVQLPIYNTAK 218
               ++     Y T K
Sbjct: 266 AAPANATVFYTYETLK 281

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 72.8 bits (177), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 82/334 (24%), Positives = 144/334 (43%), Gaps = 61/334 (18%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKV------------ 75
           F+AGG+       VT P +LVKTR+Q     S   Q +YK+  +AL +            
Sbjct: 60  FLAGGIGGMAGAVVTCPFDLVKTRLQ-----SDIYQNMYKSQAEALMMNTTRPRIVNLTL 114

Query: 76  ---------------IFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYP 120
                          +++ EG R L KGL    +  I         Y   + + +K F  
Sbjct: 115 QAATHFKETVSIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDIYSKAFNN 174

Query: 121 AMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGL 180
             +        +++++ AT+G   A   +P++++KTR+Q      + G+   Y + ++ L
Sbjct: 175 GQEAP-----WIHLMAAATAGWATATATNPIWMVKTRVQ----LDKAGKTRTYKNSYDCL 225

Query: 181 SSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVAST- 239
            SI R EG  GLYRG+ A+ L +  G  +Q  +Y   KH + K  + K G       +T 
Sbjct: 226 KSILRNEGIYGLYRGLSASYLGSVEG-ILQWLLYEQLKHLIKKRSIEKFGAHDESTMTTT 284

Query: 240 --------------VSGFGVGVVMNPWDVILTRVYN---QKGNL-YKGPLDCFVKTVRIE 281
                         ++ F   +V  P +V+ TR+     + G + Y G +  F   ++ E
Sbjct: 285 DKIKQWCQRSGGAGLAKFMASIVTYPHEVVRTRLRQSPLENGKVKYTGLVQSFRVIIKEE 344

Query: 282 GIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVV 315
           G+ ++Y G    + R  P++I+     E  +K++
Sbjct: 345 GLASMYSGLTPHLMRTVPNSIIMFGTWEVVIKLL 378

 Score = 60.1 bits (144), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 56/210 (26%), Positives = 94/210 (44%), Gaps = 25/210 (11%)

Query: 108 EPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQS--YSNA- 164
           +P+    +K   P ++ HK     V+ ++G   G+ GA++  P  L+KTR+QS  Y N  
Sbjct: 34  QPVILEDSKIVQPKLEVHKTVKPWVHFLAGGIGGMAGAVVTCPFDLVKTRLQSDIYQNMY 93

Query: 165 ------------------IQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAG 206
                             + +   TH+    + + ++YR EGF+ L++G+   ++     
Sbjct: 94  KSQAEALMMNTTRPRIVNLTLQAATHFKETVSIIGNVYRQEGFRSLFKGLGPNLVGVIPA 153

Query: 207 SSVQLPIYNTAKHFLLK-HDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQKG- 264
            S+    Y T K    K  +  +E   +HL+A+  +G+      NP  ++ TRV   K  
Sbjct: 154 RSINFFTYGTTKDIYSKAFNNGQEAPWIHLMAAATAGWATATATNPIWMVKTRVQLDKAG 213

Query: 265 --NLYKGPLDCFVKTVRIEGIGALYKGFEA 292
               YK   DC    +R EGI  LY+G  A
Sbjct: 214 KTRTYKNSYDCLKSILRNEGIYGLYRGLSA 243

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 72.4 bits (176), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 107/247 (43%), Gaps = 28/247 (11%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGI-RGLQ 86
           F+AGG+   I  +  + ++ VKTR Q      A     YK+ +QA + +F  EG  RGL 
Sbjct: 57  FLAGGVGGIIGDSAMHSLDTVKTRQQ-----GAPNVHKYKHMLQAYRTMFIEEGFRRGLY 111

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146
            G   A +            YE  +  +       ++ + + +   ++ +G       + 
Sbjct: 112 GGYCAAMLGSFPSAAIFFSTYEFTKRTM-------INDYHLNDTFSHLTAGFLGDFFSSF 164

Query: 147 MGSPLFLIKTRMQ---SYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRT 203
           +  P  ++KTR+Q    Y+N        +Y S+ N +++IYR EG   L+ G  A + R 
Sbjct: 165 VYVPSEVLKTRLQLQGCYNNP-HFNSGYNYKSLRNAIATIYRTEGVAALFFGYKATLARD 223

Query: 204 GAGSSVQLPIYNTAKH--FLL------KHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVI 255
              S++Q   Y   +   FLL      KHDL        +V    +G   G++  P DV+
Sbjct: 224 LPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISN---EIVTGACAGGLAGILTTPLDVV 280

Query: 256 LTRVYNQ 262
            TRV  Q
Sbjct: 281 KTRVQTQ 287

 Score = 59.3 bits (142), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 85/195 (43%), Gaps = 17/195 (8%)

Query: 135 VSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFK-GLY 193
           ++G   GIIG      L  +KTR Q   N  +      Y  +     +++  EGF+ GLY
Sbjct: 58  LAGGVGGIIGDSAMHSLDTVKTRQQGAPNVHK------YKHMLQAYRTMFIEEGFRRGLY 111

Query: 194 RGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWD 253
            G  AA+L +   +++    Y   K  ++ +D     T  HL A  +  F    V  P +
Sbjct: 112 GGYCAAMLGSFPSAAIFFSTYEFTKRTMI-NDYHLNDTFSHLTAGFLGDFFSSFVYVPSE 170

Query: 254 VILTRV-----YNQ----KGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILC 304
           V+ TR+     YN      G  YK   +      R EG+ AL+ G++A + R  P + L 
Sbjct: 171 VLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKATLARDLPFSALQ 230

Query: 305 LTFMEQTMKVVYAVE 319
             F E+  +  + +E
Sbjct: 231 FAFYEKFRQWAFLLE 245

 Score = 57.0 bits (136), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 57/206 (27%), Positives = 96/206 (46%), Gaps = 23/206 (11%)

Query: 30  AGGMAACIAVTVTNPIELVKTRMQLQG---EMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           AG +    +  V  P E++KTR+QLQG       ++   YK+   A+  I++ EG+  L 
Sbjct: 154 AGFLGDFFSSFVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALF 213

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRS----VLNKTFYPAMDPHKVQNVAVNVVSGATSGI 142
            G        +  +  +  FYE  R     +  K  Y     H + +++  +V+GA +G 
Sbjct: 214 FGYKATLARDLPFSALQFAFYEKFRQWAFLLEGKDIYK----HDL-SISNEIVTGACAGG 268

Query: 143 IGAIMGSPLFLIKTRMQS-YSNAIQIGQQTHY----------TSIWNGLSSIYRAEGFKG 191
           +  I+ +PL ++KTR+Q+   + I I   T             SI+  L ++Y +EGF G
Sbjct: 269 LAGILTTPLDVVKTRVQTQLPSQIDISTDTKIKNVSKPVTLTNSIFKSLRTVYTSEGFFG 328

Query: 192 LYRGVDAAILRTGAGSSVQLPIYNTA 217
            + GV    + T   SS+ L +Y  A
Sbjct: 329 FFSGVGPRFVWTSVQSSIMLLLYQMA 354

 Score = 28.5 bits (62), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 5/63 (7%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQG----EMSADAQ-RIYKNPMQALKVI 76
           +S +   + G  A  +A  +T P+++VKTR+Q Q     ++S D + +    P+     I
Sbjct: 254 LSISNEIVTGACAGGLAGILTTPLDVVKTRVQTQLPSQIDISTDTKIKNVSKPVTLTNSI 313

Query: 77  FKN 79
           FK+
Sbjct: 314 FKS 316

>Scas_716.29
          Length = 316

 Score = 71.6 bits (174), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 73/311 (23%), Positives = 138/311 (44%), Gaps = 43/311 (13%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNE-GIRGL 85
           S +AG ++  +A TV  P++ +K R+QL+   +  A       ++ +K +  NE G+R  
Sbjct: 25  SLVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAP---SGLLKMMKGMILNEGGLRSF 81

Query: 86  QKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPH-KVQNVAVNVVSGATSGIIG 144
            KG     +  +   G++   Y    S  N  F    D + ++Q++ V    GA +G+  
Sbjct: 82  WKGNVPGTMMYVLYGGAQFSSY----SFYNNLFGETSDMNGQLQSLVV----GALAGMTS 133

Query: 145 AIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTG 204
           + +  P  +++TR  +        Q    +S+ +G   I+  EG  G +RG  A++    
Sbjct: 134 SFVSYPTDVLRTRFIA-------NQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTIT 186

Query: 205 AGSSVQLPIYNTAKHFLLKHDLMKEGTG-LHLVASTVSGFGVGVVMNPWDVILTRV---- 259
             +S+    Y + K +  ++    + T  L   AS++SG    +V  P D I  R+    
Sbjct: 187 LSASILFGTYESIKIYCDEYSKESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQVRN 246

Query: 260 -----YNQKGNL-------YKGPLDCFVKT----VRIEGIGALYKGFEAQIFRIAPHTIL 303
                +N +  +       YKG    F++     +R EG+ +LY+G    + +  P T++
Sbjct: 247 SVYVQHNVENKIVTEIYQSYKGA--SFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTVV 304

Query: 304 CLTFMEQTMKV 314
            L   E  M++
Sbjct: 305 SLWAYETVMRL 315

>Scas_691.4
          Length = 334

 Score = 70.9 bits (172), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 59/214 (27%), Positives = 93/214 (43%), Gaps = 28/214 (13%)

Query: 27  SFIAG-GMAACIAVTVTNPIELVKTRMQLQ---------------GEMSADAQRIYKNPM 70
           +F+AG G     AV V NP+E+VK R+Q Q               G  +   +  Y N +
Sbjct: 113 TFLAGVGAGITEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAI 172

Query: 71  QALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNV 130
            A   I K EG   L +G+S     Q    G+    Y  ++  L K       P   +  
Sbjct: 173 HAAYTIVKEEGAGALYRGVSLTAARQATNQGANFTVYSYLKDYLQKYHNRESLP-SWETS 231

Query: 131 AVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFK 190
            + ++SGA    IG    +PL  IKTR+Q   +   I   + +  I+   + + + EGF+
Sbjct: 232 CIGLISGA----IGPFSNAPLDTIKTRLQKDKS---ISSNSAWKKIYIIGTQLIKEEGFR 284

Query: 191 GLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKH 224
            LY+G+   ++R   G +V   +Y     F+ KH
Sbjct: 285 ALYKGITPRVMRVAPGQAVTFTVY----EFVRKH 314

 Score = 63.9 bits (154), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 69/307 (22%), Positives = 119/307 (38%), Gaps = 37/307 (12%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           + +AGG A        +P++ +K RMQ+           +   +   + I+ +EG   L 
Sbjct: 16  NLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPHGF---ITTGRNIYSHEGFLALY 72

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146
           KGL    I  I     R   YE  R+ L           +        ++G  +GI  A+
Sbjct: 73  KGLGAVVIGIIPKMAIRFSSYEFYRNALTD------KETRTITTGNTFLAGVGAGITEAV 126

Query: 147 MG-SPLFLIKTRMQSYSNAIQIGQ--------------QTHYTSIWNGLSSIYRAEGFKG 191
           +  +P+ ++K R+Q+      I Q              +  Y +  +   +I + EG   
Sbjct: 127 LVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEGAGA 186

Query: 192 LYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMK-----EGTGLHLVASTVSGFGVG 246
           LYRGV     R          +Y+  K +L K+   +     E + + L++  +  F   
Sbjct: 187 LYRGVSLTAARQATNQGANFTVYSYLKDYLQKYHNRESLPSWETSCIGLISGAIGPFSNA 246

Query: 247 VVMNPWDVILTRVYNQKG----NLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTI 302
               P D I TR+   K     + +K       + ++ EG  ALYKG   ++ R+AP   
Sbjct: 247 ----PLDTIKTRLQKDKSISSNSAWKKIYIIGTQLIKEEGFRALYKGITPRVMRVAPGQA 302

Query: 303 LCLTFME 309
           +  T  E
Sbjct: 303 VTFTVYE 309

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 80/193 (41%), Gaps = 27/193 (13%)

Query: 120 PAMDPH-KVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWN 178
           P  +P+ K  +  +N+V+G T+G+  A+   PL  IK RMQ       +      T+  N
Sbjct: 2   PQKNPNDKKSSPLINLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRPHGFITTGRN 61

Query: 179 GLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVAS 238
               IY  EGF  LY+G+ A ++      +++   Y   ++ L   +     TG   +A 
Sbjct: 62  ----IYSHEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRNALTDKETRTITTGNTFLAG 117

Query: 239 TVSGFGVGV-VMNPWDVILTRVYNQKGN---------------------LYKGPLDCFVK 276
             +G    V V+NP +V+  R+  Q  N                      Y   +     
Sbjct: 118 VGAGITEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYT 177

Query: 277 TVRIEGIGALYKG 289
            V+ EG GALY+G
Sbjct: 178 IVKEEGAGALYRG 190

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 72/312 (23%), Positives = 125/312 (40%), Gaps = 42/312 (13%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG 81
           VS T S +AG ++   A T   P++ VK ++Q+           +      L  I K EG
Sbjct: 13  VSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTP---------HNKNANVLINILKREG 63

Query: 82  IRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSG 141
           IRG  KG     I  I   G++ G Y  I S L       + P        + + G+ +G
Sbjct: 64  IRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDLNISPQ-----LYSCLVGSLAG 118

Query: 142 IIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAIL 201
           +  ++   P  +++TR  + S    I  +    +IW+        EG  G + G  ++++
Sbjct: 119 MTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWS-------HEGLMGFFSGCGSSMI 171

Query: 202 RTGAGSSVQLPIYNTAKHFLLKH----DLMKEGTGLHLVASTVSGFGVGVVMNPWDVILT 257
             G  +++   +Y + K F  +     D     T L+ +A  +SGF   +   P D +  
Sbjct: 172 NIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFTSKLATFPLDTVRR 231

Query: 258 RVYNQKG------------NLYKGP-----LDCFVKTVRIEGIGALYKGFEAQIFRIAPH 300
           R+  +              ++YK       L   +  V+ EG  +LY+G    + +  P 
Sbjct: 232 RIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGVTMSLIKSVPS 291

Query: 301 TILCLTFMEQTM 312
           T + L   E  M
Sbjct: 292 TAISLWSYELFM 303

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score = 69.3 bits (168), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 69/288 (23%), Positives = 118/288 (40%), Gaps = 33/288 (11%)

Query: 23  SKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGI 82
           S+   F+AG  +      V +P + +K R+Q     ++  +  +K P+  +   F+N+GI
Sbjct: 22  SRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQ-----TSQNETRFKGPLDCVYKTFRNQGI 76

Query: 83  RGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGI 142
           RG   G +   +  I ++   LG     R +++K  YP  +   +      ++SG  +G 
Sbjct: 77  RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGC---IISGVLAGW 133

Query: 143 IGAIMGSPLFLIKTRMQSYSNAIQIGQ-QTHYTSIWNGLSSIYRAEGFKGLYRG-VDAAI 200
             + +  P+ L K ++Q     +Q  +  T Y    + +  IY A+G +GLY+G +   I
Sbjct: 134 SVSFIAPPIELAKAKLQ-----VQYDKTTTRYKGPLDVIKKIYSAQGIRGLYKGLISTLI 188

Query: 201 LRT----GAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVIL 256
            RT      GS      Y     +  ++  M E           + FG      P DV+ 
Sbjct: 189 FRTHFVYWWGS------YELLTRWFRENTKMSEAAINFWAGGFSASFGFWTTAYPSDVVK 242

Query: 257 TRVY-NQKGNLYKGPLDCFVKTVR----IEGIGALYKGFEAQIFRIAP 299
             V  N K   Y G    +   V+     +GI   +KGF     R  P
Sbjct: 243 QVVLCNDK---YDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFP 287

>Scas_669.6
          Length = 373

 Score = 69.3 bits (168), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 98/205 (47%), Gaps = 21/205 (10%)

Query: 30  AGGMAACIAVTVTNPIELVKTRMQLQGEMSA---DAQRIYKNPMQALKVIFKNEGIRGLQ 86
           AG +   ++  V  P E++KTR+QLQG ++     +   Y++   A+++I   EG++ L 
Sbjct: 152 AGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFFQSGYNYRSLRTAIRIIVNTEGVKALF 211

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146
            G        +  +  + GFYE  R    K     +  H + ++   + +GA +G +  I
Sbjct: 212 FGYKATLARDLPFSALQFGFYEKFRQTAFKLEKKDITKHNL-SIPNEIFTGAIAGGLAGI 270

Query: 147 MGSPLFLIKTRMQSY------SNAIQIGQQTHYT-----------SIWNGLSSIYRAEGF 189
           + +P+ +IKTR+Q+       ++A  +G  +  T           SI+  L  +Y++EG 
Sbjct: 271 ITTPMDVIKTRLQTQQADINPNSATTVGAISAKTNKKSRPIVLSNSIFRSLKLVYQSEGV 330

Query: 190 KGLYRGVDAAILRTGAGSSVQLPIY 214
            G + GV    + T   SS+ L +Y
Sbjct: 331 IGFFSGVGPRFVWTSVQSSIMLLLY 355

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/235 (25%), Positives = 98/235 (41%), Gaps = 30/235 (12%)

Query: 45  IELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGI-RGLQKGLSCAYIYQIGLNGSR 103
           ++ VKTR Q      A     YKN   A + IF  EGI RGL  G   A +         
Sbjct: 72  LDTVKTRQQ-----GAPMTPKYKNMTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAIF 126

Query: 104 LGFYEPIRSVLNKTFYPAMDPHKVQNVAVN-VVSGATSGIIGAIMGS----PLFLIKTRM 158
            G YE  +  +            + ++  N  VS  ++G++G  + S    P  ++KTR+
Sbjct: 127 FGTYEWCKRKM------------IGDLGFNDTVSHLSAGLLGDFVSSFVYVPSEVLKTRL 174

Query: 159 QSYSNAIQIGQQT--HYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNT 216
           Q          Q+  +Y S+   +  I   EG K L+ G  A + R    S++Q   Y  
Sbjct: 175 QLQGRVNNPFFQSGYNYRSLRTAIRIIVNTEGVKALFFGYKATLARDLPFSALQFGFYEK 234

Query: 217 AKHF---LLKHDLMKEGTGL--HLVASTVSGFGVGVVMNPWDVILTRVYNQKGNL 266
            +     L K D+ K    +   +    ++G   G++  P DVI TR+  Q+ ++
Sbjct: 235 FRQTAFKLEKKDITKHNLSIPNEIFTGAIAGGLAGIITTPMDVIKTRLQTQQADI 289

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 71/159 (44%), Gaps = 11/159 (6%)

Query: 173 YTSIWNGLSSIYRAEGF-KGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGT 231
           Y ++     +I+  EG  +GLY G  AA+L +   +++    Y   K  ++  DL    T
Sbjct: 88  YKNMTTAYRTIFLEEGIARGLYGGYFAAMLGSFPSAAIFFGTYEWCKRKMIG-DLGFNDT 146

Query: 232 GLHLVASTVSGFGVGVVMNPWDVILTRV---------YNQKGNLYKGPLDCFVKTVRIEG 282
             HL A  +  F    V  P +V+ TR+         + Q G  Y+         V  EG
Sbjct: 147 VSHLSAGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFFQSGYNYRSLRTAIRIIVNTEG 206

Query: 283 IGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYAVEKQ 321
           + AL+ G++A + R  P + L   F E+  +  + +EK+
Sbjct: 207 VKALFFGYKATLARDLPFSALQFGFYEKFRQTAFKLEKK 245

 Score = 35.0 bits (79), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 44/85 (51%), Gaps = 22/85 (25%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQ------------GEMSADAQR------IYKNPM 70
           IAGG+A  I    T P++++KTR+Q Q            G +SA   +      +  +  
Sbjct: 263 IAGGLAGII----TTPMDVIKTRLQTQQADINPNSATTVGAISAKTNKKSRPIVLSNSIF 318

Query: 71  QALKVIFKNEGIRGLQKGLSCAYIY 95
           ++LK+++++EG+ G   G+   +++
Sbjct: 319 RSLKLVYQSEGVIGFFSGVGPRFVW 343

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 68.9 bits (167), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 80/308 (25%), Positives = 137/308 (44%), Gaps = 56/308 (18%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQG------EMSADAQRIYKN---PMQALKVIFKN 79
           I+G  A  I   VT+P++L+K R+QL              QRI K+     Q LK  ++ 
Sbjct: 17  ISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQVQRIIKDGSGTQQLLKEAYRG 76

Query: 80  EGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVN------ 133
            GI  +  G + A+       G   G Y   + V+    Y       +QN  +N      
Sbjct: 77  LGINII--GNAVAW-------GLYFGLYRCSKDVV----YSLSSEPALQNKFMNDRKMTS 123

Query: 134 ---VVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFK 190
              +VS   SG+  A++ +P+++IKTR+ S  ++        YTSI N ++ IY  EG K
Sbjct: 124 SMYLVSAGASGLATALLTNPMWVIKTRIMSTKSS------QGYTSILNAITRIYTEEGLK 177

Query: 191 GLYRGVDAAILRTGAGSSVQLPIYNTAKHFLL--KHDLMK------EGTGLHLVASTVSG 242
             +RG+  ++     G ++   IY+T K   L  ++D+ +      E  G+  ++  +S 
Sbjct: 178 TFWRGLVPSLFGVTQG-ALYFAIYDTLKLKYLHDRNDIQERRLNAVETIGIISLSKMISV 236

Query: 243 FGVGVVMNPWDVILT--RVYNQKGNLYKGPLDCFVKTV-RIEGIGALYKGFEAQIFRIAP 299
             V     P  ++ T  + +  + N     ++  ++++    GI   YKG  A + R  P
Sbjct: 237 SSV----YPLQLLKTNLQTFRTEHN-ENSKMNSLIRSIWHTNGIAGFYKGLFANLVRAIP 291

Query: 300 HTILCLTF 307
            T  C+TF
Sbjct: 292 ST--CITF 297

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/196 (20%), Positives = 85/196 (43%), Gaps = 21/196 (10%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK 87
            ++ G +      +TNP+ ++KTR+     MS  + + Y + + A+  I+  EG++   +
Sbjct: 127 LVSAGASGLATALLTNPMWVIKTRI-----MSTKSSQGYTSILNAITRIYTEEGLKTFWR 181

Query: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSG----ATSGII 143
           GL    ++ +         Y+ ++           D + +Q   +N V      + S +I
Sbjct: 182 GL-VPSLFGVTQGALYFAIYDTLK------LKYLHDRNDIQERRLNAVETIGIISLSKMI 234

Query: 144 GAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRT 203
                 PL L+KT +Q++       +    + + + + SI+   G  G Y+G+ A ++R 
Sbjct: 235 SVSSVYPLQLLKTNLQTFRT-----EHNENSKMNSLIRSIWHTNGIAGFYKGLFANLVRA 289

Query: 204 GAGSSVQLPIYNTAKH 219
              + +   +Y   KH
Sbjct: 290 IPSTCITFGVYEHFKH 305

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 80/179 (44%), Gaps = 23/179 (12%)

Query: 134 VVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYR-----AEG 188
           ++SG T+G I  I+  PL LIK R+Q    AI +   ++Y    N +  I +      + 
Sbjct: 16  IISGLTAGTITTIVTHPLDLIKLRLQ--LAAIDLKPSSYY----NQVQRIIKDGSGTQQL 69

Query: 189 FKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFL--------LKHDLM---KEGTGLHLVA 237
            K  YRG+   I+       +   +Y  +K  +        L++  M   K  + ++LV+
Sbjct: 70  LKEAYRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSSMYLVS 129

Query: 238 STVSGFGVGVVMNPWDVILTRVYNQKGNL-YKGPLDCFVKTVRIEGIGALYKGFEAQIF 295
           +  SG    ++ NP  VI TR+ + K +  Y   L+   +    EG+   ++G    +F
Sbjct: 130 AGASGLATALLTNPMWVIKTRIMSTKSSQGYTSILNAITRIYTEEGLKTFWRGLVPSLF 188

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 68.6 bits (166), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 71/278 (25%), Positives = 117/278 (42%), Gaps = 17/278 (6%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEM--SADAQRIYKNPMQALKVIFKNEGIRG 84
            F+ GG++A ++ T   PIE VK  +Q Q EM       R Y   ++  K    +EG+  
Sbjct: 13  DFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECFKRTAADEGVAS 72

Query: 85  LQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIG 144
             +G +   I           F + I+++    F    +    +  A N+ SG  +G + 
Sbjct: 73  FWRGNTANVIRYFPTQALNFAFKDKIKAM----FGFKKEEGYAKWFAGNLASGGLAGGLS 128

Query: 145 AIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYR----AEGFKGLYRGVDAAI 200
            +    L   +TR+ + S + + G +  +    NGL  +Y+    ++G  GLYRG   ++
Sbjct: 129 LLFVYSLDYARTRLAADSKSAKKGGERQF----NGLVDVYKKTLASDGVAGLYRGFLPSV 184

Query: 201 LRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVY 260
           +       +   +Y++ K  LL   L        L+   V+  G      P D +  R+ 
Sbjct: 185 VGIVVYRGLYFGLYDSLKPLLLTGSLENSFLASFLLGWAVTT-GASTASYPLDTVRRRMM 243

Query: 261 NQKGNL--YKGPLDCFVKTVRIEGIGALYKGFEAQIFR 296
              G    Y G  D F K V  EGI +L+KG  A I R
Sbjct: 244 MTSGQAVKYDGAFDAFRKIVAAEGIKSLFKGCGANILR 281

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 69/167 (41%), Gaps = 15/167 (8%)

Query: 45  IELVKTRMQLQGEMSADA-QRIYKNPMQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSR 103
           ++  +TR+    + +    +R +   +   K    ++G+ GL +G   + +  +   G  
Sbjct: 135 LDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFLPSVVGIVVYRGLY 194

Query: 104 LGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGS-PLFLIKTRMQSYS 162
            G Y+ ++        P +    ++N  +       +   GA   S PL  ++ RM   S
Sbjct: 195 FGLYDSLK--------PLLLTGSLENSFLASFLLGWAVTTGASTASYPLDTVRRRMMMTS 246

Query: 163 NAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSV 209
                GQ   Y   ++    I  AEG K L++G  A ILR  AG+ V
Sbjct: 247 -----GQAVKYDGAFDAFRKIVAAEGIKSLFKGCGANILRGVAGAGV 288

 Score = 35.8 bits (81), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 267 YKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYAVEKQ 321
           Y G ++CF +T   EG+ + ++G  A + R  P   L   F ++ +K ++  +K+
Sbjct: 54  YTGIVECFKRTAADEGVASFWRGNTANVIRYFPTQALNFAFKDK-IKAMFGFKKE 107

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 68.9 bits (167), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 75/326 (23%), Positives = 144/326 (44%), Gaps = 50/326 (15%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQ------------LQGEMSADAQRI------YKNP 69
           F+AGG+       VT P ++VKTR+Q            +Q   S+    +      +K  
Sbjct: 54  FVAGGIGGMAGAIVTCPFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKET 113

Query: 70  MQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQN 129
              +  +++ EG R L KGL    +  I         Y   + + ++T     +      
Sbjct: 114 FGIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFLTYGTTKDIYSRTLNNGQEAP---- 169

Query: 130 VAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGF 189
             +++++ AT+G   + + +P++L+KTR+Q      + G +T+  S+ + + S+ + EG 
Sbjct: 170 -WIHLLAAATAGWATSTVTNPIWLVKTRLQ----LDKAGTKTYKNSL-DCIKSVVKNEGV 223

Query: 190 KGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSG------- 242
            GLY+G+ A+ L +  G  +Q  +Y   K  + +  + K G  +H  A + S        
Sbjct: 224 LGLYKGLSASYLGSVEG-ILQWILYEQMKRIIKERSIEKFG-HIHEDAKSTSDKVKEWCQ 281

Query: 243 ---------FGVGVVMNPWDVILTRVY---NQKGNL-YKGPLDCFVKTVRIEGIGALYKG 289
                    F   +V  P +V+ TR+     + G L Y G +  F   ++ EG+ ++Y G
Sbjct: 282 RSGSAGLAKFVASIVTYPHEVVRTRLRQAPTENGKLKYTGLVQSFRVIIKEEGLVSMYSG 341

Query: 290 FEAQIFRIAPHTILCLTFMEQTMKVV 315
               + R  P++I+     E  +K++
Sbjct: 342 LTPHLLRTVPNSIIMFGTWELVIKLL 367

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 68.2 bits (165), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 69/278 (24%), Positives = 117/278 (42%), Gaps = 49/278 (17%)

Query: 66  YKNPMQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLN-KTFYPAMDP 124
           +   ++A   I   EGI  L +G+S   +  I  N      YE IR V    + YP ++P
Sbjct: 102 FNGTLEAFTKIASVEGITSLWRGISLTLLMAIPANMVYFSGYEYIRDVSPIASTYPTLNP 161

Query: 125 HKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIW---NGLS 181
                    +  GA + +  A   +PL L+KT++QS      I + +  T  W     L 
Sbjct: 162 ---------LFCGAIARVFAATSIAPLELVKTKLQS------IPRSSKSTKTWMMVKDLL 206

Query: 182 SIYRAE-----GFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLM---KEGTGL 233
           +  R E       + L++G++  + R    S++    Y   K  L         K+   +
Sbjct: 207 NETRQEMKMVGPSRALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTRFASKDANWV 266

Query: 234 HLVAS----TVSGFGVGVVMNPWDVILTRVY------------NQKGNLYKGPLDCFVKT 277
           H + S     +SG    +  +P+DV  TR              N+  N++K     F++T
Sbjct: 267 HFINSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFK-----FLET 321

Query: 278 V-RIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKV 314
           + R EG+ ALY G  A++ +I P   + ++  E + KV
Sbjct: 322 IWRTEGLAALYTGLAARVIKIRPSCAIMISSYEISKKV 359

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 84/197 (42%), Gaps = 7/197 (3%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQL--QGEMSADAQRIYKNPMQALKVIFKNEG-IRG 84
              G +A   A T   P+ELVKT++Q   +   S     + K+ +   +   K  G  R 
Sbjct: 162 LFCGAIARVFAATSIAPLELVKTKLQSIPRSSKSTKTWMMVKDLLNETRQEMKMVGPSRA 221

Query: 85  LQKGLSCAYIYQIGLNGSRLGFYEPI--RSVLNKTFYPAMDPHKVQNVAVNVVSGATSGI 142
           L KGL       +  +      YE    R  L+ T + + D + V  +  +  SG  SG+
Sbjct: 222 LFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTRFASKDANWVHFIN-SFASGCISGM 280

Query: 143 IGAIMGSPLFLIKTRMQ-SYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAIL 201
           I AI   P  + KTR Q S  N           +++  L +I+R EG   LY G+ A ++
Sbjct: 281 IAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTEGLAALYTGLAARVI 340

Query: 202 RTGAGSSVQLPIYNTAK 218
           +     ++ +  Y  +K
Sbjct: 341 KIRPSCAIMISSYEISK 357

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 38/71 (53%), Gaps = 2/71 (2%)

Query: 26  GSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQ--RIYKNPMQALKVIFKNEGIR 83
            SF +G ++  IA   T+P ++ KTR Q+    ++D +     +N  + L+ I++ EG+ 
Sbjct: 270 NSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTEGLA 329

Query: 84  GLQKGLSCAYI 94
            L  GL+   I
Sbjct: 330 ALYTGLAARVI 340

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 67.8 bits (164), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 73/273 (26%), Positives = 126/273 (46%), Gaps = 34/273 (12%)

Query: 66  YKNPMQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIR--SVLNKTFYPAMD 123
           +   ++A + I K EG+  L +G+S   +  I  N      YE +R  S LN   YP ++
Sbjct: 110 FNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVRDRSPLNG-LYPTIN 168

Query: 124 PHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSY-SNAIQIGQQTHYTSIWNGLSS 182
           P         ++ GA +  + A   +PL LIKT++QS  S++++ G    Y  ++N + S
Sbjct: 169 P---------LICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKS 219

Query: 183 IYRAEGF-KGLYRGVDAAILRTGAGSSV---QLPIYNTAKHFLLKHDLMKEGTG-LHLVA 237
                G  + +++G++  + R    S++       Y T   +L      K  +   H   
Sbjct: 220 EIAMRGVAQTMFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHFTN 279

Query: 238 STVSGFGVG----VVMNPWDVILTR-----VYNQK---GNLYKGPLDC---FVKTVR-IE 281
           S + GF  G    +  +P+DV  TR     V ++K    NL  G  +    F+  +R  E
Sbjct: 280 SFLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKTE 339

Query: 282 GIGALYKGFEAQIFRIAPHTILCLTFMEQTMKV 314
           GIGALY G   ++ +IAP   + ++  E T ++
Sbjct: 340 GIGALYTGLAPRVAKIAPSCAIMISSYELTKRL 372

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 44/210 (20%), Positives = 78/210 (37%), Gaps = 20/210 (9%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQL--QGEMSADAQRIYKNPMQALKVIFKNEGI-RG 84
            I G  A  +A T   P+EL+KT++Q      M   +  +Y++    +K      G+ + 
Sbjct: 170 LICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMRGVAQT 229

Query: 85  LQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVN-------VVSG 137
           + KGL       +  +      YE       KT    + P      + N        + G
Sbjct: 230 MFKGLEITLWRDVPFSAIYWASYE-----FYKTKVAYLSPSTFDKNSSNWFHFTNSFLGG 284

Query: 138 ATSGIIGAIMGSPLFLIKTRMQ-SYSNAIQIGQQT----HYTSIWNGLSSIYRAEGFKGL 192
             SG + AI   P  + KTR Q S     ++           +++  L+ I + EG   L
Sbjct: 285 FISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKTEGIGAL 344

Query: 193 YRGVDAAILRTGAGSSVQLPIYNTAKHFLL 222
           Y G+   + +     ++ +  Y   K   +
Sbjct: 345 YTGLAPRVAKIAPSCAIMISSYELTKRLFM 374

 Score = 30.0 bits (66), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 12/55 (21%), Positives = 24/55 (43%)

Query: 252 WDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLT 306
           W+    +  N +   + G L+ F K  + EG+  L++G    +    P  ++  T
Sbjct: 95  WESTCFQNLNCRNQKFNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFT 149

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 6/72 (8%)

Query: 25  TGSFIAGGMAACIAVTVTNPIELVKTRMQLQ---GEMSADAQRIY--KNPMQA-LKVIFK 78
           T SF+ G ++  +A   T+P ++ KTR Q+     +  A++   Y   N M   L  I K
Sbjct: 278 TNSFLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRK 337

Query: 79  NEGIRGLQKGLS 90
            EGI  L  GL+
Sbjct: 338 TEGIGALYTGLA 349

>Kwal_55.21335
          Length = 317

 Score = 67.4 bits (163), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 65/274 (23%), Positives = 118/274 (43%), Gaps = 28/274 (10%)

Query: 31  GGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG-IRGLQKGL 89
           G +A      +  P++ +K R+Q Q         ++      +K  ++ EG ++G  +G+
Sbjct: 52  GSIAGAAGKVIEYPLDTIKVRLQTQ------PAHVFPTSWSCIKYTYQKEGFVKGFYQGV 105

Query: 90  SCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGS 149
           +   +     N      +   ++ L +  Y ++ P     ++  V+SGA +G   + + +
Sbjct: 106 ASPLVGAALENAVLFVTFNRAQNFLQQ--YESVSP-----LSQTVLSGAFAGACTSYVLT 158

Query: 150 PLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSV 209
           P+ LIK  +Q  SN    G  T ++ IW  +  I + +G  GL++G  +  +R  AG +V
Sbjct: 159 PVELIKCTLQ-VSNLE--GATTRHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAV 215

Query: 210 QLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMN----PWDVILTRVYNQKGN 265
               Y + K +L +     E     L+A   SG   GV  N    P D I +    Q   
Sbjct: 216 WFTTYESLKSYLARRRNDTENHTWELLA---SGASAGVAFNASIFPADTIKSTAQTQ--- 269

Query: 266 LYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAP 299
            + G +D   + +   G   LY+G    + R AP
Sbjct: 270 -HLGIVDATKRILARSGPAGLYRGLGITLIRAAP 302

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 79/189 (41%), Gaps = 20/189 (10%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           ++G  A      V  P+EL+K  +Q+     A  +     P   +K I +++GI GL +G
Sbjct: 144 LSGAFAGACTSYVLTPVELIKCTLQVSNLEGATTRHSKIWPT--VKHIVQHKGIGGLWQG 201

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVV-SGATSGIIGAIM 147
            S  +I +          YE ++S      Y A   +  +N    ++ SGA++G+     
Sbjct: 202 QSSTFIRECAGGAVWFTTYESLKS------YLARRRNDTENHTWELLASGASAGVA---F 252

Query: 148 GSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGS 207
            + +F   T        I+   QT +  I +    I    G  GLYRG+   ++R    +
Sbjct: 253 NASIFPADT--------IKSTAQTQHLGIVDATKRILARSGPAGLYRGLGITLIRAAPAN 304

Query: 208 SVQLPIYNT 216
           ++    Y T
Sbjct: 305 AIVFYTYET 313

>Kwal_33.15446
          Length = 305

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 75/303 (24%), Positives = 122/303 (40%), Gaps = 33/303 (10%)

Query: 23  SKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGI 82
           S+   F++G  +      V +P + +K R+Q     S D  R +K P+  +    + +GI
Sbjct: 17  SRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQ----TSQDTGR-FKGPLDCVYQTMRQQGI 71

Query: 83  RGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGI 142
           RG   G +   +  I ++   LG     R +L K  Y   +   +      ++SG  +G 
Sbjct: 72  RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGC---ILSGVLAGW 128

Query: 143 IGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRG-VDAAIL 201
             + + +P+ L K ++Q   +A    Q T Y    + +  +Y A+G +G+Y+G V   I 
Sbjct: 129 SVSFIAAPVELAKAKLQVQYDA----QTTRYRGPLDVIKKVYAADGIRGMYKGLVSTLIF 184

Query: 202 RTGAGSSVQLPIYNTAKHFLL----KHDLMKEGTGLHLVASTVSG-FGVGVVMNPWDVIL 256
           RT         +Y    + LL    K +     T ++  A   S  FG      P DVI 
Sbjct: 185 RTHF-------VYWWGSYELLTRWFKANTNLSDTAINFWAGGFSASFGFWTTAYPSDVIK 237

Query: 257 TRVY-NQKGNLYKGPLDCFVKTV----RIEGIGALYKGFEAQIFRIAPHTILCLTFMEQT 311
             +  N K   Y G L  +        R  GI   +KGF     R  P     L   E  
Sbjct: 238 QVILCNDK---YDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFV 294

Query: 312 MKV 314
           ++V
Sbjct: 295 LRV 297

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 82/187 (43%), Gaps = 21/187 (11%)

Query: 121 AMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGL 180
           A+ P++  +  +  VSG  SGI    +G P   IK R+Q+  +  +             L
Sbjct: 9   AVVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTGRFK---------GPL 59

Query: 181 SSIY---RAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEG----TGL 233
             +Y   R +G +G Y G    ++      SV L   +  +  L K+    E     +G 
Sbjct: 60  DCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGC 119

Query: 234 HLVASTVSGFGVGVVMNPWDVILTRV---YNQKGNLYKGPLDCFVKTVRIEGIGALYKGF 290
            +++  ++G+ V  +  P ++   ++   Y+ +   Y+GPLD   K    +GI  +YKG 
Sbjct: 120 -ILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYKGL 178

Query: 291 EAQ-IFR 296
            +  IFR
Sbjct: 179 VSTLIFR 185

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 65/282 (23%), Positives = 115/282 (40%), Gaps = 23/282 (8%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK 87
           F++G  A    + V  P+++VKTRMQLQ      +   Y   +  L  I K EG   L K
Sbjct: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71

Query: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIM 147
           G+S   + +     ++    +  + +    +   +D    Q   ++++SG+ +G+  A +
Sbjct: 72  GISSPMLMEAPKRATKFACNDSYQKMFKDLY--GVDKLTQQ---ISILSGSLAGVTEACV 126

Query: 148 GSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGS 207
             P  L+K R+Q  ++      +  + +I        R  G   LY G+++ + R    +
Sbjct: 127 IVPFELVKIRLQDVNSKFNGPMEVVFKTI--------RETGILSLYNGLESTMWRNAFWN 178

Query: 208 SVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFG-VGVVMNPWDVILTRVYN----- 261
                +    +  L K     E T   L+A T+ G+           V+ +R+ +     
Sbjct: 179 GGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTT 238

Query: 262 -QKGNL---YKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAP 299
              G +   Y        K    EG  ALYKGF  +I R+ P
Sbjct: 239 LADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280

 Score = 65.5 bits (158), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 80/198 (40%), Gaps = 16/198 (8%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           S ++G +A      V  P ELVK R+Q       D    +  PM+ +    +  GI  L 
Sbjct: 112 SILSGSLAGVTEACVIVPFELVKIRLQ-------DVNSKFNGPMEVVFKTIRETGILSLY 164

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIG-A 145
            GL          NG   G    IR++L K      +  K  N   ++++G   G    +
Sbjct: 165 NGLESTMWRNAFWNGGYFGVIFQIRALLPKA---KTNTEKTTN---DLIAGTIGGYCRYS 218

Query: 146 IMGSPLFLIKTRMQSYSNAIQIGQQT--HYTSIWNGLSSIYRAEGFKGLYRGVDAAILRT 203
              + L ++K+R+QS +            Y   W  L  IY  EGF  LY+G    ILR 
Sbjct: 219 TEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRL 278

Query: 204 GAGSSVQLPIYNTAKHFL 221
           G G  + L ++N    F 
Sbjct: 279 GPGGGIMLVVFNGMMAFF 296

>Scas_379.2
          Length = 301

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 85/197 (43%), Gaps = 22/197 (11%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           ++G +A   A  + NP + +K RMQL    +              K I+KNEG       
Sbjct: 123 LSGTVATIAADALMNPFDTLKQRMQLNTNTTV---------WNVTKQIYKNEGFSAFYY- 172

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMG 148
              +Y   + +N     F   I     K F P  D     N  V+ +SG  SG   A + 
Sbjct: 173 ---SYPTTLAMNIPFAAFNFMIYESATKFFNPTND----YNPLVHCLSGGLSGATCAAIT 225

Query: 149 SPLFLIKTRMQ---SYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGA 205
           +PL  IKT +Q   S S ++Q+ ++ +  +      +IY+  G KG +RG+   +     
Sbjct: 226 TPLDCIKTVLQVRGSESVSLQVMKEAN--TFQKATKAIYQVHGAKGFWRGLQPRVFANMP 283

Query: 206 GSSVQLPIYNTAKHFLL 222
            +++    Y  AKHFLL
Sbjct: 284 ATAIAWTAYECAKHFLL 300

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 61/294 (20%), Positives = 107/294 (36%), Gaps = 39/294 (13%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK 87
            +AG  A  +  +V  PI+ +KTR+Q      + + +   N +  +  I   EG   L K
Sbjct: 27  LLAGAFAGIMEHSVMFPIDALKTRIQ------STSAKSTSNMLSQMAKISTAEGSLALWK 80

Query: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIM 147
           G+    +     +      YE  +  L       M  H+    A   +SG  + I    +
Sbjct: 81  GVQSVILGAGPAHAVYFATYEYTKKYLIDE--KDMQTHQPLKTA---LSGTVATIAADAL 135

Query: 148 GSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGS 207
            +P   +K RMQ  +N          T++WN    IY+ EGF   Y      +      +
Sbjct: 136 MNPFDTLKQRMQLNTN----------TTVWNVTKQIYKNEGFSAFYYSYPTTLAMNIPFA 185

Query: 208 SVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILT---------- 257
           +    IY +A  F   +        +H ++  +SG     +  P D I T          
Sbjct: 186 AFNFMIYESATKFF--NPTNDYNPLVHCLSGGLSGATCAAITTPLDCIKTVLQVRGSESV 243

Query: 258 --RVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFME 309
             +V  +     K     +    ++ G    ++G + ++F   P T +  T  E
Sbjct: 244 SLQVMKEANTFQKATKAIY----QVHGAKGFWRGLQPRVFANMPATAIAWTAYE 293

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 65.9 bits (159), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 81/197 (41%), Gaps = 22/197 (11%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           I+G  A  +A  + NP +++K RMQL    S              K I+  EG       
Sbjct: 117 ISGMAATTVADALMNPFDVIKQRMQLNTRESV---------WHVTKNIYHKEGFAAFYYS 167

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMG 148
                +  I         YE     +N        P    N  ++ +SG  SG   A + 
Sbjct: 168 YPTTLVMNIPFAAFNFAIYESATKFMN--------PSNEYNPFIHCISGGLSGATCAAIT 219

Query: 149 SPLFLIKTRMQ---SYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGA 205
           +PL  IKT +Q   S + + +I +Q +  +     S+IY+  G+KG  RG+   ++    
Sbjct: 220 TPLDCIKTVLQVRGSETVSNEIMKQAN--TFQRAASAIYKIHGWKGFLRGLKPRVIANMP 277

Query: 206 GSSVQLPIYNTAKHFLL 222
            +++    Y  AKHFL+
Sbjct: 278 ATAISWTSYECAKHFLV 294

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/233 (22%), Positives = 92/233 (39%), Gaps = 28/233 (12%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK 87
            +AG  A  +  +V  P++ +KTR+Q     +A    I     + +  I   EG   L K
Sbjct: 20  LLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLI-----KQISKITTAEGSLALWK 74

Query: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDP---HKVQNVAVNVVSGATSGIIG 144
           G+    +     +      YE  +S L       +DP   H  Q +   +   A + +  
Sbjct: 75  GVQSVILGAGPAHAVYFATYEFSKSKL-------IDPQDMHTHQPIKTAISGMAATTVAD 127

Query: 145 AIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTG 204
           A+M +P  +IK RMQ  +            S+W+   +IY  EGF   Y      ++   
Sbjct: 128 ALM-NPFDVIKQRMQLNTR----------ESVWHVTKNIYHKEGFAAFYYSYPTTLVMNI 176

Query: 205 AGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILT 257
             ++    IY +A  F+   +  +    +H ++  +SG     +  P D I T
Sbjct: 177 PFAAFNFAIYESATKFMNPSN--EYNPFIHCISGGLSGATCAAITTPLDCIKT 227

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 79/182 (43%), Gaps = 12/182 (6%)

Query: 134 VVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLY 193
           +++GA +GI+   +  P+  IKTR+QS S+    G  T    +   +S I  AEG   L+
Sbjct: 20  LLAGAFAGIMEHSVLFPVDAIKTRIQSSSS----GAATQ--GLIKQISKITTAEGSLALW 73

Query: 194 RGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVG-VVMNPW 252
           +GV + IL  G   +V    Y  +K  L+    M     +    S ++   V   +MNP+
Sbjct: 74  KGVQSVILGAGPAHAVYFATYEFSKSKLIDPQDMHTHQPIKTAISGMAATTVADALMNPF 133

Query: 253 DVILTRV-YNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQT 311
           DVI  R+  N + +++    + + K    EG  A Y  +   +    P         E  
Sbjct: 134 DVIKQRMQLNTRESVWHVTKNIYHK----EGFAAFYYSYPTTLVMNIPFAAFNFAIYESA 189

Query: 312 MK 313
            K
Sbjct: 190 TK 191

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 66.2 bits (160), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 92/203 (45%), Gaps = 20/203 (9%)

Query: 30  AGGMAACIAVTVTNPIELVKTRMQLQGEMSA---DAQRIYKNPMQALKVIFKNEGIRGLQ 86
           AG +   I+  V  P E++KTR+QLQG  +     +   Y N   A+K + K EG R L 
Sbjct: 154 AGFLGDFISSFVYVPSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLF 213

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQ-NVAVNVVSGATSGIIGA 145
            G        +  +  +  FYE  R +  K      D    + ++   +++GA +G +  
Sbjct: 214 FGYKATLARDLPFSALQFAFYEKFRQLAFKI--EQKDGRDGELSIPNEILTGACAGGLAG 271

Query: 146 IMGSPLFLIKTRMQ-----SYSNAIQIGQQTHYT---------SIWNGLSSIYRAEGFKG 191
           I+ +P+ ++KTR+Q     S SN        H T         SI   L ++Y++EG  G
Sbjct: 272 IITTPMDVVKTRVQTQQPPSQSNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVLG 331

Query: 192 LYRGVDAAILRTGAGSSVQLPIY 214
            + GV    + T   SS+ L +Y
Sbjct: 332 FFSGVGPRFVWTSVQSSIMLLLY 354

 Score = 63.2 bits (152), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 58/246 (23%), Positives = 111/246 (45%), Gaps = 26/246 (10%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIR-GLQK 87
           ++GG+   I  +  + ++ VKTR Q      A   + Y+N + A + I+  EG+R GL  
Sbjct: 58  VSGGIGGKIGDSAMHSLDTVKTRQQ-----GAPNVKKYRNMISAYRTIWLEEGVRRGLYG 112

Query: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIM 147
           G   A +          G YE  +  +       ++  ++ +   ++ +G     I + +
Sbjct: 113 GYMAAMLGSFPSAAIFFGTYEYTKRTM-------IEDWQINDTITHLSAGFLGDFISSFV 165

Query: 148 GSPLFLIKTRMQ---SYSNAI-QIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRT 203
             P  ++KTR+Q    ++N   Q G   +Y+++ N + ++ + EGF+ L+ G  A + R 
Sbjct: 166 YVPSEVLKTRLQLQGRFNNPFFQSGY--NYSNLRNAIKTVIKEEGFRSLFFGYKATLARD 223

Query: 204 GAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHL------VASTVSGFGVGVVMNPWDVILT 257
              S++Q   Y   +    K +  K+G    L      +    +G   G++  P DV+ T
Sbjct: 224 LPFSALQFAFYEKFRQLAFKIE-QKDGRDGELSIPNEILTGACAGGLAGIITTPMDVVKT 282

Query: 258 RVYNQK 263
           RV  Q+
Sbjct: 283 RVQTQQ 288

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 88/198 (44%), Gaps = 17/198 (8%)

Query: 134 VVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFK-GL 192
           VVSG   G IG      L  +KTR Q   N  +      Y ++ +   +I+  EG + GL
Sbjct: 57  VVSGGIGGKIGDSAMHSLDTVKTRQQGAPNVKK------YRNMISAYRTIWLEEGVRRGL 110

Query: 193 YRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPW 252
           Y G  AA+L +   +++    Y   K  +++ D     T  HL A  +  F    V  P 
Sbjct: 111 YGGYMAAMLGSFPSAAIFFGTYEYTKRTMIE-DWQINDTITHLSAGFLGDFISSFVYVPS 169

Query: 253 DVILTRV---------YNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTIL 303
           +V+ TR+         + Q G  Y    +     ++ EG  +L+ G++A + R  P + L
Sbjct: 170 EVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKATLARDLPFSAL 229

Query: 304 CLTFMEQTMKVVYAVEKQ 321
              F E+  ++ + +E++
Sbjct: 230 QFAFYEKFRQLAFKIEQK 247

 Score = 29.3 bits (64), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 40/83 (48%), Gaps = 17/83 (20%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYK---------NPMQ-------A 72
           + G  A  +A  +T P+++VKTR+Q Q +  + + + Y           P         +
Sbjct: 261 LTGACAGGLAGIITTPMDVVKTRVQTQ-QPPSQSNKSYSVTHPHVTNGRPAALSNSISLS 319

Query: 73  LKVIFKNEGIRGLQKGLSCAYIY 95
           L+ ++++EG+ G   G+   +++
Sbjct: 320 LRTVYQSEGVLGFFSGVGPRFVW 342

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 65.5 bits (158), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 75/290 (25%), Positives = 129/290 (44%), Gaps = 28/290 (9%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPM-QALKVIFKNEGIRGL 85
           +F+AGG+   ++ TV +P+E VK  +Q+Q   +A     Y   +  A+K ++K EG++GL
Sbjct: 19  AFVAGGVGGAVSRTVVSPVERVKILLQVQSSTTA-----YNGGLVHAVKQVYKEEGVKGL 73

Query: 86  QK--GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGII 143
            +  G++C  I+    +  +   YE  ++   + F+     H+       +V GA  G  
Sbjct: 74  FRGNGINCLRIFP--YSAVQYAVYEFCKT---RVFHVGQSGHEQLRSWERLVGGALGGGA 128

Query: 144 GAIMGSPLFLIKTRMQ-SYSNAIQIGQQTHYT-----SIWNGLSSIYRAE-GFKGLYRGV 196
             ++  PL L++TR+    +N  ++ +   +       I   L  I+R E G +G YRGV
Sbjct: 129 SVLVTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGV 188

Query: 197 DAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEG-TGLHLVASTVSGFGVGVVMNPWDV- 254
               L      ++   +Y   K  L+ HD          L    VSG     V+ P+D+ 
Sbjct: 189 YPTSLGVVPFVALNFALYERLKA-LIPHDYDAGSVAAAKLAIGAVSGGIAQTVVYPFDLL 247

Query: 255 -----ILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAP 299
                +LT   ++ G  Y    D      R EG+   YKG  A + ++ P
Sbjct: 248 RRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVP 297

 Score = 59.3 bits (142), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 88/186 (47%), Gaps = 21/186 (11%)

Query: 41  VTNPIELVKTRMQLQGEMSADAQR-----IYKNP--MQALKVIFKNEG-IRGLQKGLSCA 92
           VT P++LV+TR+ +Q    A   R     I + P  ++ L+ IF+ EG +RG  +G+   
Sbjct: 132 VTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPT 191

Query: 93  YIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLF 152
            +  +         YE +++++   +    D   V   A  +  GA SG I   +  P  
Sbjct: 192 SLGVVPFVALNFALYERLKALIPHDY----DAGSV--AAAKLAIGAVSGGIAQTVVYPFD 245

Query: 153 LIKTRMQSYSNAIQIGQQT---HYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSV 209
           L++ R Q     + +GQ      Y S+ + L +I R EG +G Y+G+ A +++     +V
Sbjct: 246 LLRRRFQ----VLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAV 301

Query: 210 QLPIYN 215
           Q  +Y 
Sbjct: 302 QWFVYE 307

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 65.9 bits (159), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 60/212 (28%), Positives = 97/212 (45%), Gaps = 33/212 (15%)

Query: 34  AACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGL--SC 91
           A  I+ T+TNPI +VKTR+ LQ   +      YKN + A   I+K EGI+    GL  S 
Sbjct: 225 AGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYSGLIPSL 284

Query: 92  AYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHK-VQNVAVN----------------V 134
             +  + ++      YE ++ VL+   YP+  P++   NV  N                +
Sbjct: 285 FGLLHVAIH---FPVYEKLKKVLH--CYPSGRPNQETMNVNGNSNPQTTGSTNFQLGRLI 339

Query: 135 VSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYR 194
           V+   S +I + +  P  +++TR+Q  S+           SI + + + Y  EG +G Y 
Sbjct: 340 VASCGSKMIASTLTYPHEILRTRLQLKSDM--------KPSIKSIIRTTYAKEGIRGFYS 391

Query: 195 GVDAAILRTGAGSSVQLPIYNT-AKHFLLKHD 225
           G    + RT   S++ L  +    KHF L +D
Sbjct: 392 GFLTNMFRTVPASAITLVSFEYFRKHFKLWND 423

 Score = 64.7 bits (156), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 93/209 (44%), Gaps = 22/209 (10%)

Query: 128 QNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSY-------------SNAIQIGQQTHYT 174
            +  +  +SGA +G +  ++  PL + KTR+Q+              S A   G + +Y+
Sbjct: 101 NDTEITALSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGK-YYS 159

Query: 175 SIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLH 234
            IW  L++I R E  +GLY+G+   +L       +   +Y   K    ++    E    H
Sbjct: 160 GIWGTLTTIVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRYFNNSEFLS-H 218

Query: 235 LVASTVSGFGVGVVMNPWDVILTRVYNQKG------NLYKGPLDCFVKTVRIEGIGALYK 288
            +++  +G     + NP  V+ TR+  Q G        YK  LD F+K  ++EGI + Y 
Sbjct: 219 SMSALTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYKVEGIKSFYS 278

Query: 289 GFEAQIFRIAPHTILCLTFMEQTMKVVYA 317
           G    +F +  H  +     E+  KV++ 
Sbjct: 279 GLIPSLFGLL-HVAIHFPVYEKLKKVLHC 306

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 70/316 (22%), Positives = 122/316 (38%), Gaps = 46/316 (14%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQG-EMSADAQR------------IYKNPMQALKV 75
           ++G +A  +A  +  P+++ KTR+Q QG +++    R             Y      L  
Sbjct: 108 LSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTLTT 167

Query: 76  IFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVV 135
           I ++E IRGL KG+    +            YE  +    + F              + +
Sbjct: 168 IVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRYF-------NNSEFLSHSM 220

Query: 136 SGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRG 195
           S  T+G I   + +P++++KTR+   S    I   THY +  +    IY+ EG K  Y G
Sbjct: 221 SALTAGAISTTLTNPIWVVKTRLMLQSGK-NIKGMTHYKNTLDAFIKIYKVEGIKSFYSG 279

Query: 196 VDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGT---------------------GLH 234
           +  ++       ++  P+Y   K  L  +   +                        G  
Sbjct: 280 LIPSLFGL-LHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTGSTNFQLGRL 338

Query: 235 LVASTVSGFGVGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRI-EGIGALYKGFEAQ 293
           +VAS  S      +  P +++ TR+  Q  +  K  +   ++T    EGI   Y GF   
Sbjct: 339 IVASCGSKMIASTLTYPHEILRTRL--QLKSDMKPSIKSIIRTTYAKEGIRGFYSGFLTN 396

Query: 294 IFRIAPHTILCLTFME 309
           +FR  P + + L   E
Sbjct: 397 MFRTVPASAITLVSFE 412

 Score = 29.3 bits (64), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 46/131 (35%), Gaps = 27/131 (20%)

Query: 199 AILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTR 258
           AI   G+ S   L I     HF          T +  ++  ++GF  GV++ P DV  TR
Sbjct: 79  AIDLEGSSSRHGLSIVREEGHF--------NDTEITALSGALAGFLAGVIVCPLDVAKTR 130

Query: 259 VYNQ-------------------KGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAP 299
           +  Q                    G  Y G        VR E I  LYKG    +    P
Sbjct: 131 LQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTLTTIVRDESIRGLYKGIVPIVLGYFP 190

Query: 300 HTILCLTFMEQ 310
             ++  +  E+
Sbjct: 191 TWMIYFSVYER 201

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score = 64.7 bits (156), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 64/275 (23%), Positives = 112/275 (40%), Gaps = 30/275 (10%)

Query: 31  GGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGI-RGLQKGL 89
           G +A  +   +  P + VK R+Q Q         ++      +K  + NEG+ RG  +G+
Sbjct: 13  GSIAGAVGKVIEYPFDTVKVRLQTQ------PAHMFPTTWSCIKFTYDNEGLWRGFYQGI 66

Query: 90  SCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNV----AVNVVSGATSGIIGA 145
                      GS L       +VL  +F  A     V+++    +  V +GA +G   +
Sbjct: 67  -----------GSPLAGAALENAVLFVSFNQAKRLLDVESLLSPLSKTVWAGAFAGACAS 115

Query: 146 IMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGA 205
            + +P+ LIK ++Q  SN      +T +T I   + S+    GF GL++G     +R   
Sbjct: 116 FVLTPVELIKCKLQ-VSNLSTT--KTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESG 172

Query: 206 GSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVS-GFGVGVVMNPWDVILTRVYNQKG 264
           G +     Y   K++L      ++ T   L+AS  S G      + P D I + +     
Sbjct: 173 GGAAWFTTYEVVKNYLASRRQAEQNTTWELLASGASAGLAFNASIFPADTIKSTMQTDHI 232

Query: 265 NLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAP 299
           +L       + +    +GI   Y+G    + R  P
Sbjct: 233 DLSSATRKIYAR----QGIAGFYRGLGITLIRAVP 263

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 76/188 (40%), Gaps = 20/188 (10%)

Query: 30  AGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGL 89
           AG  A   A  V  P+EL+K ++Q+    +      +   +  +K +    G  GL +G 
Sbjct: 106 AGAFAGACASFVLTPVELIKCKLQVSNLSTTKTS--HTKILPTIKSVLSERGFLGLWQGQ 163

Query: 90  SCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVV-SGATSGIIGAIMG 148
           S  +I + G   +    YE +++      Y A      QN    ++ SGA++G+      
Sbjct: 164 SGTFIRESGGGAAWFTTYEVVKN------YLASRRQAEQNTTWELLASGASAGLAFNASI 217

Query: 149 SPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSS 208
            P   IK+ MQ           T +  + +    IY  +G  G YRG+   ++R    ++
Sbjct: 218 FPADTIKSTMQ-----------TDHIDLSSATRKIYARQGIAGFYRGLGITLIRAVPANA 266

Query: 209 VQLPIYNT 216
                Y T
Sbjct: 267 AIFYTYET 274

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 65.1 bits (157), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 84/199 (42%), Gaps = 22/199 (11%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           I+G  A   +  + NP + +K R+QL    S           Q  K I+++EG+      
Sbjct: 135 ISGACATTASDALMNPFDTIKQRIQLNTSASV---------WQTTKQIYQSEGLAAFYYS 185

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMG 148
                +  I         YE     LN        P    N  ++ + G+ SG   A + 
Sbjct: 186 YPTTLVMNIPFAAFNFVIYESSTKFLN--------PSNEYNPLIHCLCGSISGSTCAAIT 237

Query: 149 SPLFLIKTRMQ---SYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGA 205
           +PL  IKT +Q   S + +++I ++    S     S+IY+  G+KG +RG    I+    
Sbjct: 238 TPLDCIKTVLQIRGSQTVSLEIMRKADTFS--KAASAIYQVYGWKGFWRGWKPRIVANMP 295

Query: 206 GSSVQLPIYNTAKHFLLKH 224
            +++    Y  AKHFL+ +
Sbjct: 296 ATAISWTAYECAKHFLMTY 314

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 67/295 (22%), Positives = 121/295 (41%), Gaps = 39/295 (13%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIY-KNPMQALKVIFKNEGIRGLQ 86
            IAG  A  +  +V  PI+ +KTR+Q     SA+A+ +  KN +  +  I  +EG   L 
Sbjct: 37  LIAGAFAGIMEHSVMFPIDALKTRIQ-----SANAKSLSAKNMLSQISHISTSEGTLALW 91

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPI-RSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGA 145
           KG+    +     +    G YE   +++++ +      P K        +SGA +     
Sbjct: 92  KGVQSVILGAGPAHAVYFGTYEFCKKNLIDSSDTQTHHPFKT------AISGACATTASD 145

Query: 146 IMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGA 205
            + +P   IK R+Q  ++A          S+W     IY++EG    Y      ++    
Sbjct: 146 ALMNPFDTIKQRIQLNTSA----------SVWQTTKQIYQSEGLAAFYYSYPTTLVMNIP 195

Query: 206 GSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQKGN 265
            ++    IY ++  FL   +  +    +H +  ++SG     +  P D I T V   +G+
Sbjct: 196 FAAFNFVIYESSTKFLNPSN--EYNPLIHCLCGSISGSTCAAITTPLDCIKT-VLQIRGS 252

Query: 266 -------LYKGPLDCFVKTV----RIEGIGALYKGFEAQIFRIAPHTILCLTFME 309
                  + K   D F K      ++ G    ++G++ +I    P T +  T  E
Sbjct: 253 QTVSLEIMRKA--DTFSKAASAIYQVYGWKGFWRGWKPRIVANMPATAISWTAYE 305

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 80/187 (42%), Gaps = 17/187 (9%)

Query: 134 VVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLY 193
           +++GA +GI+   +  P+  +KTR+QS +NA  +  +   + I    S I  +EG   L+
Sbjct: 37  LIAGAFAGIMEHSVMFPIDALKTRIQS-ANAKSLSAKNMLSQI----SHISTSEGTLALW 91

Query: 194 RGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSG----FGVGVVM 249
           +GV + IL  G   +V    Y   K  L+      +    H   + +SG         +M
Sbjct: 92  KGVQSVILGAGPAHAVYFGTYEFCKKNLIDSS---DTQTHHPFKTAISGACATTASDALM 148

Query: 250 NPWDVILTRV-YNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFM 308
           NP+D I  R+  N   ++++     +    + EG+ A Y  +   +    P         
Sbjct: 149 NPFDTIKQRIQLNTSASVWQTTKQIY----QSEGLAAFYYSYPTTLVMNIPFAAFNFVIY 204

Query: 309 EQTMKVV 315
           E + K +
Sbjct: 205 ESSTKFL 211

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 64.7 bits (156), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/306 (20%), Positives = 136/306 (44%), Gaps = 40/306 (13%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNP-MQALKVIFKNE 80
           V+   + +AG ++  +A ++T P++ +K R+QL     A+  + + +  M+  + + KNE
Sbjct: 14  VAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLT---PANGLKPFGSQVMEVARSMIKNE 70

Query: 81  GIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATS 140
           GIR   KG     +  +    ++   Y    S+ N+     + P  ++    ++V GA +
Sbjct: 71  GIRSFWKGNIPGSLLYVTYGSAQFSSY----SLFNR----YLTPFGLEARLHSLVVGAFA 122

Query: 141 GIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAI 200
           GI  +I+  P  +++TR+ +         Q H  SI   +  I++ EG  G ++G  A++
Sbjct: 123 GITSSIVSYPFDVLRTRLVA-------NNQMHSMSITREVRDIWKLEGLPGFFKGSIASM 175

Query: 201 LRTGAGSSVQLPIYNTAKHFLLKHDLMK------EGTGLHLVASTVSGFGVGVVMNPWDV 254
                 +S+    Y T + +  +++         E   L+  A T+ G    ++  P + 
Sbjct: 176 TTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLET 235

Query: 255 ILTRV----------YNQKGNLY-----KGPLDCFVKTVRIEGIGALYKGFEAQIFRIAP 299
           I  R+          +++  ++Y      G     ++ ++ EG+ +LY+G    + +  P
Sbjct: 236 IRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIP 295

Query: 300 HTILCL 305
            T +  
Sbjct: 296 TTFVSF 301

 Score = 62.8 bits (151), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 94/205 (45%), Gaps = 18/205 (8%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           S + G  A   +  V+ P ++++TR+    +M +       +  + ++ I+K EG+ G  
Sbjct: 115 SLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHS------MSITREVRDIWKLEGLPGFF 168

Query: 87  KGLSCAYIYQIGLNGS-RLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGA 145
           KG S A +  I L  S   G YE IR   ++         K +   +N  +G   G+I  
Sbjct: 169 KG-SIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAK 227

Query: 146 IMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLS---------SIYRAEGFKGLYRGV 196
           I+  PL  I+ RMQ + N+  + + + ++S++              I + EG   LYRG+
Sbjct: 228 IITFPLETIRRRMQ-FMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGI 286

Query: 197 DAAILRTGAGSSVQLPIYNTAKHFL 221
             A+ +T   + V    Y TA H+L
Sbjct: 287 LVALSKTIPTTFVSFWGYETAIHYL 311

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 64/214 (29%), Positives = 93/214 (43%), Gaps = 22/214 (10%)

Query: 22  VSKTGSFIAG-GMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNE 80
           VS   +FIAG G     AV V NP+E+VK R+Q Q     +    YKN +QA   I K E
Sbjct: 107 VSTGNTFIAGVGAGITEAVVVVNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEE 166

Query: 81  GIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVL----NKTFYPAMDPHKVQNVAVNVVS 136
           G   L +G+S     Q    G+    Y  ++  L    N+   P+ +   +         
Sbjct: 167 GFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLI--------- 217

Query: 137 GATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGV 196
           G  SG IG    +PL  IKTR+Q   +   +      T I   L    + EGF+ LY+G+
Sbjct: 218 GLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQL---IQEEGFRALYKGI 274

Query: 197 DAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEG 230
              ++R   G +V    Y       ++ +L K G
Sbjct: 275 TPRVMRVAPGQAVTFTAYE-----FIRKELEKTG 303

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 75/304 (24%), Positives = 122/304 (40%), Gaps = 44/304 (14%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQA-------LKV---I 76
           + IAGG A  +     +P++ +K RMQ           IYKN + +       +K    I
Sbjct: 13  NLIAGGGAGLMEGLCCHPLDTIKVRMQ-----------IYKNAVGSGVKAPGFIKTGGEI 61

Query: 77  FKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVS 136
           ++NEG     KGL    I        R   YE  R++L        +  KV +     ++
Sbjct: 62  YRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADK-----ETGKV-STGNTFIA 115

Query: 137 GATSGIIGAIMGSPLFLI-KTRMQS-YSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYR 194
           G  +GI  A++      + K R+Q+ + N ++   +  Y +      +I + EGF  LYR
Sbjct: 116 GVGAGITEAVVVVNPMEVVKIRLQAQHLNPVEGAPK--YKNAVQACYTIVKEEGFSALYR 173

Query: 195 GVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMK-----EGTGLHLVASTVSGFGVGVVM 249
           GV     R          +Y+  K FL  +   +     E + + L++  +  F      
Sbjct: 174 GVSLTAARQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNA--- 230

Query: 250 NPWDVILTRVYNQKGNLYKGPLDCFV----KTVRIEGIGALYKGFEAQIFRIAPHTILCL 305
            P D I TR+   K       L        + ++ EG  ALYKG   ++ R+AP   +  
Sbjct: 231 -PLDTIKTRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQAVTF 289

Query: 306 TFME 309
           T  E
Sbjct: 290 TAYE 293

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 75/176 (42%), Gaps = 17/176 (9%)

Query: 125 HKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIY 184
            K  N AVN+++G  +G++  +   PL  IK RMQ Y NA  +G              IY
Sbjct: 5   QKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNA--VGSGVKAPGFIKTGGEIY 62

Query: 185 RAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFG 244
           R EGF   Y+G+ A ++      +++   Y   +  L   +  K  TG   +A    G G
Sbjct: 63  RNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLADKETGKVSTGNTFIA----GVG 118

Query: 245 VGVV---MNPWDVILTRVYNQKGNL--------YKGPLDCFVKTVRIEGIGALYKG 289
            G+    +    + + ++  Q  +L        YK  +      V+ EG  ALY+G
Sbjct: 119 AGITEAVVVVNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKEEGFSALYRG 174

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/290 (23%), Positives = 138/290 (47%), Gaps = 34/290 (11%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGI-RGLQK 87
           I+G  A  +   + +P++L K R+QL   +++  ++ Y+N     +++  +  + R L +
Sbjct: 13  ISGLTAGSVTTLIVHPLDLFKVRLQLL--ITSTTKKGYRNLWS--EIVGSDLSLTRELYR 68

Query: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQN-----VAVNVVSGATSGI 142
           GL+      + L G+ + +     S      Y     H+++N       + + + A+SG+
Sbjct: 69  GLT------VNLVGNTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASSGM 122

Query: 143 IGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILR 202
           +  ++ +PL++IKTRM S +N+     +         L  + + +G +GL++G+  A++ 
Sbjct: 123 LTTVLTNPLWVIKTRMMSKANSDLTSMKV--------LRDLIKNDGVQGLWKGLVPALVG 174

Query: 203 TGAGSSVQLPIYNTAKH-FLLKHDLMKEGTGLHLVAST-VSGFGVGVVMNPWDVILTRV- 259
              G ++    Y+T KH  +LK+    E T L  +A T VS       + P+ ++ + + 
Sbjct: 175 VSQG-ALHFTCYDTLKHKLVLKNRDSDEITNLETIAVTSVSKMLSTSAVYPFQLLKSNLQ 233

Query: 260 -YNQKGNLYK-GPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTF 307
            +    N +K  PL   + +    G+   YKG  A + R  P T  C+TF
Sbjct: 234 SFQASENDFKLLPLSKMIYSR--SGLLGFYKGLSANLLRSVPST--CITF 279

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 89/194 (45%), Gaps = 22/194 (11%)

Query: 30  AGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGL 89
           A   +  +   +TNP+ ++KTRM  +      +       M+ L+ + KN+G++GL KGL
Sbjct: 116 ASASSGMLTTVLTNPLWVIKTRMMSKANSDLTS-------MKVLRDLIKNDGVQGLWKGL 168

Query: 90  SCAYIYQIGLNGSRLGF--YEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIM 147
             A +   G++   L F  Y+ ++   +K      D  ++ N+    V+ + S ++    
Sbjct: 169 VPALV---GVSQGALHFTCYDTLK---HKLVLKNRDSDEITNLETIAVT-SVSKMLSTSA 221

Query: 148 GSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGS 207
             P  L+K+ +QS+  +    +    + +      IY   G  G Y+G+ A +LR+   +
Sbjct: 222 VYPFQLLKSNLQSFQASENDFKLLPLSKM------IYSRSGLLGFYKGLSANLLRSVPST 275

Query: 208 SVQLPIYNTAKHFL 221
            +   IY   K FL
Sbjct: 276 CITFCIYENFKSFL 289

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 75/163 (46%), Gaps = 12/163 (7%)

Query: 134 VVSGATSGIIGAIMGSPLFLIKTRMQSY-SNAIQIGQQTHYTSIWNGLSSIYRAEGFKGL 192
           V+SG T+G +  ++  PL L K R+Q   ++  + G +  ++ I     S+ R      L
Sbjct: 12  VISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKGYRNLWSEIVGSDLSLTRE-----L 66

Query: 193 YRGVDAAILRTGAGSSVQLPIYNTAKHFLL--KHDLMKE---GTGLHLVASTVSGFGVGV 247
           YRG+   ++       +    Y  AK +L+   H +  +    + ++L AS  SG    V
Sbjct: 67  YRGLTVNLVGNTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASSGMLTTV 126

Query: 248 VMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGF 290
           + NP  VI TR+ + K N     +      ++ +G+  L+KG 
Sbjct: 127 LTNPLWVIKTRMMS-KANSDLTSMKVLRDLIKNDGVQGLWKGL 168

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 80/330 (24%), Positives = 138/330 (41%), Gaps = 51/330 (15%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSA----------------------DAQRI 65
           F+AGG+       VT P +LVKTR+Q    + A                       A   
Sbjct: 56  FVAGGIGGMAGAVVTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTH 115

Query: 66  YKNPMQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPH 125
           +K  +  +  ++K EG R L KGL    +  I         Y   + +  K F    +  
Sbjct: 116 FKETLGIIGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAKAFNNGQE-- 173

Query: 126 KVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQ-SYSNAIQIGQQTHYTSIWNGLSSIY 184
                 +++++ AT+G   A   +P++LIKTR+Q   +    + Q   Y + W+ L S+ 
Sbjct: 174 ---TPMIHLMAAATAGWATATATNPIWLIKTRVQLDKAGKTSVRQ---YKNSWDCLKSVI 227

Query: 185 RAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVAST----- 239
           R EGF GLY+G+ A+ L +  G  +Q  +Y   K  + +  + K G       ST     
Sbjct: 228 RNEGFTGLYKGLSASYLGSVEG-ILQWLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVK 286

Query: 240 ----------VSGFGVGVVMNPWDVILTRVYNQ-KGN---LYKGPLDCFVKTVRIEGIGA 285
                     ++ F   +   P +V+ TR+    K N    Y G +  F   ++ EG+ +
Sbjct: 287 EWCQRSGSAGLAKFVASIATYPHEVVRTRLRQTPKENGKRKYTGLVQSFKVIIKEEGLFS 346

Query: 286 LYKGFEAQIFRIAPHTILCLTFMEQTMKVV 315
           +Y G    + R  P++I+     E  ++++
Sbjct: 347 MYSGLTPHLMRTVPNSIIMFGTWEIVIRLL 376

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 86/198 (43%), Gaps = 27/198 (13%)

Query: 122 MDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQS-------YSNAIQIGQ----- 169
           ++ H      V+ V+G   G+ GA++  P  L+KTR+QS        S A+ I +     
Sbjct: 44  IENHPTVKPWVHFVAGGIGGMAGAVVTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRP 103

Query: 170 ---------QTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHF 220
                     TH+      + ++Y+ EGF+ L++G+   ++      S+    Y T K  
Sbjct: 104 KSINYVIQAGTHFKETLGIIGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDM 163

Query: 221 LLK-HDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQKG-----NLYKGPLDCF 274
             K  +  +E   +HL+A+  +G+      NP  +I TRV   K        YK   DC 
Sbjct: 164 YAKAFNNGQETPMIHLMAAATAGWATATATNPIWLIKTRVQLDKAGKTSVRQYKNSWDCL 223

Query: 275 VKTVRIEGIGALYKGFEA 292
              +R EG   LYKG  A
Sbjct: 224 KSVIRNEGFTGLYKGLSA 241

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 81/189 (42%), Gaps = 28/189 (14%)

Query: 123 DPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSY-SNAIQIGQQTHYTSIWNGLS 181
           D H  +    +V SG   G+   ++G P  +IK R+Q+   NA          + W  ++
Sbjct: 17  DLHGFRKTLKDVFSGTVGGVAQVLVGQPFDIIKVRLQTMPGNA----------TAWEAIT 66

Query: 182 SIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKE--------GTGL 233
            + + EGF G Y+G  A ++  GA  S Q  I    K +    DL +           G 
Sbjct: 67  DLVKYEGFMGFYKGTMAPLVGVGACVSCQFGINEAMKRYF--RDLNRSRGIYDNTLSLGQ 124

Query: 234 HLVASTVSGFGVGVVMNPWDVILTRVYNQKGNL----YKGPLDCFVKTVRIEGIGALYKG 289
           +     VSG    ++  P + +  R+  QK  L    YK  LDC   T ++   G+L +G
Sbjct: 125 YYTCGFVSGSANALLATPIEHVRIRLQLQKEALANAEYKSTLDC---TEKLLKQGSLMRG 181

Query: 290 FEAQIFRIA 298
           F A + R +
Sbjct: 182 FTATLMRTS 190

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 62/299 (20%), Positives = 110/299 (36%), Gaps = 33/299 (11%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
            +G +     V V  P +++K R+Q    M  +A        +A+  + K EG  G  KG
Sbjct: 29  FSGTVGGVAQVLVGQPFDIIKVRLQ---TMPGNA-----TAWEAITDLVKYEGFMGFYKG 80

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVS-------GATSG 141
                +        + G  E ++           D ++ + +  N +S       G  SG
Sbjct: 81  TMAPLVGVGACVSCQFGINEAMKRYFR-------DLNRSRGIYDNTLSLGQYYTCGFVSG 133

Query: 142 IIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAIL 201
              A++ +P+  ++ R+Q    A+       Y S  +    + +      L RG  A ++
Sbjct: 134 SANALLATPIEHVRIRLQLQKEALA---NAEYKSTLDCTEKLLKQ---GSLMRGFTATLM 187

Query: 202 RTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLH--LVASTVSGFGVGVVMNPWDVILTRV 259
           RT  G  +    Y T     L H   +E        +   +SG     +  P+DV+ + +
Sbjct: 188 RTSHGFGIYFLTYETLIASQLAHGFRREDISAWKACMFGALSGAFFWAMTYPFDVVKSVM 247

Query: 260 YNQK--GNLYKGPLDCFVKTV-RIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVV 315
              K     Y   +    K + R  G+ A  KGF   + R  P         E TM+++
Sbjct: 248 QADKLVNPAYGTNVVQVAKNIYRERGLRAFTKGFMPTMLRSLPVNGATFAAFEVTMQML 306

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 79/182 (43%), Gaps = 23/182 (12%)

Query: 25  TGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRG 84
           T  F++G   A +A     PIE V+ R+QLQ E  A+A+  YK+ +   + + K      
Sbjct: 127 TCGFVSGSANALLA----TPIEHVRIRLQLQKEALANAE--YKSTLDCTEKLLKQG---S 177

Query: 85  LQKGLSCAYIYQIGLNGSRLGFYEP-IRSVLNKTFYPAMDPHKVQNVAV--NVVSGATSG 141
           L +G +   +      G     YE  I S L   F       + ++++     + GA SG
Sbjct: 178 LMRGFTATLMRTSHGFGIYFLTYETLIASQLAHGF-------RREDISAWKACMFGALSG 230

Query: 142 IIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAIL 201
                M  P  ++K+ MQ    A ++    + T++     +IYR  G +   +G    +L
Sbjct: 231 AFFWAMTYPFDVVKSVMQ----ADKLVNPAYGTNVVQVAKNIYRERGLRAFTKGFMPTML 286

Query: 202 RT 203
           R+
Sbjct: 287 RS 288

>Scas_632.9
          Length = 292

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 64/276 (23%), Positives = 110/276 (39%), Gaps = 25/276 (9%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGI-RGLQK 87
           + G +A      +  P + VK R+Q QG        I+      +K  + NEG+ RG  +
Sbjct: 22  VNGSIAGAFGKIIEYPFDTVKVRLQTQGS------HIFPTTWSCIKYTYHNEGVWRGFFQ 75

Query: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIM 147
           G+          N +    Y    +VL K  +  + P  + N+   ++SGA +G   + +
Sbjct: 76  GIGSPLFGAALENATLFVSYNQCSNVLEK--FTNVSP--LSNI---LLSGAFAGSCASFV 128

Query: 148 GSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGS 207
            +P+ LIK ++Q  +    +  Q  +T I   L  + R +G  GL++G  +  +R   G 
Sbjct: 129 LTPVELIKCKLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQGQSSTFIRESLGG 188

Query: 208 SVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMN----PWDVILTRVYNQK 263
                 Y   K  L       E     L+   VSG   G+  N    P D + + +  + 
Sbjct: 189 VAWFATYEVMKQGLKDRRKDTENKTWELL---VSGASAGLAFNASIFPADTVKSMMQTEH 245

Query: 264 GNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAP 299
             L    ++   K +   GI   Y+G    + R  P
Sbjct: 246 ITL----INAVKKVLTTYGITGFYRGLGITLIRAVP 277

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 82/192 (42%), Gaps = 21/192 (10%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSA-DAQRIYKNPMQALKVIFKNEGIRGLQ 86
            ++G  A   A  V  P+EL+K ++Q+    +A + Q  +   +  L  + + +GI GL 
Sbjct: 115 LLSGAFAGSCASFVLTPVELIKCKLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLW 174

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHK-VQNVAVNV-VSGATSGIIG 144
           +G S  +I +     +    YE ++  L        D  K  +N    + VSGA++G+  
Sbjct: 175 QGQSSTFIRESLGGVAWFATYEVMKQGLK-------DRRKDTENKTWELLVSGASAGLAF 227

Query: 145 AIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTG 204
                P   +K+ MQ           T + ++ N +  +    G  G YRG+   ++R  
Sbjct: 228 NASIFPADTVKSMMQ-----------TEHITLINAVKKVLTTYGITGFYRGLGITLIRAV 276

Query: 205 AGSSVQLPIYNT 216
             ++    +Y T
Sbjct: 277 PANATVFYMYET 288

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/185 (20%), Positives = 82/185 (44%), Gaps = 20/185 (10%)

Query: 122 MDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLS 181
           ++   VQN   ++V+G+ +G  G I+  P   +K R+Q+  + I       + + W+ + 
Sbjct: 9   IEKSSVQNALSDIVNGSIAGAFGKIIEYPFDTVKVRLQTQGSHI-------FPTTWSCIK 61

Query: 182 SIYRAEG-FKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTV 240
             Y  EG ++G ++G+ + +      ++     YN   + L K   +   + + L++   
Sbjct: 62  YTYHNEGVWRGFFQGIGSPLFGAALENATLFVSYNQCSNVLEKFTNVSPLSNI-LLSGAF 120

Query: 241 SGFGVGVVMNPWDVILTRVYNQKGNL---------YKGPLDCFVKTVRIEGIGALYKGFE 291
           +G     V+ P ++I  ++  Q  NL         +   +   +  +R +GI  L++G  
Sbjct: 121 AGSCASFVLTPVELIKCKL--QVSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQGQS 178

Query: 292 AQIFR 296
           +   R
Sbjct: 179 STFIR 183

>Scas_662.12
          Length = 308

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 78/304 (25%), Positives = 126/304 (41%), Gaps = 42/304 (13%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           I+G  A  +   + +P++L+K R+QL    +           Q       NE I   +K 
Sbjct: 12  ISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQH-------QKGYTYLINELINNSKKM 64

Query: 89  LSCAYIYQI------GLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQN-------VAVNVV 135
            S   IY +      GL  + LG    +   L  T Y +   +  QN         + + 
Sbjct: 65  GSQGPIYNLIKESYRGLPINLLG--NAVAWSLYFTIYNSTKDYMFQNNYLHNNNTTIFLT 122

Query: 136 SGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRG 195
           SG  SGI   ++ +PL++IKTR+ S S       +  Y SI +G  S+   EG K ++ G
Sbjct: 123 SGLISGISTTLLTNPLWVIKTRIMSTSRH----HKDSYKSIRHGFKSLLTKEGPKAIWMG 178

Query: 196 VDAAILRTGAGSSVQLPIYNTAK-HFLL-----KHDLMKEGTGLHLVASTVSGFGVGVVM 249
           +  ++L    G+ +   IY+  K HF +     K D       + L++S      V  V 
Sbjct: 179 LLPSLLGVSQGA-IYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLSVMSVY 237

Query: 250 NPWDVILTRVYNQKGNLYKGPLDCF------VKTVRIEGIGALYKGFEAQIFRIAPHTIL 303
            P+ ++ + +   +      P + +       K  R  GI  LYKG  A + R  P T  
Sbjct: 238 -PFQLLKSNLQTFRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAIPST-- 294

Query: 304 CLTF 307
           C+TF
Sbjct: 295 CITF 298

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 88/200 (44%), Gaps = 13/200 (6%)

Query: 23  SKTGSFIAGGMAACIAVTV-TNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG 81
           + T  F+  G+ + I+ T+ TNP+ ++KTR+        D+   YK+     K +   EG
Sbjct: 115 NNTTIFLTSGLISGISTTLLTNPLWVIKTRIMSTSRHHKDS---YKSIRHGFKSLLTKEG 171

Query: 82  IRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVN---VVSGA 138
            + +  GL  +      L  S+   Y  I   L   F   ++  K  N   N   V+  +
Sbjct: 172 PKAIWMGLLPSL-----LGVSQGAIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISS 226

Query: 139 TSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDA 198
            S ++  +   P  L+K+ +Q++ +      Q  Y  I   +  IYR  G KGLY+G+ A
Sbjct: 227 LSKMLSVMSVYPFQLLKSNLQTFRSVTNNIPQNDYHFI-TLIRKIYRDNGIKGLYKGLSA 285

Query: 199 AILRTGAGSSVQLPIYNTAK 218
            +LR    + +   IY   K
Sbjct: 286 NLLRAIPSTCITFCIYENFK 305

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 81/178 (45%), Gaps = 12/178 (6%)

Query: 125 HKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIY 184
           H++  +   ++SG ++G +  ++  PL LIK R+Q  +       Q  YT + N L +  
Sbjct: 2   HELTPIQKEIISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNS 61

Query: 185 RAEGFKG--------LYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHD-LMKEGTGLHL 235
           +  G +G         YRG+   +L      S+   IYN+ K ++ +++ L    T + L
Sbjct: 62  KKMGSQGPIYNLIKESYRGLPINLLGNAVAWSLYFTIYNSTKDYMFQNNYLHNNNTTIFL 121

Query: 236 VASTVSGFGVGVVMNPWDVILTRVYN---QKGNLYKGPLDCFVKTVRIEGIGALYKGF 290
            +  +SG    ++ NP  VI TR+ +      + YK     F   +  EG  A++ G 
Sbjct: 122 TSGLISGISTTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKSLLTKEGPKAIWMGL 179

 Score = 32.3 bits (72), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 19/86 (22%), Positives = 42/86 (48%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           +   ++  ++V    P +L+K+ +Q    ++ +  +   + +  ++ I+++ GI+GL KG
Sbjct: 223 LISSLSKMLSVMSVYPFQLLKSNLQTFRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKG 282

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVL 114
           LS   +  I         YE  +S L
Sbjct: 283 LSANLLRAIPSTCITFCIYENFKSKL 308

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score = 62.8 bits (151), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 70/284 (24%), Positives = 118/284 (41%), Gaps = 25/284 (8%)

Query: 23  SKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGI 82
           S+   F++G  +      V +P + +K R+Q     S D+ R +K P+  +   F  +GI
Sbjct: 59  SRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQ----TSQDSTR-FKGPLDCVYKTFTQQGI 113

Query: 83  RGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGI 142
           RG   G +   +  I ++   LG     R +L K  Y   +   +      ++SG  +G 
Sbjct: 114 RGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGC---IISGVMAGW 170

Query: 143 IGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAA-IL 201
             + + +P+ L K ++Q   +A    + T YT   + +  +Y + G +GLY+G+ +  I 
Sbjct: 171 SVSFIAAPVELAKAKLQVQYDA----KTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIF 226

Query: 202 RTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSG-FGVGVVMNPWDVILTRVY 260
           RT          Y     +  +H  M + T ++  +   S  FG      P DVI   V 
Sbjct: 227 RTNF--VFWWGSYELLTRWFKEHTNMSD-TAINFWSGGFSASFGFWTTAYPSDVIKQVVL 283

Query: 261 -NQKGNLYKGPLDCF---VKTV-RIEGIGALYKGFEAQIFRIAP 299
            N K   Y G    +    K + R  G    +KGF     R  P
Sbjct: 284 CNDK---YDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 83/202 (41%), Gaps = 21/202 (10%)

Query: 124 PHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSI 183
           P +  +  +  VSG  SGI    +G P   IK R+Q+  ++      T +    + +   
Sbjct: 54  PSEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDS------TRFKGPLDCVYKT 107

Query: 184 YRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEG----TGLHLVAST 239
           +  +G +G Y G    ++      SV L   +  +  L K+    E     +G  +++  
Sbjct: 108 FTQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGC-IISGV 166

Query: 240 VSGFGVGVVMNPWDVILTRV---YNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQ--- 293
           ++G+ V  +  P ++   ++   Y+ K   Y GP+D   K     G+  LYKG  +    
Sbjct: 167 MAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYKGLTSTLIF 226

Query: 294 ----IFRIAPHTILCLTFMEQT 311
               +F    + +L   F E T
Sbjct: 227 RTNFVFWWGSYELLTRWFKEHT 248

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score = 62.4 bits (150), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 71/296 (23%), Positives = 121/296 (40%), Gaps = 37/296 (12%)

Query: 23  SKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGI 82
           S+   F+AG  +     TV +P + VK R+Q   ++ + A   +K P+  +    KN+GI
Sbjct: 8   SRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTS-QVGSGAGIQFKGPLDCVYKTLKNQGI 66

Query: 83  RGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGI 142
           RGL  G +      I ++ + LG     R +L+K  YP  D   +      ++SG  +G 
Sbjct: 67  RGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGC---IISGVMAGW 123

Query: 143 IGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRA--------EGFKGLYR 194
             + + +P+ L K ++Q   +A    + T YT   + +  +++          G + LY+
Sbjct: 124 TVSFIAAPVELAKAKLQVQYDA----KTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYK 179

Query: 195 G-VDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMK----EGTGLHLVASTVSG-FGVGVV 248
           G +   I R+         ++    + L+     K        ++  A  +S  FG    
Sbjct: 180 GLISTLIFRSNF-------VFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTS 232

Query: 249 MNPWDVILTRVY-NQKGNLYKGPLDCFVKTV----RIEGIGALYKGFEAQIFRIAP 299
             P DV+   V  N K   Y G    +   V    R  GI   +KGF     R  P
Sbjct: 233 AYPSDVVKQVVLCNDK---YDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFP 285

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 62.0 bits (149), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 77/197 (39%), Gaps = 18/197 (9%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           ++G +A   A  + NP + VK R+QL   +     R++       K I++NEG       
Sbjct: 125 LSGTIATIAADALMNPFDTVKQRLQLDTNL-----RVW----NVTKQIYQNEGFAAFYYS 175

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMG 148
                   I         YE      N        P    N  ++ + G  SG   A + 
Sbjct: 176 YPTTLAMNIPFAAFNFMIYESASKFFN--------PQNSYNPLIHCLCGGISGATCAALT 227

Query: 149 SPLFLIKTRMQSY-SNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGS 207
           +PL  IKT +Q   S  + I       +      +I    G+KG +RG+   I+     +
Sbjct: 228 TPLDCIKTVLQVRGSETVSIEIMKDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPAT 287

Query: 208 SVQLPIYNTAKHFLLKH 224
           ++    Y  AKHFL+K+
Sbjct: 288 AISWTAYECAKHFLMKN 304

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/230 (22%), Positives = 86/230 (37%), Gaps = 21/230 (9%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK 87
            +AG  A  +  ++  PI+ +KTR+Q  G   A +  +    +  +  I   EG   L K
Sbjct: 27  LLAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAASTGM----ISQISKISTMEGSMALWK 82

Query: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIM 147
           G+    +     +    G YE  ++ L       M  H+    A   +SG  + I    +
Sbjct: 83  GVQSVILGAGPAHAVYFGTYEFCKARLISP--EDMQTHQPMKTA---LSGTIATIAADAL 137

Query: 148 GSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGS 207
            +P   +K R+Q  +N            +WN    IY+ EGF   Y      +      +
Sbjct: 138 MNPFDTVKQRLQLDTN----------LRVWNVTKQIYQNEGFAAFYYSYPTTLAMNIPFA 187

Query: 208 SVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILT 257
           +    IY +A  F    +       +H +   +SG     +  P D I T
Sbjct: 188 AFNFMIYESASKFFNPQN--SYNPLIHCLCGGISGATCAALTTPLDCIKT 235

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 81/201 (40%), Gaps = 34/201 (16%)

Query: 99  LNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRM 158
           +N S L   E I        Y A+  H    +   +++GA +GI+   +  P+  +KTR+
Sbjct: 1   MNTSELSIAEEID-------YEALPSHA--PLHSQLLAGAFAGIMEHSLMFPIDALKTRV 51

Query: 159 QSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAK 218
           Q+         +   T + + +S I   EG   L++GV + IL  G   +V    Y   K
Sbjct: 52  QAAG-----LNKAASTGMISQISKISTMEGSMALWKGVQSVILGAGPAHAVYFGTYEFCK 106

Query: 219 HFLLKHDLMKEGTGLHLVAS-TVSGFGVGVVMNPWDVILT--------RVYNQKGNLYKG 269
             L+  + M+    +    S T++      +MNP+D +          RV+N    +Y+ 
Sbjct: 107 ARLISPEDMQTHQPMKTALSGTIATIAADALMNPFDTVKQRLQLDTNLRVWNVTKQIYQN 166

Query: 270 PLDCFVKTVRIEGIGALYKGF 290
                      EG  A Y  +
Sbjct: 167 -----------EGFAAFYYSY 176

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 62.4 bits (150), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 87/202 (43%), Gaps = 10/202 (4%)

Query: 30  AGGMAACIAVTVTNPIELVKTRMQLQG---EMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           AG +    +  V  P E++KTR+QLQG        +   Y+    A++ I + EG+  L 
Sbjct: 154 AGFLGDLFSSVVYVPSEVLKTRLQLQGCYNNRHFQSGYNYRGLSDAVRTIVRTEGVSALF 213

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146
            G        +  +  +  FYE  R          +D H   +    VV+GA++G +  I
Sbjct: 214 FGYKATLSRDLPFSALQFAFYERFRKWAFLLERKPVDGH--LSFTAEVVTGASAGGLAGI 271

Query: 147 MGSPLFLIKTRMQSYSNAIQIGQQTHYT-----SIWNGLSSIYRAEGFKGLYRGVDAAIL 201
           + +PL ++KTR+Q+                   SI+  L  + R EG  G + GV    +
Sbjct: 272 ITTPLDVVKTRIQTQPRGSAGTPDASAPARLNGSIFRSLLVVLRYEGLGGAFSGVGPRFI 331

Query: 202 RTGAGSSVQLPIYNTAKHFLLK 223
            T   SS+ L +Y TA   L +
Sbjct: 332 WTSIQSSIMLLLYQTALRTLAR 353

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 81/178 (45%), Gaps = 17/178 (9%)

Query: 154 IKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFK-GLYRGVDAAILRTGAGSSVQLP 212
           +KTR Q     ++      Y  + +   ++   EG + GLY G  AA+L +   ++V   
Sbjct: 77  VKTRQQGAPGEVK------YRHMISAYRTLALEEGVRRGLYGGYGAAMLGSFPSAAVFFG 130

Query: 213 IYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRV-----YN----QK 263
            Y   K  ++    + E T  HL A  +      VV  P +V+ TR+     YN    Q 
Sbjct: 131 TYEWVKRQMINEWQIHE-TYSHLAAGFLGDLFSSVVYVPSEVLKTRLQLQGCYNNRHFQS 189

Query: 264 GNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYAVEKQ 321
           G  Y+G  D     VR EG+ AL+ G++A + R  P + L   F E+  K  + +E++
Sbjct: 190 GYNYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAFYERFRKWAFLLERK 247

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 60/272 (22%), Positives = 110/272 (40%), Gaps = 37/272 (13%)

Query: 40  TVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGI-RGLQKGLSCAYIYQIG 98
           +V + ++ VKTR Q      A  +  Y++ + A + +   EG+ RGL  G   A +    
Sbjct: 69  SVMHSLDTVKTRQQ-----GAPGEVKYRHMISAYRTLALEEGVRRGLYGGYGAAMLGSFP 123

Query: 99  LNGSRLGFYEPI-RSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTR 157
                 G YE + R ++N+         ++     ++ +G    +  +++  P  ++KTR
Sbjct: 124 SAAVFFGTYEWVKRQMINEW--------QIHETYSHLAAGFLGDLFSSVVYVPSEVLKTR 175

Query: 158 MQ---SYSNA-IQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPI 213
           +Q    Y+N   Q G   +Y  + + + +I R EG   L+ G  A + R    S++Q   
Sbjct: 176 LQLQGCYNNRHFQSGY--NYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLPFSALQFAF 233

Query: 214 YNTAKHFLLKHDLMKEGTGLHLVASTVSGFG----VGVVMNPWDVILTRVYNQKGNLYKG 269
           Y   + +    +       L   A  V+G       G++  P DV+ TR+  Q       
Sbjct: 234 YERFRKWAFLLERKPVDGHLSFTAEVVTGASAGGLAGIITTPLDVVKTRIQTQPRGSAGT 293

Query: 270 P------------LDCFVKTVRIEGIGALYKG 289
           P                +  +R EG+G  + G
Sbjct: 294 PDASAPARLNGSIFRSLLVVLRYEGLGGAFSG 325

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 43/80 (53%), Gaps = 6/80 (7%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSA---DAQ---RIYKNPMQALKV 75
           +S T   + G  A  +A  +T P+++VKTR+Q Q   SA   DA    R+  +  ++L V
Sbjct: 253 LSFTAEVVTGASAGGLAGIITTPLDVVKTRIQTQPRGSAGTPDASAPARLNGSIFRSLLV 312

Query: 76  IFKNEGIRGLQKGLSCAYIY 95
           + + EG+ G   G+   +I+
Sbjct: 313 VLRYEGLGGAFSGVGPRFIW 332

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 84/195 (43%), Gaps = 30/195 (15%)

Query: 31  GGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNE---GIR-GLQ 86
           G +AAC+   V  P E+VK R Q     S+          + L+ I KNE   G+R  L 
Sbjct: 103 GEIAACM---VRVPAEVVKQRSQTHASHSS---------WETLREILKNENGEGVRRNLY 150

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146
           +G S   + +I     +   YE ++ V     +  +D           V G+ +G I A 
Sbjct: 151 RGWSTTIMREIPFTCIQFPLYEYMKKV-----WAELDESDRVEPWKGAVCGSIAGGIAAA 205

Query: 147 MGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAG 206
             +PL  +KTR+     +I +G           +S+IY+ EGFK  + GV    +   AG
Sbjct: 206 TTTPLDFLKTRLMLCKKSIPLGTL---------VSTIYKEEGFKVFFSGVGPRTMWISAG 256

Query: 207 SSVQLPIYNTAKHFL 221
            ++ L IY T    L
Sbjct: 257 GAIFLGIYETVHSLL 271

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/273 (23%), Positives = 111/273 (40%), Gaps = 45/273 (16%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           S ++G  A      V  PI+ +KTR+Q +G                    F+N G RG+ 
Sbjct: 8   SLLSGAAAGTSTDLVFFPIDTLKTRLQAKGGF------------------FRNGGYRGVY 49

Query: 87  KGLSCAYIYQIGLNGSRLGF--YEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIG 144
           +GL  A +      G+ L F  Y+  ++     F   +    V +V  ++ S +   I  
Sbjct: 50  RGLGSAVVASA--PGASLFFITYDTCKAETRGFFRGLLPSSNVADVVTHMFSSSMGEIAA 107

Query: 145 AIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKG----LYRGVDAAI 200
            ++  P  ++K R Q++++           S W  L  I + E  +G    LYRG    I
Sbjct: 108 CMVRVPAEVVKQRSQTHASH----------SSWETLREILKNENGEGVRRNLYRGWSTTI 157

Query: 201 LRTGAGSSVQLPIYNTAKHF---LLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILT 257
           +R    + +Q P+Y   K     L + D ++   G   V  +++G        P D + T
Sbjct: 158 MREIPFTCIQFPLYEYMKKVWAELDESDRVEPWKG--AVCGSIAGGIAAATTTPLDFLKT 215

Query: 258 RVYNQKGNLYKGPLDCFVKTV-RIEGIGALYKG 289
           R+   K ++   PL   V T+ + EG    + G
Sbjct: 216 RLMLCKKSI---PLGTLVSTIYKEEGFKVFFSG 245

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 87/196 (44%), Gaps = 33/196 (16%)

Query: 132 VNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKG 191
           ++++SGA +G    ++  P+  +KTR+Q+                       +R  G++G
Sbjct: 7   ISLLSGAAAGTSTDLVFFPIDTLKTRLQAKGG-------------------FFRNGGYRG 47

Query: 192 LYRGVDAAILRTGAGSSVQLPIYNTAKH--------FLLKHDLMKEGTGLHLVASTVSGF 243
           +YRG+ +A++ +  G+S+    Y+T K          L   ++    T  H+ +S++   
Sbjct: 48  VYRGLGSAVVASAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVT--HMFSSSMGEI 105

Query: 244 GVGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGA-LYKGFEAQIFRIAPHTI 302
              +V  P +V+  R      +     L   +K    EG+   LY+G+   I R  P T 
Sbjct: 106 AACMVRVPAEVVKQRSQTHASHSSWETLREILKNENGEGVRRNLYRGWSTTIMREIPFT- 164

Query: 303 LCLTF-MEQTMKVVYA 317
            C+ F + + MK V+A
Sbjct: 165 -CIQFPLYEYMKKVWA 179

 Score = 32.3 bits (72), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 41/96 (42%), Gaps = 10/96 (10%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQAL-KVIFKNEGIRGLQK 87
           + G +A  IA   T P++ +KTR+ L  +           P+  L   I+K EG +    
Sbjct: 194 VCGSIAGGIAAATTTPLDFLKTRLMLCKK---------SIPLGTLVSTIYKEEGFKVFFS 244

Query: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMD 123
           G+    ++        LG YE + S+L+    P  +
Sbjct: 245 GVGPRTMWISAGGAIFLGIYETVHSLLSTNKKPTRN 280

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 86/190 (45%), Gaps = 13/190 (6%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK 87
            I+GG+A   A  V  P+ELVK ++Q+     A A+  +   +  +K I    G+ GL +
Sbjct: 111 LISGGVAGSCASLVLTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQ 170

Query: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQN-VAVNVVSGATSGIIGAI 146
           G S  +I +     +    YE ++  L K  +   DP + ++ +   ++SG ++G+    
Sbjct: 171 GQSGTFIRESFGGVAWFATYEIVKKSL-KDRHSLDDPKRDESKIWELLISGGSAGLAFNA 229

Query: 147 MGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAG 206
              P   +K+ M           QT + S+ N +  I+   G KG YRG+   + R    
Sbjct: 230 SIFPADTVKSVM-----------QTEHISLTNAVKKIFGKFGLKGFYRGLGITLFRAVPA 278

Query: 207 SSVQLPIYNT 216
           ++    I+ T
Sbjct: 279 NAAVFYIFET 288

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 62/283 (21%), Positives = 110/283 (38%), Gaps = 35/283 (12%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGI-RGLQK 87
           I G +A      +  P + VK R+Q Q      A  ++      +K  ++NEGI RG  +
Sbjct: 18  INGSIAGACGKVIEFPFDTVKVRLQTQ------ASNVFPTTWSCIKFTYQNEGIARGFFQ 71

Query: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVLNK--TFYPAMDPHKVQNVAVNVVSGATSGIIGA 145
           G++   +     N +    Y      L K    +P         +   ++SG  +G   +
Sbjct: 72  GIASPLVGACLENATLFVSYNQCSKFLEKHTNVFP---------LGQILISGGVAGSCAS 122

Query: 146 IMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGA 205
           ++ +P+ L+K ++Q  +N      +T +T +   + +I    G  GL++G     +R   
Sbjct: 123 LVLTPVELVKCKLQ-VANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESF 181

Query: 206 GSSVQLPIYNTAKHFLL-KHDL----MKEGTGLHLVASTVSGFGVGVVMN----PWDVIL 256
           G       Y   K  L  +H L      E     L+   +SG   G+  N    P D + 
Sbjct: 182 GGVAWFATYEIVKKSLKDRHSLDDPKRDESKIWELL---ISGGSAGLAFNASIFPADTVK 238

Query: 257 TRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAP 299
           + +  +  +L       F K     G+   Y+G    +FR  P
Sbjct: 239 SVMQTEHISLTNAVKKIFGKF----GLKGFYRGLGITLFRAVP 277

 Score = 29.6 bits (65), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 30/62 (48%), Gaps = 3/62 (4%)

Query: 229 EGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYK 288
           EG  L ++  +++G    V+  P+D +  R+  Q  N++     C   T + EGI    +
Sbjct: 11  EGAILDIINGSIAGACGKVIEFPFDTVKVRLQTQASNVFPTTWSCIKFTYQNEGIA---R 67

Query: 289 GF 290
           GF
Sbjct: 68  GF 69

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 61.6 bits (148), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 68/282 (24%), Positives = 126/282 (44%), Gaps = 41/282 (14%)

Query: 66  YKNPMQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRS-VLNKTFYPAMDP 124
           + +  +A   I + EG+  L +GLS   +  I  N      YE  R     +  YP+++P
Sbjct: 97  FNSTWEAFTKISEVEGLATLWRGLSITLLMAIPANVVYFSGYEMFRDHSPMRDSYPSLNP 156

Query: 125 HKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQ-IGQQTHYTSIWNGLSSI 183
                    +  GAT+ ++ A   +PL LIKTR+QS   + +    Q  +  +     + 
Sbjct: 157 ---------LFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNE 207

Query: 184 YRAEGFKGLYRGVDAAILRTGAGSSVQLPIYN-TAKHFLLKHDLMKEGTGLHL------- 235
            R+ G+K L++G++  + R    S++    Y    K+F +  D  ++    +L       
Sbjct: 208 IRSGGYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWI--DFSEQCLRWNLSPNWDFF 265

Query: 236 ----VASTVSGFGVGVVMNPWDVILTR------VYNQKGNLYKGP--------LDCFVKT 277
               +  +VSG    ++ +P+DV  TR      + N++ N    P        +  F+  
Sbjct: 266 INSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYN 325

Query: 278 VR-IEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYAV 318
           ++  EG GALY G   ++ +IAP   + ++  E + K ++AV
Sbjct: 326 IKQTEGYGALYTGLIPRVMKIAPSCAIMISTYELS-KRLFAV 366

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 87/211 (41%), Gaps = 22/211 (10%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSAD--AQRIYKNPMQALKVIFKNEGIRGLQ 86
             G  A  +A T   P+EL+KTR+Q       D   Q ++K+ ++  +   ++ G + L 
Sbjct: 158 FCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSGGYKVLF 217

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQ-NVAVN-------VVSGA 138
           KGL       +  +    G YE       K F+       ++ N++ N        + G+
Sbjct: 218 KGLEITLWRDVPFSAIYWGSYE----FYKKNFWIDFSEQCLRWNLSPNWDFFINSFIGGS 273

Query: 139 TSGIIGAIMGSPLFLIKTRMQ--------SYSNAIQIGQQTHYTSIWNGLSSIYRAEGFK 190
            SG   A++  P  + KTRMQ          +  +   ++     ++  L +I + EG+ 
Sbjct: 274 VSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQTEGYG 333

Query: 191 GLYRGVDAAILRTGAGSSVQLPIYNTAKHFL 221
            LY G+   +++     ++ +  Y  +K   
Sbjct: 334 ALYTGLIPRVMKIAPSCAIMISTYELSKRLF 364

 Score = 28.5 bits (62), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 7/64 (10%)

Query: 26  GSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGL 85
            SFI G ++   A  +T+P ++ KTRMQ+    + D +   +N + + K   K    RG+
Sbjct: 267 NSFIGGSVSGSSAALLTHPFDVGKTRMQI----TMDIENKQRNTLVSPK---KRVSARGM 319

Query: 86  QKGL 89
            K L
Sbjct: 320 FKFL 323

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 55/191 (28%), Positives = 86/191 (45%), Gaps = 28/191 (14%)

Query: 22  VSKTGSFIAGGMAACIA--------VTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQAL 73
           +S  GS I GG+   +A         T    +E+ K +       SA A  I ++   A 
Sbjct: 105 LSNFGSGIMGGVTGGVAQAYLTMGFCTCMKTVEITKKK-------SAGAGAIPQSSWGAF 157

Query: 74  KVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFY----EPIRSVLNKTFYPAMDPHKVQN 129
           K I+K +GI+G+ KG++   I Q+   GSR GF     E IR+   KT  P      ++ 
Sbjct: 158 KEIYKKDGIKGINKGVNAVAIRQMTNWGSRFGFSRLVEEGIRNATGKT-NPDDKLTALEK 216

Query: 130 VAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGF 189
           +A + + G  S         P+ +I+  MQS     +   +    ++ +    IY++ G 
Sbjct: 217 IAASAIGGGLSA-----WNQPIEVIRVEMQSKK---EDPNRPKNLTVSSAFKYIYQSSGI 268

Query: 190 KGLYRGVDAAI 200
           KGLYRGV   I
Sbjct: 269 KGLYRGVAPRI 279

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 63/301 (20%), Positives = 117/301 (38%), Gaps = 35/301 (11%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK 87
            +  G+  C   T+  P+E++KT M         A R + +   A+K ++   G+ G  +
Sbjct: 22  LLGAGLNMCEVTTLGQPLEVIKTTMA--------ANRSF-SFFNAIKHVWSRGGVFGFYQ 72

Query: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAV-NVVSGATSGIIGAI 146
           GL      +    G+ L             F  A   ++ + + + N  SG   G+ G +
Sbjct: 73  GLIPWAWIEASTKGAVL------------LFVSAESEYQFKRMGLSNFGSGIMGGVTGGV 120

Query: 147 MGSPL---FLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILR- 202
             + L   F    +    +     G      S W     IY+ +G KG+ +GV+A  +R 
Sbjct: 121 AQAYLTMGFCTCMKTVEITKKKSAGAGAIPQSSWGAFKEIYKKDGIKGINKGVNAVAIRQ 180

Query: 203 -TGAGSSVQLP--IYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRV 259
            T  GS       +    ++   K +   + T L  +A++  G G+     P +VI   +
Sbjct: 181 MTNWGSRFGFSRLVEEGIRNATGKTNPDDKLTALEKIAASAIGGGLSAWNQPIEVIRVEM 240

Query: 260 YNQKGNLYKGPLDCFVKTV-----RIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKV 314
            ++K +  + P +  V +      +  GI  LY+G   +I      T+  + F +     
Sbjct: 241 QSKKEDPNR-PKNLTVSSAFKYIYQSSGIKGLYRGVAPRIGLGVWQTVFMVGFGDMARDF 299

Query: 315 V 315
           V
Sbjct: 300 V 300

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 73/310 (23%), Positives = 117/310 (37%), Gaps = 52/310 (16%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
             +AG       V V  P +  K R+Q     +          M+ ++ +  NEG RG  
Sbjct: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPT--------TAMEVVRKLLANEGPRGFY 79

Query: 87  KGLSCAYI-------YQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGAT 139
           KG     I        Q G+N +   F+    + ++ T           ++      G T
Sbjct: 80  KGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTL----------SLPQYYACGVT 129

Query: 140 SGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAA 199
            GI+ + + SP+  ++ R+Q+     Q G  T+       L  I +    K L RG+   
Sbjct: 130 GGIVNSFLASPIEHVRIRLQT-----QTGSGTN-AEFKGPLECIKKLRHNKALLRGLTPT 183

Query: 200 ILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLH---------LVASTVSGFGVGVVMN 250
           ILR G G      +Y       L  + M +  GL           +   +SG  + +++ 
Sbjct: 184 ILREGHGCGTYFLVYEA-----LIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVY 238

Query: 251 PWDVILTRVYNQKGNLYK----GPLDCFVKTVRIEG-IGALYKGFEAQIFRIAPHTILCL 305
           P DVI  +   Q  NL K      +    KT+   G IGA +KGF   + R AP      
Sbjct: 239 PLDVI--KSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATF 296

Query: 306 TFMEQTMKVV 315
              E  M+++
Sbjct: 297 ATFELAMRLL 306

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 74/180 (41%), Gaps = 21/180 (11%)

Query: 125 HKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIY 184
           H    V  ++++G   GI   ++G P    K R+Q+ S           T+    +  + 
Sbjct: 20  HDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP---------TTAMEVVRKLL 70

Query: 185 RAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFG 244
             EG +G Y+G    ++  GA  S+Q  +    K F   H      + L L      G  
Sbjct: 71  ANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRF-FHHRNADMSSTLSLPQYYACGVT 129

Query: 245 VGVV----MNPWDVILTRVYNQKGN----LYKGPLDCFVKTVRIEGIGALYKGFEAQIFR 296
            G+V     +P + +  R+  Q G+     +KGPL+C +K +R     AL +G    I R
Sbjct: 130 GGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLEC-IKKLRHN--KALLRGLTPTILR 186

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 60.1 bits (144), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 78/199 (39%), Gaps = 22/199 (11%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
            +G  A   A  + NP +++K R+QL   +S              K I+  EG +     
Sbjct: 126 FSGATATIAADALMNPFDVIKQRIQLNTNISV---------WDTAKRIYSKEGFQAFYSS 176

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMG 148
                   I       G Y+      N        P  V N  ++ + G  SG   A + 
Sbjct: 177 YPTTLAINIPFAAFNFGIYDTATRYFN--------PSGVYNPFIHCLCGGISGAACAGLT 228

Query: 149 SPLFLIKTRMQ---SYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGA 205
           +PL  IKT +Q   S   ++++ +Q    +      +IY+  G++G + GV   IL    
Sbjct: 229 TPLDCIKTALQVRGSEKVSMEVFKQA--DTFKKATRAIYQVYGWRGFWSGVKPRILANMP 286

Query: 206 GSSVQLPIYNTAKHFLLKH 224
            +++    Y  AKHFL  +
Sbjct: 287 ATAISWTAYEFAKHFLFHY 305

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 76/176 (43%), Gaps = 11/176 (6%)

Query: 119 YPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWN 178
           Y A+  H    +A  +++GA +GI    +  PL  +KTR+Q+       G Q   +++  
Sbjct: 9   YEALPDHA--PLAHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLR 66

Query: 179 GLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVAS 238
            LSSI   EG   L++GV + +L  G   +V    Y   K FL+  D     +  H   +
Sbjct: 67  QLSSISAQEGSMVLWKGVQSVLLGAGPAHAVYFATYEMVKSFLI--DEATSTSKYHFFKT 124

Query: 239 TVSG----FGVGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGF 290
             SG         +MNP+DVI  R+   + N      D   +    EG  A Y  +
Sbjct: 125 AFSGATATIAADALMNPFDVIKQRI---QLNTNISVWDTAKRIYSKEGFQAFYSSY 177

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 66/291 (22%), Positives = 109/291 (37%), Gaps = 27/291 (9%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSAD-AQRIYKNPMQALKVIFKNEGIRGLQK 87
           +AG  A     +V  P++ +KTR+Q    +S    Q I    ++ L  I   EG   L K
Sbjct: 23  MAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQPIPSTMLRQLSSISAQEGSMVLWK 82

Query: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIM 147
           G+    +     +      YE ++S L          H  +       SGAT+ I    +
Sbjct: 83  GVQSVLLGAGPAHAVYFATYEMVKSFLIDEATSTSKYHFFK----TAFSGATATIAADAL 138

Query: 148 GSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGS 207
            +P  +IK R+Q  +N           S+W+    IY  EGF+  Y      +      +
Sbjct: 139 MNPFDVIKQRIQLNTN----------ISVWDTAKRIYSKEGFQAFYSSYPTTLAINIPFA 188

Query: 208 SVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQKG--- 264
           +    IY+TA  +     +      +H +   +SG     +  P D I T +  +     
Sbjct: 189 AFNFGIYDTATRYFNPSGVYNP--FIHCLCGGISGAACAGLTTPLDCIKTALQVRGSEKV 246

Query: 265 --NLYKGPLDCFVKTVR----IEGIGALYKGFEAQIFRIAPHTILCLTFME 309
              ++K   D F K  R    + G    + G + +I    P T +  T  E
Sbjct: 247 SMEVFKQ-ADTFKKATRAIYQVYGWRGFWSGVKPRILANMPATAISWTAYE 296

>Scas_667.22
          Length = 306

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 66/301 (21%), Positives = 124/301 (41%), Gaps = 35/301 (11%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
             +AG       V V  P +  K R+Q     +          M+ ++ + KNEG +G  
Sbjct: 28  DLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA--------MEVIRKLLKNEGPKGFY 79

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPH---KVQNVAVNVVSGATSGII 143
           KG     I        + G  E +     K F+ + +P    ++ ++    + G T GI 
Sbjct: 80  KGTLTPLIGVGACVSLQFGVNEAM-----KRFFHSRNPDSTSQILSLPQYYICGLTGGIT 134

Query: 144 GAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRT 203
            + + SP+  ++ R+Q+ + +   G    +    + +  + RA+G  G  RG+   +LR 
Sbjct: 135 NSFLASPIEHVRIRLQTQTGS---GPNVEFKGPLDCIRKL-RAQG--GFMRGLTPTMLRE 188

Query: 204 GAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVA------STVSGFGVGVVMNPWDVI-- 255
           G G      +Y      ++ +++ K      + A        +SG  + +++ P DVI  
Sbjct: 189 GHGCGTYFLVYEA----MVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIKS 244

Query: 256 LTRVYNQKGNLYKGPLDCFVKTVRIEG-IGALYKGFEAQIFRIAPHTILCLTFMEQTMKV 314
           + +  N K   Y   +    KT+  +G +GA +KGF   + R AP         E  M++
Sbjct: 245 VMQTDNLKSPKYGNSISSVAKTLYAKGGLGAFFKGFGPTMLRAAPANGATFATFELAMRL 304

Query: 315 V 315
           +
Sbjct: 305 L 305

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 75/180 (41%), Gaps = 20/180 (11%)

Query: 125 HKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIY 184
           H    V  ++++G   GI   ++G P    K R+Q+ S           T+    +  + 
Sbjct: 20  HDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP---------TTAMEVIRKLL 70

Query: 185 RAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFG 244
           + EG KG Y+G    ++  GA  S+Q  +    K F    +       L L    + G  
Sbjct: 71  KNEGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQYYICGLT 130

Query: 245 VGV----VMNPWDVILTRVYNQKGN----LYKGPLDCFVKTVRIEGIGALYKGFEAQIFR 296
            G+    + +P + +  R+  Q G+     +KGPLDC ++ +R +  G   +G    + R
Sbjct: 131 GGITNSFLASPIEHVRIRLQTQTGSGPNVEFKGPLDC-IRKLRAQ--GGFMRGLTPTMLR 187

>Kwal_23.3529
          Length = 395

 Score = 59.7 bits (143), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 96/205 (46%), Gaps = 18/205 (8%)

Query: 22  VSKTGSFIAGGMAACIAVTVTN-PIELVKTRMQLQG---EMSADAQRIYKNPMQALKVIF 77
           V++T S +  G++  +  +V   P E++KTR+QLQG        +   Y+N   A+  I 
Sbjct: 177 VNETLSHLTAGLSGDLVSSVVYVPSEVLKTRLQLQGCYNNPHFHSGYNYRNLRDAITAIV 236

Query: 78  KNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIR----SVLNKTFYPAMDPHKVQNVAVN 133
           + EG + L  G        +  +  +  FYE  R    ++  KT  P+ D   +  +   
Sbjct: 237 RLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFRQWAFTLEGKT--PSQDLSLLNELLTG 294

Query: 134 VVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWN----GLSSIYRAEGF 189
             +G  +GII     +P+ +IKTR+Q+   +      T    I N    GL+++YR+EG 
Sbjct: 295 AAAGGLAGIIT----TPMDVIKTRIQTQMPSTVASDSTRLVRIENSLIKGLTAVYRSEGT 350

Query: 190 KGLYRGVDAAILRTGAGSSVQLPIY 214
            G + GV    + T   SS+ L +Y
Sbjct: 351 LGFFSGVGPRFIWTSIQSSIMLLLY 375

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/262 (24%), Positives = 113/262 (43%), Gaps = 29/262 (11%)

Query: 40  TVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGI-RGLQKGLSCAYIYQIG 98
           +V + ++ VKTR Q      A     Y+N + A + IF  EGI RGL  G + A +    
Sbjct: 101 SVMHSLDTVKTRQQ-----GAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFP 155

Query: 99  LNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRM 158
                 G YE  +  L       +D   V     ++ +G +  ++ +++  P  ++KTR+
Sbjct: 156 SAAIFFGTYELTKRKL-------IDDWGVNETLSHLTAGLSGDLVSSVVYVPSEVLKTRL 208

Query: 159 Q---SYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYN 215
           Q    Y+N        +Y ++ + +++I R EG++ L+ G  A + R    S+ Q   Y 
Sbjct: 209 QLQGCYNNP-HFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYE 267

Query: 216 TAKHFLLKHDLMKEGTGLHLV----ASTVSGFGVGVVMNPWDVILTRVYNQKGNLYKGPL 271
             + +    +       L L+        +G   G++  P DVI TR+  Q  +      
Sbjct: 268 KFRQWAFTLEGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQMPSTVASDS 327

Query: 272 DCFVKTVRIE-----GIGALYK 288
               + VRIE     G+ A+Y+
Sbjct: 328 ---TRLVRIENSLIKGLTAVYR 346

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 75/176 (42%), Gaps = 17/176 (9%)

Query: 154 IKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGF-KGLYRGVDAAILRTGAGSSVQLP 212
           +KTR Q   NA +      Y ++ +    I+  EG  +GLY G  AA+L +   +++   
Sbjct: 109 VKTRQQGAPNAPK------YRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFPSAAIFFG 162

Query: 213 IYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRV-----YN----QK 263
            Y   K  L+  D     T  HL A         VV  P +V+ TR+     YN      
Sbjct: 163 TYELTKRKLID-DWGVNETLSHLTAGLSGDLVSSVVYVPSEVLKTRLQLQGCYNNPHFHS 221

Query: 264 GNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYAVE 319
           G  Y+   D     VR+EG   L+ G++A + R  P +     F E+  +  + +E
Sbjct: 222 GYNYRNLRDAITAIVRLEGWQTLFFGYKATLCRDLPFSAFQFAFYEKFRQWAFTLE 277

>Scas_558.2
          Length = 289

 Score = 58.9 bits (141), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 84/201 (41%), Gaps = 31/201 (15%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG----IRG 84
           IA  M    A  V  P E++K R Q+    S+          Q  + I KNE     IR 
Sbjct: 104 IASSMGELAACLVRVPAEVIKQRTQVHSTNSS---------WQTFRTILKNENQEGIIRN 154

Query: 85  LQKGLSCAYIYQIGLNGSRLGFYEPIRS--VLNKTFYPAMDPHKVQNVAVNVVSGATSGI 142
           L +G S   + +I     +   YE ++    L       + P K        + G+ +G 
Sbjct: 155 LYRGWSTTIMREIPFTCIQFPLYEFMKKEWALYDNEVGHLKPWK------GAICGSIAGG 208

Query: 143 IGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILR 202
           I A   +PL  +KTR+    ++I I            + +IY+ EGFK  + G+    + 
Sbjct: 209 IAAATTTPLDFLKTRLMLNKDSIPIKSL---------IRNIYKEEGFKIFFSGIYPRTMW 259

Query: 203 TGAGSSVQLPIYNTAKHFLLK 223
             AG ++ L +Y T  HF+L+
Sbjct: 260 ISAGGAIFLGVYETM-HFMLQ 279

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/282 (20%), Positives = 111/282 (39%), Gaps = 57/282 (20%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           S ++G  A      V  PI+ +KTR+Q +G                    F+N G  G+ 
Sbjct: 9   SLLSGAAAGTSTDLVFFPIDTLKTRLQAKGGF------------------FQNGGYHGIY 50

Query: 87  KGLSCAYI--------YQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGA 138
           +GL  A +        + +  +  ++     +  V+N +      PH V  + V++++ +
Sbjct: 51  RGLGSAVVASAPSASLFFVTYDSMKVRVRPHVERVINSS--GTRSPHSVDTI-VHMIASS 107

Query: 139 TSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKG----LYR 194
              +   ++  P  +IK R Q +S            S W    +I + E  +G    LYR
Sbjct: 108 MGELAACLVRVPAEVIKQRTQVHST----------NSSWQTFRTILKNENQEGIIRNLYR 157

Query: 195 GVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHL------VASTVSGFGVGVV 248
           G    I+R    + +Q P+Y     F+ K   + +    HL      +  +++G      
Sbjct: 158 GWSTTIMREIPFTCIQFPLYE----FMKKEWALYDNEVGHLKPWKGAICGSIAGGIAAAT 213

Query: 249 MNPWDVILTRVYNQKGNLYKGPLDCFVKTV-RIEGIGALYKG 289
             P D + TR+   K ++   P+   ++ + + EG    + G
Sbjct: 214 TTPLDFLKTRLMLNKDSI---PIKSLIRNIYKEEGFKIFFSG 252

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 88/200 (44%), Gaps = 34/200 (17%)

Query: 132 VNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKG 191
           ++++SGA +G    ++  P+  +KTR+Q+     Q G                   G+ G
Sbjct: 8   MSLLSGAAAGTSTDLVFFPIDTLKTRLQAKGGFFQNG-------------------GYHG 48

Query: 192 LYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKH-DLMKEGTG----------LHLVASTV 240
           +YRG+ +A++ +   +S+    Y++ K  +  H + +   +G          +H++AS++
Sbjct: 49  IYRGLGSAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIASSM 108

Query: 241 SGFGVGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEG-IGALYKGFEAQIFRIAP 299
                 +V  P +VI  R      N         +K    EG I  LY+G+   I R  P
Sbjct: 109 GELAACLVRVPAEVIKQRTQVHSTNSSWQTFRTILKNENQEGIIRNLYRGWSTTIMREIP 168

Query: 300 HTILCLTF-MEQTMKVVYAV 318
            T  C+ F + + MK  +A+
Sbjct: 169 FT--CIQFPLYEFMKKEWAL 186

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 70/297 (23%), Positives = 120/297 (40%), Gaps = 51/297 (17%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
            AG +     V V  P +  K R+Q     +          ++ L+ + KNEG+    KG
Sbjct: 39  FAGTIGGIAQVLVGQPFDTTKVRLQTATTRTTT--------LEVLRNLVKNEGVFAFYKG 90

Query: 89  LSCAYI-------YQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNV------- 134
                +        Q G+N +   F++   +  N    P M    V     N        
Sbjct: 91  ALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKN----PNMSSQDVDLSRSNTLPLSQYY 146

Query: 135 VSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYR 194
           V G T G++ + + SP+  I+ R+Q+ ++    G    +   W+ +  + +A+G  GL R
Sbjct: 147 VCGLTGGVVNSFLASPIEQIRIRLQTQTSN---GGDREFKGPWDCIKKL-KAQG--GLMR 200

Query: 195 GVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLH---------LVASTVSGFGV 245
           G+   ++R G G      +Y      L+  ++   GTGL           +    SG  +
Sbjct: 201 GLFPTMIRAGHGLGTYFLVYEA----LVAREI---GTGLTRNEIPPWKLCLFGAFSGTML 253

Query: 246 GVVMNPWDVILTRVYNQ--KGNLYKGPLDCFVKTVRI-EGIGALYKGFEAQIFRIAP 299
            + + P DV+ + + N   +   YK  +    KT+   EGI A +KGF   + R AP
Sbjct: 254 WLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAP 310

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 72/188 (38%), Gaps = 34/188 (18%)

Query: 130 VAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGF 189
           V  ++ +G   GI   ++G P    K R+Q+          T  T+    L ++ + EG 
Sbjct: 34  VLKDIFAGTIGGIAQVLVGQPFDTTKVRLQT---------ATTRTTTLEVLRNLVKNEGV 84

Query: 190 KGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKH-------------DLMKEGTGLHLV 236
              Y+G    +L  G   SVQ  +    K F   +             DL +  T L L 
Sbjct: 85  FAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNT-LPLS 143

Query: 237 ASTVSGFGVGVV----MNPWDVILTRVYNQKGN----LYKGPLDCFVKTVRIEGIGALYK 288
              V G   GVV     +P + I  R+  Q  N     +KGP DC  K   ++  G L +
Sbjct: 144 QYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKK---LKAQGGLMR 200

Query: 289 GFEAQIFR 296
           G    + R
Sbjct: 201 GLFPTMIR 208

 Score = 35.4 bits (80), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 43/196 (21%), Positives = 81/196 (41%), Gaps = 17/196 (8%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK 87
           ++ G     +   + +PIE ++ R+Q Q     D  R +K P   +K + K +G  GL +
Sbjct: 146 YVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGD--REFKGPWDCIKKL-KAQG--GLMR 200

Query: 88  GLSCAYIYQIGLNGSRLGFYEPI--RSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGA 145
           GL    I      G+    YE +  R +        + P K+       + GA SG +  
Sbjct: 201 GLFPTMIRAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKL------CLFGAFSGTMLW 254

Query: 146 IMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGA 205
           +   PL ++K+ +Q+      + +  +  SI     +IY  EG +  ++G    ++R+  
Sbjct: 255 LTVYPLDVVKSIIQNDD----LRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAP 310

Query: 206 GSSVQLPIYNTAKHFL 221
            +      +     FL
Sbjct: 311 VNGATFLTFELVMRFL 326

>Kwal_33.14050
          Length = 314

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/300 (22%), Positives = 111/300 (37%), Gaps = 34/300 (11%)

Query: 25  TGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEM--SAD-AQRIYKNPMQALKVIFKNEG 81
           T    AG  A  +  ++  PI+ +KTRMQ       SA+ A ++  N +Q +  I   EG
Sbjct: 17  THQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEG 76

Query: 82  IRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQN--VAVNVVSGAT 139
              L KG+    +     +      YE  +S L       +DP   Q         SG  
Sbjct: 77  SMALWKGVQSVILGAGPAHAVYFATYEMCKSYL-------IDPQDFQTHQPLKTAASGIA 129

Query: 140 SGIIGAIMGSPLFLIKTRMQ--SYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVD 197
           + +   ++ +P   IK RMQ  ++S             +W+  S IYR EG    +    
Sbjct: 130 ATVAADLLMNPFDTIKQRMQLRTFSK----------DRMWSVASRIYRNEGLAAFFYSYP 179

Query: 198 AAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILT 257
             I      ++    IY +A  F    +       +H +   +SG     +  P D I T
Sbjct: 180 TTIAMNIPFAAFNFAIYESATKFFNPENTYNP--LIHCLCGGISGATCAAITTPLDCIKT 237

Query: 258 RVYNQKGNLYKGPL----DCFVKTV----RIEGIGALYKGFEAQIFRIAPHTILCLTFME 309
            +  +       PL    D F +      ++ G    ++G + +I    P T +  T  E
Sbjct: 238 VLQVRGSESVVDPLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNMPATAISWTAYE 297

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 85/203 (41%), Gaps = 29/203 (14%)

Query: 30  AGGMAACIAVTV-TNPIELVKTRMQL----QGEMSADAQRIYKNPMQALKVIFKNEGIRG 84
           A G+AA +A  +  NP + +K RMQL    +  M + A RIY+N  + L   F +     
Sbjct: 125 ASGIAATVAADLLMNPFDTIKQRMQLRTFSKDRMWSVASRIYRN--EGLAAFFYS----- 177

Query: 85  LQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIG 144
                   Y   I +N     F   I     K F    +P    N  ++ + G  SG   
Sbjct: 178 --------YPTTIAMNIPFAAFNFAIYESATKFF----NPENTYNPLIHCLCGGISGATC 225

Query: 145 AIMGSPLFLIKTRMQ---SYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAIL 201
           A + +PL  IKT +Q   S S    + +Q    S     S+I +  G+ G +RG+   I+
Sbjct: 226 AAITTPLDCIKTVLQVRGSESVVDPLFRQADTFS--RAASAISKVYGWSGFWRGLKPRII 283

Query: 202 RTGAGSSVQLPIYNTAKHFLLKH 224
                +++    Y  AKH L  +
Sbjct: 284 SNMPATAISWTAYECAKHTLFNY 306

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 75/184 (40%), Gaps = 6/184 (3%)

Query: 134 VVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHY--TSIWNGLSSIYRAEGFKG 191
           + +GA +GI+   +  P+  IKTRMQ+ S  I          ++I   ++ I   EG   
Sbjct: 20  LAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEGSMA 79

Query: 192 LYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSG-FGVGVVMN 250
           L++GV + IL  G   +V    Y   K +L+     +    L   AS ++      ++MN
Sbjct: 80  LWKGVQSVILGAGPAHAVYFATYEMCKSYLIDPQDFQTHQPLKTAASGIAATVAADLLMN 139

Query: 251 PWDVILTRVYNQKGNLYKGPLDCFVKTV-RIEGIGALYKGFEAQIFRIAPHTILCLTFME 309
           P+D I  R+  Q     K  +      + R EG+ A +  +   I    P         E
Sbjct: 140 PFDTIKQRM--QLRTFSKDRMWSVASRIYRNEGLAAFFYSYPTTIAMNIPFAAFNFAIYE 197

Query: 310 QTMK 313
              K
Sbjct: 198 SATK 201

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 78/173 (45%), Gaps = 12/173 (6%)

Query: 149 SPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSS 208
           +PL L+K R+Q       +  Q + +++ +G  +I R+EG   ++ GV A  +      +
Sbjct: 34  TPLDLVKCRLQ-------VNPQLYRSNL-DGWKTIVRSEGLSKVFTGVGATFIGYSLQGA 85

Query: 209 VQLPIYN----TAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQKG 264
            +   Y     T  + L      +  T ++L AS  + F   +++ PW+ I  +      
Sbjct: 86  CKYGGYEYFKQTYSNLLSPETAHRHRTAVYLCASASAEFLADILLCPWEAIKVKQQTTIP 145

Query: 265 NLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYA 317
              K  L+ + K    EG+  LYKG      R  P+T+   T  E+ ++++YA
Sbjct: 146 PFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIPYTMCKFTSFERIVEMIYA 198

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 63/279 (22%), Positives = 115/279 (41%), Gaps = 33/279 (11%)

Query: 31  GGMAACIAV-TVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGL 89
           GG+ AC    +   P++LVK R+Q+  ++       Y++ +   K I ++EG+  +  G+
Sbjct: 21  GGVVACGPTHSSVTPLDLVKCRLQVNPQL-------YRSNLDGWKTIVRSEGLSKVFTGV 73

Query: 90  SCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGS 149
              +I        + G YE  +   +    P    H+    AV + + A++  +  I+  
Sbjct: 74  GATFIGYSLQGACKYGGYEYFKQTYSNLLSPETA-HR-HRTAVYLCASASAEFLADILLC 131

Query: 150 PLFLIKTRMQSYSNAIQIGQQT----HYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGA 205
           P             AI++ QQT       +   G S I  AEG  GLY+G+     R   
Sbjct: 132 PW-----------EAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIP 180

Query: 206 GSSVQLPIYNT------AKHFLLKHDLM-KEGTGLHLVASTVSGFGVGVVMNPWDVILTR 258
            +  +   +        AK    K ++   +  G+  V   ++G    VV +P DV++++
Sbjct: 181 YTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSK 240

Query: 259 VYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRI 297
           V N      +  ++   +     G G L+ G   +IF I
Sbjct: 241 V-NADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMI 278

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 81/197 (41%), Gaps = 19/197 (9%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK 87
             A   A  +A  +  P E +K + Q             KN ++    I   EG+ GL K
Sbjct: 116 LCASASAEFLADILLCPWEAIKVKQQ------TTIPPFCKNFLEGWSKITAAEGLSGLYK 169

Query: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPA---MDPHKVQNVAVNVVSGATSGIIG 144
           G++  +  QI     +   +E I  ++      +   M P   Q + V+ V G  +GI+ 
Sbjct: 170 GITPLWCRQIPYTMCKFTSFERIVEMIYAKLPRSKQEMSPS--QQIGVSFVGGYLAGILC 227

Query: 145 AIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTG 204
           A++  P  ++ +++ +         +    S+      IY   GF GL+ G+   I   G
Sbjct: 228 AVVSHPADVMVSKVNA--------DRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIG 279

Query: 205 AGSSVQLPIYNTAKHFL 221
             +S Q  IY++ K ++
Sbjct: 280 TLTSFQWLIYDSFKAYI 296

>Scas_582.7
          Length = 329

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 77/201 (38%), Gaps = 16/201 (7%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           ++G  A   +    NP + +K RMQ+        +++Y       K I+  EG+      
Sbjct: 140 VSGATATVASDFFMNPFDTIKQRMQIS---DLKKEKVY----NVAKKIYNLEGLSAFYYS 192

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMG 148
                   I         YE      N        P    N  ++ + G  SG I A + 
Sbjct: 193 YPTTIAMNIPFAAFNFMIYESASKFFN--------PLHHYNPLIHCLCGGISGAIAAAVT 244

Query: 149 SPLFLIKTRMQSY-SNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGS 207
           +PL  IKT +Q   S+ + +       +     S+I    G+KG +RG+   IL     +
Sbjct: 245 TPLDCIKTVIQIRGSSVVSLEVMKKANTFKKATSAILMVYGWKGFWRGLQPRILANMPAT 304

Query: 208 SVQLPIYNTAKHFLLKHDLMK 228
           ++    Y  AKHFL    L+K
Sbjct: 305 AISWTAYECAKHFLFSTRLLK 325

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 79/178 (44%), Gaps = 9/178 (5%)

Query: 119 YPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWN 178
           Y A+  H    ++  +++GA +GI+      P+  +KTR+QS +     G +   TSI  
Sbjct: 27  YEALPAHA--PLSHQLLAGAFAGIMEHSTMFPIDALKTRIQSTTTK---GTEQTSTSIIK 81

Query: 179 GLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHL-VA 237
            +S I   EG   L++GV + IL  G   +V    Y   K  L+     +    + + V+
Sbjct: 82  QISKISTMEGSLALWKGVQSVILGAGPAHAVYFATYEFTKAHLIPDSQRETHQPIKVAVS 141

Query: 238 STVSGFGVGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTV-RIEGIGALYKGFEAQI 294
              +       MNP+D I  R+  Q  +L K  +    K +  +EG+ A Y  +   I
Sbjct: 142 GATATVASDFFMNPFDTIKQRM--QISDLKKEKVYNVAKKIYNLEGLSAFYYSYPTTI 197

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 62/293 (21%), Positives = 103/293 (35%), Gaps = 31/293 (10%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK 87
            +AG  A  +  +   PI+ +KTR  +Q   +   ++   + ++ +  I   EG   L K
Sbjct: 40  LLAGAFAGIMEHSTMFPIDALKTR--IQSTTTKGTEQTSTSIIKQISKISTMEGSLALWK 97

Query: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIM 147
           G+    +     +      YE  ++ L     P       Q + V  VSGAT+ +     
Sbjct: 98  GVQSVILGAGPAHAVYFATYEFTKAHL----IPDSQRETHQPIKV-AVSGATATVASDFF 152

Query: 148 GSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGS 207
            +P   IK RMQ                ++N    IY  EG    Y      I      +
Sbjct: 153 MNPFDTIKQRMQI--------SDLKKEKVYNVAKKIYNLEGLSAFYYSYPTTIAMNIPFA 204

Query: 208 SVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRV-------- 259
           +    IY +A  F   + L      +H +   +SG     V  P D I T +        
Sbjct: 205 AFNFMIYESASKFF--NPLHHYNPLIHCLCGGISGAIAAAVTTPLDCIKTVIQIRGSSVV 262

Query: 260 ---YNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFME 309
                +K N +K         + + G    ++G + +I    P T +  T  E
Sbjct: 263 SLEVMKKANTFKKATSAI---LMVYGWKGFWRGLQPRILANMPATAISWTAYE 312

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 79/186 (42%), Gaps = 31/186 (16%)

Query: 124 PHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQ---SYSNAIQIGQQTHYTSIWNGL 180
           PH    V  ++++G   GI   ++G P    K R+Q   + +NA+++            +
Sbjct: 17  PHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNAVKV------------I 64

Query: 181 SSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHL----- 235
             + + EG  G Y+G    ++  GA  S+Q  +    K F    D   E    HL     
Sbjct: 65  KDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFD---EAASQHLSLLQY 121

Query: 236 -VASTVSGFGVGVVMNPWDVILTRVYNQKGN----LYKGPLDCFVKTVRIEGIGALYKGF 290
            +     GF    + +P + I  R+  Q G+     +KGP+DC +K +R+   G L +G 
Sbjct: 122 YICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDC-IKKLRVN--GQLMRGL 178

Query: 291 EAQIFR 296
              + R
Sbjct: 179 TPTMLR 184

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 66/299 (22%), Positives = 114/299 (38%), Gaps = 32/299 (10%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
             +AG       V V  P +  K R+Q   E S +A ++ K+       + KNEG  G  
Sbjct: 26  DLLAGTAGGIAQVLVGQPFDTTKVRLQ-TSETSTNAVKVIKD-------LIKNEGPMGFY 77

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAV--NVVSGATSGIIG 144
           KG     +        + G  E +     K F+   D    Q++++    + G   G   
Sbjct: 78  KGTLTPLVGVGACVSLQFGVNEAM-----KRFFHTFDEAASQHLSLLQYYICGVAGGFTN 132

Query: 145 AIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTG 204
           + + SP+  I+ R+Q+ + +   G    +    + +  + R  G   L RG+   +LR  
Sbjct: 133 SFLASPIEHIRIRLQTQTGS---GATAEFKGPIDCIKKL-RVNG--QLMRGLTPTMLRES 186

Query: 205 AGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVA--STVSGFGVGVVMNPWDVILTRVYNQ 262
            G  V    Y       +K  + ++      +      SG  +  ++ P DVI  +   Q
Sbjct: 187 HGCGVYFLTYEALIGHQVKSGIQRKDIPAWKLCLFGAASGTLLWTMVYPLDVI--KSVMQ 244

Query: 263 KGNLYKGP------LDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVV 315
             NL K P      L      +  +G+  L+KGF   + R AP         E  M+++
Sbjct: 245 TDNL-KTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLRAAPANAATFATFETAMRLL 302

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 62/135 (45%), Gaps = 17/135 (12%)

Query: 72  ALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVA 131
           A K I+  EGIRG+ KG++   I Q+   GSR GF   +   L K F    +P       
Sbjct: 152 AFKEIYNKEGIRGINKGVNAVAIRQMTNWGSRFGFSRLVEEGLRK-FTGKTNPDDKLTAL 210

Query: 132 VNVVSGATSGIIGAIMGSPLFLIKTRMQSYSN------AIQIGQQTHYTSIWNGLSSIYR 185
             + + A  G + A    P+ +I+  MQS +N       + +G+   Y         IY+
Sbjct: 211 EKIFASAIGGGLSA-WNQPIEVIRVEMQSKTNDPNRPKDLTVGKAFRY---------IYQ 260

Query: 186 AEGFKGLYRGVDAAI 200
           + G KGLYRGV   I
Sbjct: 261 SNGVKGLYRGVTPRI 275

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 69/285 (24%), Positives = 112/285 (39%), Gaps = 34/285 (11%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG 81
           +S +   +  G+  C   T+  P+E+VKT       M+A+ Q  +    QA+  I+   G
Sbjct: 13  ISFSNILLGAGLNMCEVTTLGQPLEVVKT------TMAANRQFTF---FQAINHIWSRGG 63

Query: 82  IRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSG 141
           + G  +GL      +    G+ L F         K          + N    ++ G + G
Sbjct: 64  VFGFYQGLIPWAWIEASTKGAVLLFVSAEAEYHFKKL-------GLNNFGAGIMGGVSGG 116

Query: 142 IIGA--IMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAA 199
           +  A   MG    +    +  + +A    +Q    S W     IY  EG +G+ +GV+A 
Sbjct: 117 VAQAYLTMGFCTCMKTVEITKHKSAAAGAKQ----SSWAAFKEIYNKEGIRGINKGVNAV 172

Query: 200 ILR--TGAGSSVQLP--IYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVI 255
            +R  T  GS       +    + F  K +   + T L  + ++  G G+     P +VI
Sbjct: 173 AIRQMTNWGSRFGFSRLVEEGLRKFTGKTNPDDKLTALEKIFASAIGGGLSAWNQPIEVI 232

Query: 256 LTRVYNQ-KGNLYKGPLDCFV-KTVRI----EGIGALYKGFEAQI 294
             RV  Q K N    P D  V K  R      G+  LY+G   +I
Sbjct: 233 --RVEMQSKTNDPNRPKDLTVGKAFRYIYQSNGVKGLYRGVTPRI 275

>Kwal_23.5757
          Length = 307

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 72/174 (41%), Gaps = 13/174 (7%)

Query: 149 SPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSS 208
           +PL L+K R Q           + Y S  +G   I R+EG   ++ GV A  +      +
Sbjct: 38  TPLDLVKCRRQV--------DASLYKSNLDGWRQIVRSEGATKVFTGVGATAIGYSLQGA 89

Query: 209 VQLPIYNTAKH----FLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQ-K 263
            +   Y   KH     +         TG+ L AS  + F   + + PW+ I  R      
Sbjct: 90  FKYGGYEFFKHQYSQLVSPETAHSYRTGIFLAASASAEFIADIFLCPWEAIKVRQQTAVP 149

Query: 264 GNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYA 317
               +   D + K V  EG  +LYKG     FR  P+T+   T  E+ ++++YA
Sbjct: 150 PPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYA 203

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 87/197 (44%), Gaps = 15/197 (7%)

Query: 24  KTGSFIAGGMAA-CIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGI 82
           +TG F+A   +A  IA     P E +K R Q     +A      +N   A   +   EG 
Sbjct: 115 RTGIFLAASASAEFIADIFLCPWEAIKVRQQ-----TAVPPPFARNVFDAYSKMVGAEGF 169

Query: 83  RGLQKGLSCAYIYQIGLNGSRLGFYEPI-RSVLNKTFYPAMDPHKVQNVAVNVVSGATSG 141
             L KG++  +  QI     +   +E I   +  +   P  +  ++  ++V+   G  +G
Sbjct: 170 ASLYKGITPLWFRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAG 229

Query: 142 IIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAIL 201
           I+ A++  P  ++ +++   +N  + G+ T         S IY   GF GL+ G+   IL
Sbjct: 230 ILCAVVSHPADVMVSKV---NNERKSGESTL-----QATSRIYGKIGFPGLWNGLAVRIL 281

Query: 202 RTGAGSSVQLPIYNTAK 218
             G  +S Q  IY++ K
Sbjct: 282 MIGTLTSFQWLIYDSFK 298

>Kwal_27.12599
          Length = 304

 Score = 57.0 bits (136), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 72/303 (23%), Positives = 117/303 (38%), Gaps = 49/303 (16%)

Query: 30  AGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGL 89
           AGGMA    V V  P +  K R+Q     +          ++ +K + KNEG+RG  KG 
Sbjct: 33  AGGMAQ---VLVGQPFDTTKVRLQTSTTPT--------TAVEVVKKLVKNEGLRGFYKGT 81

Query: 90  SCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGS 149
               +        + G  E ++     +   + DPHK   +    + G   G+  + + S
Sbjct: 82  LTPLVGVGACVSCQFGVNEAMKRFFRGS---SADPHKTLTLPQYYICGFVGGVANSFLAS 138

Query: 150 PLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSV 209
           P+  ++ R+Q+ + +  + +        N L    RA G   L RG+   ILR   G   
Sbjct: 139 PIEHVRIRLQTQTASGTVAEFKGPLDCINKL----RANG--ALMRGLSPTILREAQGC-- 190

Query: 210 QLPIYNTAKHFLLKHDLMKEGTGLHLVAS-----------TVSGFGVGVVMNPWDVILTR 258
                  A +FL    L+    G  +  S            VSG  + + + P DVI  +
Sbjct: 191 -------ATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVI--K 241

Query: 259 VYNQKGNLYKGPL--DCFVKTVRI----EGIGALYKGFEAQIFRIAPHTILCLTFMEQTM 312
              Q  NL K P+     ++  R+     G  + +KGF   + R AP         E  M
Sbjct: 242 SLMQTDNL-KNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAM 300

Query: 313 KVV 315
           + +
Sbjct: 301 RFL 303

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 75/183 (40%), Gaps = 21/183 (11%)

Query: 124 PHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSI 183
           PH    V  ++++G   G+   ++G P    K R+Q+          T  T+    +  +
Sbjct: 18  PHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQT---------STTPTTAVEVVKKL 68

Query: 184 YRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGF 243
            + EG +G Y+G    ++  GA  S Q  +    K F          T L L    + GF
Sbjct: 69  VKNEGLRGFYKGTLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKT-LTLPQYYICGF 127

Query: 244 GVGV----VMNPWDVILTRVYNQKGN----LYKGPLDCFVKTVRIEGIGALYKGFEAQIF 295
             GV    + +P + +  R+  Q  +     +KGPLDC  K   +   GAL +G    I 
Sbjct: 128 VGGVANSFLASPIEHVRIRLQTQTASGTVAEFKGPLDCINK---LRANGALMRGLSPTIL 184

Query: 296 RIA 298
           R A
Sbjct: 185 REA 187

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 55.5 bits (132), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 86/186 (46%), Gaps = 31/186 (16%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           +FIAGG+A  ++ TV +P E VK  +Q+Q   SA    I    + A+  ++K EG+ GL 
Sbjct: 14  AFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGI----INAVGQVYKEEGVAGLF 69

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVL-----NKTFYPAMDPHKVQNVAVNVVS-GATS 140
           +G         GLN  R+  Y  ++ V+        F+      K Q +    +S GA  
Sbjct: 70  RG--------NGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALC 121

Query: 141 GIIGAIMGSPLFLIKTRMQ---------SYSNAIQIGQQTHYTSIWNGLSSIYRAE-GFK 190
           G +  +   PL L++TR+          S S A  I +      +W  L   ++ E G +
Sbjct: 122 GGMSVLATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKP---PGVWELLVKTFKEEGGIR 178

Query: 191 GLYRGV 196
           GLYRG+
Sbjct: 179 GLYRGI 184

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 78/185 (42%), Gaps = 33/185 (17%)

Query: 128 QNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAE 187
           Q  ++  ++G  +G +   + SP   +K  +Q     +Q     +   I N +  +Y+ E
Sbjct: 9   QESSIAFIAGGVAGAVSRTVVSPFERVKILLQ-----VQSSTSAYNHGIINAVGQVYKEE 63

Query: 188 GFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGT--------GLHLVAST 239
           G  GL+RG     +R    S+VQ  +Y   K    KH    +GT           L A  
Sbjct: 64  GVAGLFRGNGLNCVRIFPYSAVQFVVYEWCK----KHIFHVDGTVGKEQLLNWQRLSAGA 119

Query: 240 VSGFGVGVVMN-PWDVILTRVYNQKGNLYK-------------GPLDCFVKTVRIE-GIG 284
           + G G+ V+   P D++ TR+  Q  NL K             G  +  VKT + E GI 
Sbjct: 120 LCG-GMSVLATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEEGGIR 178

Query: 285 ALYKG 289
            LY+G
Sbjct: 179 GLYRG 183

 Score = 29.6 bits (65), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/97 (21%), Positives = 45/97 (46%), Gaps = 2/97 (2%)

Query: 225 DLMKEGTGLHLVASTVSGFGVGVVMNPWD--VILTRVYNQKGNLYKGPLDCFVKTVRIEG 282
            L K+ + +  +A  V+G     V++P++   IL +V +       G ++   +  + EG
Sbjct: 5   QLAKQESSIAFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEG 64

Query: 283 IGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYAVE 319
           +  L++G      RI P++ +     E   K ++ V+
Sbjct: 65  VAGLFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVD 101

>Scas_645.9
          Length = 391

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/280 (23%), Positives = 121/280 (43%), Gaps = 45/280 (16%)

Query: 66  YKNPMQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIR--SVLNKTFYPAMD 123
           +   ++A   I+K EGI  L +G+S   +  I  N      YE +R  S L  T  P  +
Sbjct: 129 FNGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYEYLRDNSPL-ATSSPTFN 187

Query: 124 PHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSI 183
           P         ++ GA + I+ A   +PL L+KT++QS      I + +  T+ W  +  +
Sbjct: 188 P---------LMCGAIARILAASTVAPLELLKTKLQS------IPRVSKSTTSWMMVKEL 232

Query: 184 YRAE--------GFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGL-- 233
            +              L++G++  + R    S++    Y   K  L   D  K  + L  
Sbjct: 233 LKETRQEMRISGASNALFKGLEITLWRDVPFSAIYWGSYEFCKTHLW-MDTSKSHSNLTF 291

Query: 234 ---HLVASTVSGFGVGVVMNPWDVILTRVY-----NQKGNLYKGP-------LDCFVKTV 278
                +  ++SG    +V +P+DV  TR       N   ++ K P       +  F++ +
Sbjct: 292 FINSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNI 351

Query: 279 -RIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYA 317
            ++EG GALY G   ++ +IAP   + ++  E + ++  A
Sbjct: 352 WKLEGWGALYTGLVPRMVKIAPSCAIMISSYELSKRLFNA 391

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/207 (19%), Positives = 86/207 (41%), Gaps = 19/207 (9%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADA------QRIYKNPMQALKVIFKNEG 81
            + G +A  +A +   P+EL+KT++Q    +S         + + K   Q +++   +  
Sbjct: 189 LMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETRQEMRI---SGA 245

Query: 82  IRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVN-VVSGATS 140
              L KGL       +  +    G YE  ++ L   +      H      +N  + G+ S
Sbjct: 246 SNALFKGLEITLWRDVPFSAIYWGSYEFCKTHL---WMDTSKSHSNLTFFINSFIGGSIS 302

Query: 141 GIIGAIMGSPLFLIKTRMQ------SYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYR 194
           G I A++  P  + KTR Q      +  + ++        +++  L +I++ EG+  LY 
Sbjct: 303 GTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWKLEGWGALYT 362

Query: 195 GVDAAILRTGAGSSVQLPIYNTAKHFL 221
           G+   +++     ++ +  Y  +K   
Sbjct: 363 GLVPRMVKIAPSCAIMISSYELSKRLF 389

 Score = 35.0 bits (79), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 9/72 (12%)

Query: 26  GSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNP--------MQALKVIF 77
            SFI G ++  IA  VT+P ++ KTR Q+   M  + + + K+P         + L+ I+
Sbjct: 294 NSFIGGSISGTIAALVTHPFDVGKTRWQISF-MGNNDKSVVKSPDIEQTKNMFKFLRNIW 352

Query: 78  KNEGIRGLQKGL 89
           K EG   L  GL
Sbjct: 353 KLEGWGALYTGL 364

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 79/195 (40%), Gaps = 18/195 (9%)

Query: 31  GGMAACIAV-TVTNPIELVKTRMQLQGEMSADAQ-RIYKNPMQALKVIFKNEGIRGLQKG 88
            G+AA +A   + NP + +K R+QLQ + S  +  R+  N       I+KNEG       
Sbjct: 140 SGVAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAFN-------IYKNEGPMAFFYS 192

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMG 148
                   I         YE      N        P    N  ++ + G  +G   A + 
Sbjct: 193 YPTTLAMNIPFAALNFVIYESSTKFFN--------PTNAYNPWIHCLCGGIAGATCAAVT 244

Query: 149 SPLFLIKTRMQSY-SNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGS 207
           +PL  IKT +Q   S+ + +       +      +I+++ G+KG +RG+   ++     +
Sbjct: 245 TPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPRVISNIPAT 304

Query: 208 SVQLPIYNTAKHFLL 222
           ++    Y  AKH L 
Sbjct: 305 AISWTSYEFAKHLLF 319

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 74/176 (42%), Gaps = 36/176 (20%)

Query: 130 VAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSN------------AIQIGQQTHYTSIW 177
           ++  +++GA +GI+   +  P+  +KTRMQ+ S             A          ++ 
Sbjct: 20  LSYQLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLL 79

Query: 178 NGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLK------HDLMKEGT 231
             +S I   EG   L+RGV + ++  G   +V    Y   K  L+       H  +K  T
Sbjct: 80  QQISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDFNTHQPLK--T 137

Query: 232 GLHLVASTVSGFGVGVVMNPWDVILTRV-----------YNQKGNLYK--GPLDCF 274
            +  VA+TV+      +MNP+D I  R+           +    N+YK  GP+  F
Sbjct: 138 AVSGVAATVAA---DALMNPFDTIKQRLQLQSKSSDSSMWRMAFNIYKNEGPMAFF 190

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 51/244 (20%), Positives = 90/244 (36%), Gaps = 31/244 (12%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNP-------------MQALKV 75
           IAG  A  +  ++  PI+ +KTRMQ   E+ A A                    +Q +  
Sbjct: 25  IAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLLQQISR 84

Query: 76  IFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVL--NKTFYPAMDPHKVQNVAVN 133
           I   EG   L +G+    +     +      YE  +  L   K F    + H+    A  
Sbjct: 85  ISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDF----NTHQPLKTA-- 138

Query: 134 VVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLY 193
            VSG  + +    + +P   IK R+       Q+  ++  +S+W    +IY+ EG    +
Sbjct: 139 -VSGVAATVAADALMNPFDTIKQRL-------QLQSKSSDSSMWRMAFNIYKNEGPMAFF 190

Query: 194 RGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWD 253
                 +      +++   IY ++  F    +       +H +   ++G     V  P D
Sbjct: 191 YSYPTTLAMNIPFAALNFVIYESSTKFFNPTNAYNP--WIHCLCGGIAGATCAAVTTPLD 248

Query: 254 VILT 257
            I T
Sbjct: 249 CIKT 252

 Score = 35.0 bits (79), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 42/88 (47%), Gaps = 2/88 (2%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGE--MSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           + GG+A      VT P++ +KT +Q++G   +  ++ +      +A + I+++ G +G  
Sbjct: 231 LCGGIAGATCAAVTTPLDCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFW 290

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVL 114
           +GL    I  I         YE  + +L
Sbjct: 291 RGLQPRVISNIPATAISWTSYEFAKHLL 318

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 83/202 (41%), Gaps = 12/202 (5%)

Query: 122 MDPHKVQNVAV--------NVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHY 173
           MDP ++   A+         + +GA +GI+   +  P+  IKTRMQ+ S           
Sbjct: 1   MDPPELDYEALPENAPLVYQLAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLP 60

Query: 174 TSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGL 233
           +++   ++ I   EG   L++GV + +L  G   +V    Y   K  L+  +  +    L
Sbjct: 61  SNMLAQIAKISTTEGSLALWKGVQSVVLGAGPAHAVYFATYEMCKSRLIDPEDRQTHQPL 120

Query: 234 HLVAS-TVSGFGVGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEA 292
               S T++      +MNP+D I  R+     +       C V+  + EGI A +  +  
Sbjct: 121 KTALSGTLATVAADALMNPFDTIKQRLQLHPSDSMT---KCAVRMYQREGIAAFFYSYPT 177

Query: 293 QIFRIAPHTILCLTFMEQTMKV 314
            I    P   L     E + K+
Sbjct: 178 TIAMNIPFAALNFVIYESSTKI 199

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 77/197 (39%), Gaps = 22/197 (11%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQ--GEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           ++G +A   A  + NP + +K R+QL     M+  A R+Y+            EGI    
Sbjct: 124 LSGTLATVAADALMNPFDTIKQRLQLHPSDSMTKCAVRMYQR-----------EGIAAFF 172

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146
                     I         YE    + N        P    N  ++ + G  SG   A 
Sbjct: 173 YSYPTTIAMNIPFAALNFVIYESSTKIFN--------PSNNYNPWIHCLCGGISGATCAA 224

Query: 147 MGSPLFLIKTRMQSY-SNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGA 205
           + +PL  +KT +Q   ++++Q        +     S+I++  G+ G +RG+   I+    
Sbjct: 225 ITTPLDCVKTVLQIRGADSVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISNMP 284

Query: 206 GSSVQLPIYNTAKHFLL 222
            +++    Y  AKH L 
Sbjct: 285 ATAISWTSYEFAKHLLF 301

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 58/291 (19%), Positives = 106/291 (36%), Gaps = 30/291 (10%)

Query: 30  AGGMAACIAVTVTNPIELVKTRMQ-LQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           AG  A  +  ++  PI+ +KTRMQ +    S+ A R+  N +  +  I   EG   L KG
Sbjct: 23  AGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEGSLALWKG 82

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAV--NVVSGATSGIIGAI 146
           +    +     +      YE  +S L       +DP   Q        +SG  + +    
Sbjct: 83  VQSVVLGAGPAHAVYFATYEMCKSRL-------IDPEDRQTHQPLKTALSGTLATVAADA 135

Query: 147 MGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAG 206
           + +P   IK R+Q + +           S+      +Y+ EG    +      I      
Sbjct: 136 LMNPFDTIKQRLQLHPS----------DSMTKCAVRMYQREGIAAFFYSYPTTIAMNIPF 185

Query: 207 SSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQKGNL 266
           +++   IY ++       +       +H +   +SG     +  P D + T +  +  + 
Sbjct: 186 AALNFVIYESSTKIFNPSN--NYNPWIHCLCGGISGATCAAITTPLDCVKTVLQIRGADS 243

Query: 267 YKGPL----DCFVKTV----RIEGIGALYKGFEAQIFRIAPHTILCLTFME 309
            +  L    D F K      +  G    ++G + +I    P T +  T  E
Sbjct: 244 VQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISNMPATAISWTSYE 294

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 43/100 (43%), Gaps = 4/100 (4%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNP---MQALKVIFKNEGIRGL 85
           + GG++      +T P++ VKT +Q++G  S  +Q ++K      +A   I K  G  G 
Sbjct: 213 LCGGISGATCAAITTPLDCVKTVLQIRGADSVQSQ-LFKEADTFRKAASAIHKTYGWSGF 271

Query: 86  QKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPH 125
            +GL    I  +         YE  + +L       +D H
Sbjct: 272 FRGLKPRIISNMPATAISWTSYEFAKHLLFTNSNAHLDNH 311

>Kwal_27.11419
          Length = 298

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 67/306 (21%), Positives = 130/306 (42%), Gaps = 41/306 (13%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMS--ADAQRIYKNPMQALKVIFKNEGIRGL 85
           FI G +    +  +  P +L+KTR+Q Q + S   D  R  + P Q    ++K      L
Sbjct: 11  FIGGFVGGLTSAVILQPFDLLKTRLQ-QNKSSNLLDVVRSIETPGQ----LWKGTLPSAL 65

Query: 86  QKGLSCAYIYQIGLNGSRLGFYEP-IRSVLNK----TFYPAMDPHKVQNVAVNVVSGATS 140
           +  +  A ++   LN  R    +  ++ +  K    +F P +  ++      N++SGA +
Sbjct: 66  RTSVGSA-LFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYE------NLISGAIT 118

Query: 141 GIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAI 200
                +   P+ ++K R +S           +Y S+    + IYR+EG +GL+ G  A +
Sbjct: 119 RAAVGVATMPITVLKVRFES--------TMYNYKSLGEAATHIYRSEGIRGLFSGCGATV 170

Query: 201 LRTGAGSSVQLPIYNTAKH--------FLLKHD-----LMKEGTGLHLVASTVSGFGVGV 247
           +R    + + +  Y  +K         ++++H+       K  T ++ +A+  S      
Sbjct: 171 MRDAPYAGLYVLFYEQSKLQLPRILPVWMVEHNESGVFSTKTSTIINSIAAFSSASLATT 230

Query: 248 VMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTF 307
           + +P+D I TR+       Y G +  F   +R E    L+ G   ++ R A    +    
Sbjct: 231 ITSPFDTIKTRMQLNPSQYY-GFIQTFKSIIRYERPRNLFDGLSLRLSRKALSAGIAWGI 289

Query: 308 MEQTMK 313
            E+ +K
Sbjct: 290 YEELVK 295

>Kwal_23.4354
          Length = 343

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 69/265 (26%), Positives = 110/265 (41%), Gaps = 34/265 (12%)

Query: 66  YKNPMQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLN-KTFYPAMDP 124
           Y +   A   I K EG++ L +GLS   +     N      YE +R     +  YP ++P
Sbjct: 84  YNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYESLRDKSRLQDKYPTLNP 143

Query: 125 HKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIY 184
                    ++ GA + ++ A   +PL L +TR+QS   +     ++    +   L    
Sbjct: 144 ---------LMCGALARVLAATTVAPLELFRTRLQSIPRS---SPKSTTAMMIKDLIKES 191

Query: 185 RAE----GFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKE------GTGLH 234
           R E    G+K L+RG++  + R    SS+    Y   K  +   D  K           H
Sbjct: 192 RYEISKVGYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNV-SIDSEKSIVNSSNSNWNH 250

Query: 235 LVASTVSG-FG---VGVVMNPWDVILTR--VYNQKGNLYKGPLDCFVKTV----RIEGIG 284
            V S V G FG     V+ +P+DV  TR  +      L K P     K +    + EG+ 
Sbjct: 251 FVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLA 310

Query: 285 ALYKGFEAQIFRIAPHTILCLTFME 309
           ALY G   ++ +IAP   + ++  E
Sbjct: 311 ALYTGLVPRVIKIAPSCAIMISTYE 335

 Score = 47.8 bits (112), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 42/200 (21%), Positives = 88/200 (44%), Gaps = 8/200 (4%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQL--QGEMSADAQRIYKNPMQALKVIFKNEGIRGL 85
            + G +A  +A T   P+EL +TR+Q   +    +    + K+ ++  +      G + L
Sbjct: 144 LMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIKESRYEISKVGYKAL 203

Query: 86  QKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAM--DPHKVQNVAVN-VVSGATSGI 142
            +GL       +  +    G YE  +S ++     ++    +   N  VN  V G+  G 
Sbjct: 204 FRGLEITLWRDVPFSSIYWGCYEFYKSNVSIDSEKSIVNSSNSNWNHFVNSFVGGSFGGA 263

Query: 143 IGAIMGSPLFLIKTRMQ-SYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAIL 201
           + A++  P  + KTRMQ +Y N+    ++    +++  L+ + ++EG   LY G+   ++
Sbjct: 264 VAAVLTHPFDVGKTRMQITYLNSTL--EKKPSKNMFKYLNQMRKSEGLAALYTGLVPRVI 321

Query: 202 RTGAGSSVQLPIYNTAKHFL 221
           +     ++ +  Y   K   
Sbjct: 322 KIAPSCAIMISTYEVCKRLF 341

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 34/64 (53%)

Query: 26  GSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGL 85
            SF+ G     +A  +T+P ++ KTRMQ+    S   ++  KN  + L  + K+EG+  L
Sbjct: 253 NSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLAAL 312

Query: 86  QKGL 89
             GL
Sbjct: 313 YTGL 316

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 32/155 (20%), Positives = 63/155 (40%), Gaps = 15/155 (9%)

Query: 172 HYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGT 231
            Y S W+    I + EG + L+RG+   +L     + V    Y + +    K  L  +  
Sbjct: 83  RYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYESLRD---KSRLQDKYP 139

Query: 232 GLH-LVASTVSGFGVGVVMNPWDVILTRVYNQKGNLYKGP----LDCFVKTVRIE----G 282
            L+ L+   ++       + P ++  TR+ +   +  K      +   +K  R E    G
Sbjct: 140 TLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIKESRYEISKVG 199

Query: 283 IGALYKGFEAQIFRIAPHTIL---CLTFMEQTMKV 314
             AL++G E  ++R  P + +   C  F +  + +
Sbjct: 200 YKALFRGLEITLWRDVPFSSIYWGCYEFYKSNVSI 234

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/203 (21%), Positives = 84/203 (41%), Gaps = 9/203 (4%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIY--KNPMQALKVIFKNEGIRGL 85
            + G  A  +A T   P+EL++TR+Q         + IY   + ++ ++      G R L
Sbjct: 140 LVCGAFARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREMRHEVSVMGYRAL 199

Query: 86  QKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGA 145
            KGL       +  +    G YE  ++          +     +   +   G+  G + A
Sbjct: 200 FKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFIGSFACGSMGGAVAA 259

Query: 146 IMGSPLFLIKTRMQ---SYSNAIQIGQQTHYTSIWNG----LSSIYRAEGFKGLYRGVDA 198
           ++  P  + KTRMQ   +    + +G +   T    G    L++I ++EG + LY G+  
Sbjct: 260 LLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRKSEGIRALYTGLLP 319

Query: 199 AILRTGAGSSVQLPIYNTAKHFL 221
            +++     ++ +  Y  +K F 
Sbjct: 320 RVMKIAPSCAIMISTYELSKKFF 342

 Score = 53.5 bits (127), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 73/322 (22%), Positives = 130/322 (40%), Gaps = 62/322 (19%)

Query: 43  NPIELVKTRMQLQ---------GEMSADAQRIY-----------KNP-------MQALKV 75
            P+++V+ R+  Q         G++S  A +++           + P       ++ L+ 
Sbjct: 30  TPLDVVRVRLHQQEMLPSCTCTGQLSKPAGKVFWQDECFANVGCREPAARLQGTLEGLRK 89

Query: 76  IFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVV 135
           I + EG+  L +GL    +  +  N      YE +R   N      +       VA  +V
Sbjct: 90  IAQLEGLPTLWRGLGITLVMAVPANVVYFSGYEALRD--NSPLASRLP------VANPLV 141

Query: 136 SGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAE----GFKG 191
            GA + I+ A   +PL L++TR+QS   A +  ++T Y  +   L    R E    G++ 
Sbjct: 142 CGAFARILAATTIAPLELLRTRLQSVPRA-RDTERTIY--LIGDLLREMRHEVSVMGYRA 198

Query: 192 LYRGVDAAILRTGAGSSVQLPIYNTAK-HFLLKHDLMKEGTGL-HLVASTVSGFGVGVV- 248
           L++G++  + R    S++    Y   K  F  +H      +   H + S   G   G V 
Sbjct: 199 LFKGLEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFIGSFACGSMGGAVA 258

Query: 249 ---MNPWDVILTRVY--------------NQKGNLYKGPLDCFVKTVRIEGIGALYKGFE 291
               +P+DV  TR+                 K +  +G         + EGI ALY G  
Sbjct: 259 ALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRKSEGIRALYTGLL 318

Query: 292 AQIFRIAPHTILCLTFMEQTMK 313
            ++ +IAP   + ++  E + K
Sbjct: 319 PRVMKIAPSCAIMISTYELSKK 340

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 16/76 (21%)

Query: 26  GSFIAGGMAACIAVTVTNPIELVKTRMQL------------QGEMSADAQRIYKNPMQAL 73
           GSF  G M   +A  +T+P ++ KTRMQ+            +   + D++ ++      L
Sbjct: 246 GSFACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMF----SFL 301

Query: 74  KVIFKNEGIRGLQKGL 89
             I K+EGIR L  GL
Sbjct: 302 NAIRKSEGIRALYTGL 317

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 79/178 (44%), Gaps = 17/178 (9%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK 87
           ++ G  + C    +  PIE V+ R+QLQ +  A+A+  Y+  +  ++ + K      L +
Sbjct: 122 YVCGVASGCANAFLATPIEHVRIRLQLQTKSLANAE--YQGSLDCMRKLLKQG---ALMR 176

Query: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMD--PHKVQNVAVNVVSGATSGIIGA 145
           G +   +      G     YE + +  +K   P  D  P KV       + GA SG    
Sbjct: 177 GFTATLMRTCHGFGIYFSTYEALIANQHKKGIPRKDIAPWKV------CIFGAFSGACYW 230

Query: 146 IMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRT 203
            M  P+ ++K+ MQS     ++    H T++W    SIY   G +   +G   A+LR+
Sbjct: 231 AMAYPIDVVKSIMQSD----RLVSPVHGTNVWQVAKSIYTTRGKRAFIKGFMPAMLRS 284

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 75/171 (43%), Gaps = 19/171 (11%)

Query: 133 NVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGL 192
           +++SG   GI   ++G P  + K RMQ+ + +          +  + ++S+ + EG  G 
Sbjct: 26  DILSGTAGGIAQVLVGQPFDITKVRMQTSAGS---------ATAVDVVTSLIKNEGILGF 76

Query: 193 YRGVDAAILRTGAGSSVQLPIYNTAKHFL--LKHDLMKE-GTGLHLVASTVSGFGVGVVM 249
           Y+G  A ++  GA  S Q  +    K     +  D  K      + V    SG     + 
Sbjct: 77  YKGTLAPLVGVGACVSCQFGVNEAMKRRFRRMNGDPSKPLSLKQYYVCGVASGCANAFLA 136

Query: 250 NPWDVILTRVYNQKGNL----YKGPLDCFVKTVRIEGIGALYKGFEAQIFR 296
            P + +  R+  Q  +L    Y+G LDC  K ++    GAL +GF A + R
Sbjct: 137 TPIEHVRIRLQLQTKSLANAEYQGSLDCMRKLLK---QGALMRGFTATLMR 184

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 75/186 (40%), Gaps = 20/186 (10%)

Query: 30  AGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGL 89
           AGG+A    V V  P ++ K RMQ     SA A       +  +  + KNEGI G  KG 
Sbjct: 32  AGGIAQ---VLVGQPFDITKVRMQTSAG-SATA-------VDVVTSLIKNEGILGFYKGT 80

Query: 90  SCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGS 149
               +        + G  E ++    +      DP K  ++    V G  SG   A + +
Sbjct: 81  LAPLVGVGACVSCQFGVNEAMKRRFRRM---NGDPSKPLSLKQYYVCGVASGCANAFLAT 137

Query: 150 PLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSV 209
           P+  ++ R+Q  + ++       Y    + +  + + +G   L RG  A ++RT  G  +
Sbjct: 138 PIEHVRIRLQLQTKSL---ANAEYQGSLDCMRKLLK-QG--ALMRGFTATLMRTCHGFGI 191

Query: 210 QLPIYN 215
               Y 
Sbjct: 192 YFSTYE 197

>Kwal_27.11626
          Length = 299

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 71/288 (24%), Positives = 109/288 (37%), Gaps = 32/288 (11%)

Query: 34  AACIAVTVTNPIELVKTR-MQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK----- 87
           A  + + V +P++ V  R M    ++S+ AQ           VIF+      L K     
Sbjct: 19  AGILEIGVFHPVDTVSKRLMSNHTKISSSAQ--------LNSVIFREHAGEALGKRLFTL 70

Query: 88  --GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDP---HKVQNVAVNVVSGATSGI 142
             GL  A  Y+I     + G        LNK F    D     K      +  +G+  GI
Sbjct: 71  FPGLGYAASYKILQRVYKYGGQPFANEFLNKNFKADFDNAFGEKTGKALRSATAGSLIGI 130

Query: 143 IGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILR 202
            G I+  PL ++K + Q+   + +            G   I + EGF GLYRG      R
Sbjct: 131 -GEIVLLPLDVLKIKRQTNPESFK----------GRGFIKILKDEGF-GLYRGWGWTAAR 178

Query: 203 TGAGSSVQLPIYNTAKHFLLK-HDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYN 261
              GS         AK ++L   D        + V+S V      +V  P DVI TR+ N
Sbjct: 179 NAPGSFALFGGNAFAKEYILGLKDYSSATWSQNFVSSIVGASASLIVSAPLDVIKTRIQN 238

Query: 262 QKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFME 309
           +  +  +        T++ EGI A +KG   ++    P  +      +
Sbjct: 239 RHFDNPESGFRIVQNTLKNEGITAFFKGLTPKLLTTGPKLVFSFALAQ 286

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 36/67 (53%), Gaps = 12/67 (17%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVI---FKNEGIR 83
           +F++  + A  ++ V+ P++++KTR+Q          R + NP    +++    KNEGI 
Sbjct: 211 NFVSSIVGASASLIVSAPLDVIKTRIQ---------NRHFDNPESGFRIVQNTLKNEGIT 261

Query: 84  GLQKGLS 90
              KGL+
Sbjct: 262 AFFKGLT 268

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 53.5 bits (127), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 66/299 (22%), Positives = 112/299 (37%), Gaps = 32/299 (10%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQ-------ALKV-IFK 78
           S IAG  AA    T+++P E +KT  QL   +   A     +P +       AL V    
Sbjct: 23  SVIAGAAAAVFQTTMSHPFEFLKTGQQLHRALPGAAAFNMLHPFKYYFSGCAALNVGTLL 82

Query: 79  NEGIRGLQKGLSCAYIY------------QIGLNGSRLGFYE-----PIRSVLNKTFYPA 121
             G R      +C ++             ++ L G+  GF E     P  S+       A
Sbjct: 83  KTGTRFATFEQACVWLRDPEHADQPIAGPRLLLAGAITGFLESLWVVPFESIKTTAVENA 142

Query: 122 MD-PHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGL 180
           ++   +VQ       +  + G            ++T  + +    +    +H+      +
Sbjct: 143 LELSRRVQGEPETRAAAVSKGPAPKATFHAARPVQTAHERWLLHYERQPSSHFAGT---V 199

Query: 181 SSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTV 240
             IYR  G +G  +G    I R    S V+   Y      L  H  + E       A  +
Sbjct: 200 LEIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTTYAWIVQSLSPHKALDEYQAF--AAGAL 257

Query: 241 SGFGVGVVMNPWDVILTRVYNQKGNL-YKGPLDCFVKTVRIEGIGALYKGFEAQIFRIA 298
           S   V  +  P DVI TR+ ++     YK  L+C  +    EG   ++KG+  ++F+++
Sbjct: 258 SSAAVVALTQPIDVIKTRMQSKTAWFTYKSSLNCAYRIFVEEGFRYMWKGWVPRLFKVS 316

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 48/89 (53%), Gaps = 7/89 (7%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           +F AG +++   V +T PI+++KTRMQ     S  A   YK+ +     IF  EG R + 
Sbjct: 251 AFAAGALSSAAVVALTQPIDVIKTRMQ-----SKTAWFTYKSSLNCAYRIFVEEGFRYMW 305

Query: 87  KGLSCAYIYQIGLNGS-RLGFYEPIRSVL 114
           KG     ++++ L+G    G Y+ + +++
Sbjct: 306 KGW-VPRLFKVSLSGGISFGVYQYVENLV 333

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 60/147 (40%), Gaps = 14/147 (9%)

Query: 76  IFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVV 135
           I++  G+RG  +G       Q+G +  R   Y  I   L+        PHK  +      
Sbjct: 202 IYRTRGVRGFLQGAMPTIFRQLGNSVVRFTTYAWIVQSLS--------PHKALDEYQAFA 253

Query: 136 SGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRG 195
           +GA S      +  P+ +IKTRMQS +          Y S  N    I+  EGF+ +++G
Sbjct: 254 AGALSSAAVVALTQPIDVIKTRMQSKTAWFT------YKSSLNCAYRIFVEEGFRYMWKG 307

Query: 196 VDAAILRTGAGSSVQLPIYNTAKHFLL 222
               + +      +   +Y   ++ +L
Sbjct: 308 WVPRLFKVSLSGGISFGVYQYVENLVL 334

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 83/199 (41%), Gaps = 22/199 (11%)

Query: 125 HKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIY 184
            K   V  ++VSG   G+       PL L+KTR+          QQ   +S+ + L  + 
Sbjct: 3   EKAGGVPAHLVSGFFGGLASVCALQPLDLLKTRL----------QQAQASSLRSVLREV- 51

Query: 185 RAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGL--------HLV 236
                + L+RG   + LRT  GS++ L + N ++  L +    +  + L        +L+
Sbjct: 52  --RTTRELWRGTLPSALRTSIGSALYLSLLNYSRSALARGSEARTRSSLLPRLQSYQNLL 109

Query: 237 ASTVSGFGVGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFR 296
              +S   VG+V  P  VI  R Y      Y G  +      R EG    +KG  A   R
Sbjct: 110 TGALSRAAVGLVTMPITVIKVR-YESTLYAYNGLAEATRHIWRSEGARGFFKGAAATTLR 168

Query: 297 IAPHTILCLTFMEQTMKVV 315
            AP+  L +   EQ  +++
Sbjct: 169 DAPYAGLYVLLYEQAKEML 187

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 69/303 (22%), Positives = 126/303 (41%), Gaps = 44/303 (14%)

Query: 31  GGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGLS 90
           GG+A+  A+    P++L+KTR+Q   +  A + R     ++  + +++      L+  + 
Sbjct: 18  GGLASVCAL---QPLDLLKTRLQ---QAQASSLRSVLREVRTTRELWRGTLPSALRTSIG 71

Query: 91  CAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSP 150
            A +Y   LN SR        +    +  P +  ++      N+++GA S     ++  P
Sbjct: 72  SA-LYLSLLNYSRSALARGSEARTRSSLLPRLQSYQ------NLLTGALSRAAVGLVTMP 124

Query: 151 LFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQ 210
           + +IK R +S   A        Y  +      I+R+EG +G ++G  A  LR    + + 
Sbjct: 125 ITVIKVRYESTLYA--------YNGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLY 176

Query: 211 LPIYNTAKHFL---LKHDLMKEGTGLHLVAST------VSGFGVG----VVMNPWDVILT 257
           + +Y  AK  L   L   L+       L A        VS F        +  P+D I T
Sbjct: 177 VLLYEQAKEMLPRALPATLLGADESGKLTAPASAMVNGVSAFLSASLATTLTAPFDTIKT 236

Query: 258 RVYNQKGNLYKGPLDCFVKTVR----IEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMK 313
           R+      L   P+  FV+T+R     E    L+ G   ++ R A    +     E+ +K
Sbjct: 237 RM-----QLQSHPVG-FVQTLRHIVCEERARTLFDGLSLRLCRKAMSACIAWGIYEELLK 290

Query: 314 VVY 316
           +++
Sbjct: 291 LLH 293

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 41/90 (45%), Gaps = 14/90 (15%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNP---MQALKVIFKNEGIRGL 85
           ++  ++A +A T+T P + +KTRMQLQ            +P   +Q L+ I   E  R L
Sbjct: 215 VSAFLSASLATTLTAPFDTIKTRMQLQ-----------SHPVGFVQTLRHIVCEERARTL 263

Query: 86  QKGLSCAYIYQIGLNGSRLGFYEPIRSVLN 115
             GLS     +        G YE +  +L+
Sbjct: 264 FDGLSLRLCRKAMSACIAWGIYEELLKLLH 293

>Kwal_34.15907
          Length = 312

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 80/183 (43%), Gaps = 20/183 (10%)

Query: 26  GSFIAGGMAACIA--------VTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIF 77
           G+ I GG++  +A         T    +E+ K +       SA A  I ++   A K I+
Sbjct: 109 GAGIMGGVSGGVAQAYLTMGFCTCMKTVEITKAK-------SAVAGAIPQSSWSAFKEIY 161

Query: 78  KNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSG 137
             EGI+G+ KG++   I Q+   GSR G    +   + + F    +P         + + 
Sbjct: 162 SKEGIKGINKGVNAVAIRQMTNWGSRFGLSRLVEQGI-RDFTGKTNPDDKLTALEKIFAS 220

Query: 138 ATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVD 197
           A  G + A    P+ +I+  MQS     +   +    ++ +    IY++ G KGLYRGV 
Sbjct: 221 ALGGGLSA-WNQPIEVIRVEMQSKK---EDPNRPKKLTVGSAFKYIYQSSGIKGLYRGVA 276

Query: 198 AAI 200
             I
Sbjct: 277 PRI 279

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 64/298 (21%), Positives = 115/298 (38%), Gaps = 33/298 (11%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG 81
           VS +   +  G+  C A T+  P+E++KT M     +         N  Q++K ++   G
Sbjct: 16  VSFSNILLGAGLNLCEATTLGQPLEVIKTTMAANRNL---------NFGQSVKHVWSRGG 66

Query: 82  IRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAV-NVVSGATS 140
           + G  +GL      +    G+ L             F  A   ++ + + + N  +G   
Sbjct: 67  VFGFYQGLIPWAWIEASTKGAVL------------LFVSAEAEYQFKRLGLGNFGAGIMG 114

Query: 141 GIIGAIMGSPL---FLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVD 197
           G+ G +  + L   F    +    + A          S W+    IY  EG KG+ +GV+
Sbjct: 115 GVSGGVAQAYLTMGFCTCMKTVEITKAKSAVAGAIPQSSWSAFKEIYSKEGIKGINKGVN 174

Query: 198 AAILR--TGAGSSVQLP--IYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWD 253
           A  +R  T  GS   L   +    + F  K +   + T L  + ++  G G+     P +
Sbjct: 175 AVAIRQMTNWGSRFGLSRLVEQGIRDFTGKTNPDDKLTALEKIFASALGGGLSAWNQPIE 234

Query: 254 VILTRVYNQKGNLYKGPL----DCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTF 307
           VI   + ++K +  +         F    +  GI  LY+G   +I      T+  + F
Sbjct: 235 VIRVEMQSKKEDPNRPKKLTVGSAFKYIYQSSGIKGLYRGVAPRIGLGVWQTVFMVGF 292

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 69/307 (22%), Positives = 125/307 (40%), Gaps = 48/307 (15%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
             +AG       V +  P +  K R+Q   ++   A  + KN       + KNEG +G  
Sbjct: 28  DLLAGTAGGIAQVLIGQPFDTTKVRLQTS-KVPTSAAEVVKN-------LLKNEGPKGFY 79

Query: 87  KGL--------SCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGA 138
           KG         +C  I Q G+N +   F+   R+V         D +   +++   + G 
Sbjct: 80  KGTLTPLVGVGACVSI-QFGVNEAMKRFFH-ARNV---------DHNATLSLSQYYLCGL 128

Query: 139 TSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDA 198
           T G+  + + SP+  ++ R+Q+ + +   G Q  +      +  I +    KGL RG+  
Sbjct: 129 TGGMTNSFLASPIEHVRIRLQTQTGS---GAQAEFKGP---IDCIKKLRSQKGLMRGLIP 182

Query: 199 AILRTGAGSSVQLPIYNTAKHFLLKHDLMK-EGTGLHL-VASTVSGFGVGVVMNPWDVI- 255
            +LR G G      +Y       +   L + E     L +   +SG  + +++ P DV+ 
Sbjct: 183 TMLREGHGCGTYFLVYEALVSKQINQGLKRTEIPPWKLCLYGALSGTALWLMVYPIDVVK 242

Query: 256 -------LTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFM 308
                  L +  N K N+ +   + + +    EG+ A +KGF   + R AP         
Sbjct: 243 SVMQTDNLNKPQNGK-NMIQVARNLYAR----EGLKAFFKGFGPTMLRAAPANGGTFATF 297

Query: 309 EQTMKVV 315
           E  M+++
Sbjct: 298 ELAMRLL 304

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 75/173 (43%), Gaps = 21/173 (12%)

Query: 122 MDPHKVQN---VAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWN 178
           ++ H  Q+   V  ++++G   GI   ++G P    K R+Q+             TS   
Sbjct: 14  LEDHPGQDNGRVVKDLLAGTAGGIAQVLIGQPFDTTKVRLQTSKVP---------TSAAE 64

Query: 179 GLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVAS 238
            + ++ + EG KG Y+G    ++  GA  S+Q  +    K F    ++    T L L   
Sbjct: 65  VVKNLLKNEGPKGFYKGTLTPLVGVGACVSIQFGVNEAMKRFFHARNVDHNAT-LSLSQY 123

Query: 239 TVSGFGVGV----VMNPWDVILTRVYNQKGN----LYKGPLDCFVKTVRIEGI 283
            + G   G+    + +P + +  R+  Q G+     +KGP+DC  K    +G+
Sbjct: 124 YLCGLTGGMTNSFLASPIEHVRIRLQTQTGSGAQAEFKGPIDCIKKLRSQKGL 176

>Scas_697.47
          Length = 328

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 72/309 (23%), Positives = 120/309 (38%), Gaps = 52/309 (16%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKN------- 79
           S +AGG+    AV   +P +L+K R Q  G+ S+         + A+K+I K+       
Sbjct: 39  SLVAGGVGGVCAVLTGHPFDLIKVRCQ-SGQASST--------IHAIKIILKDARAIPTS 89

Query: 80  ----EGIRGLQKG-----LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNV 130
                 ++G  KG     L    I+ +   G  +G     RS          D    Q  
Sbjct: 90  NMLVNSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTRS----------DSSSAQ-- 137

Query: 131 AVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFK 190
            + +   A +G I AI   P  L+    +     +Q       TS      +I +  G K
Sbjct: 138 -LTMGQMAAAGFISAI---PTTLVTAPTERIKVVLQTAGANSKTSFIGAAKNIVKDGGVK 193

Query: 191 GLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEG-TGLHLVAST-----VSGFG 244
            L++G  A + R G GS++    Y  +K FL   +   E  TG   +A+      ++G  
Sbjct: 194 SLFKGSLATLARDGPGSALYFASYEISKKFLNDRNATAESKTGEVNIANVCLAGGIAGMS 253

Query: 245 VGVVMNPWDVILTRVYNQKG--NLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTI 302
           + +V+ P D I T++ +  G  ++     + +VK     GI   + G    + R  P   
Sbjct: 254 MWLVVFPIDTIKTKLQSSSGSQSMVAATREIYVKR---GGIKGFFPGLGPALLRSFPANA 310

Query: 303 LCLTFMEQT 311
                +E T
Sbjct: 311 ATFLGVELT 319

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 80/184 (43%), Gaps = 21/184 (11%)

Query: 123 DPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSS 182
           D  + +    +++SG + GI   ++G P  + K RMQ+ S     G  T    I N    
Sbjct: 16  DAPEFRKAIKDIISGTSGGIAQVLVGQPFDITKVRMQTSS-----GSPTAIEVIKN---- 66

Query: 183 IYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSG 242
           + + EG    Y+G    ++  GA  S Q  +    K + L+ +  K+   L L+     G
Sbjct: 67  LVKNEGLLAFYKGTLVPLIGVGACVSCQFGVNEAMKRYFLRVNGYKD-QHLSLLQYYTCG 125

Query: 243 FGVG----VVMNPWDVILTRVYNQKGNL----YKGPLDCFVKTVRIEGIGALYKGFEAQI 294
           F  G     +  P + +  R+  Q   L    Y+G LDC  K ++ +   AL +GF A +
Sbjct: 126 FVSGSANAFLATPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQK---ALMRGFTATL 182

Query: 295 FRIA 298
            R +
Sbjct: 183 MRTS 186

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 68/307 (22%), Positives = 122/307 (39%), Gaps = 42/307 (13%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           I+G       V V  P ++ K RMQ     S  A  + KN       + KNEG+    KG
Sbjct: 28  ISGTSGGIAQVLVGQPFDITKVRMQTSSG-SPTAIEVIKN-------LVKNEGLLAFYKG 79

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAV--NVVSGATSGIIGAI 146
                I        + G  E +     K ++  ++ +K Q++++      G  SG   A 
Sbjct: 80  TLVPLIGVGACVSCQFGVNEAM-----KRYFLRVNGYKDQHLSLLQYYTCGFVSGSANAF 134

Query: 147 MGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAG 206
           + +P+  ++ R+Q  + A+    +  Y    + +  + +    K L RG  A ++RT  G
Sbjct: 135 LATPIEHVRIRLQLQTKALA---KAEYRGSLDCMKKLLKQ---KALMRGFTATLMRTSHG 188

Query: 207 SSVQLPIY-----NTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYN 261
             V    Y     N  K+ +L+ D+         V    SG     +  P+DV+ + +  
Sbjct: 189 FGVYFLTYEALIMNQNKNGVLRKDIPPWKV---CVFGAFSGAFFWAMTYPFDVVKSIMQA 245

Query: 262 QK-------GNLYKGPLDCFVKTVR-IEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMK 313
            +        N+++       K++    G GA  KGF   + R  P         E TM+
Sbjct: 246 DRLVSPVHGKNVFQ-----VAKSIHATRGWGAFVKGFVPTMLRSLPVNGATFATFEVTMR 300

Query: 314 VVYAVEK 320
           ++ +++K
Sbjct: 301 LLESLDK 307

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 76/181 (41%), Gaps = 21/181 (11%)

Query: 25  TGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRG 84
           T  F++G   A +A     PIE V+ R+QLQ +  A A+  Y+  +  +K + K    + 
Sbjct: 123 TCGFVSGSANAFLA----TPIEHVRIRLQLQTKALAKAE--YRGSLDCMKKLLKQ---KA 173

Query: 85  LQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKT--FYPAMDPHKVQNVAVNVVSGATSGI 142
           L +G +   +      G     YE +    NK       + P KV       V GA SG 
Sbjct: 174 LMRGFTATLMRTSHGFGVYFLTYEALIMNQNKNGVLRKDIPPWKV------CVFGAFSGA 227

Query: 143 IGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILR 202
               M  P  ++K+ MQ    A ++    H  +++    SI+   G+    +G    +LR
Sbjct: 228 FFWAMTYPFDVVKSIMQ----ADRLVSPVHGKNVFQVAKSIHATRGWGAFVKGFVPTMLR 283

Query: 203 T 203
           +
Sbjct: 284 S 284

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 94/209 (44%), Gaps = 20/209 (9%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPM-QALKVIFKNE 80
           +SK  ++IAGG+A   A     PI+ +K R+Q       D +    N + Q  K +F+  
Sbjct: 345 LSKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQC---APLDTKLKGNNLLFQTAKDMFREG 401

Query: 81  GIRGLQKGLSCAYIYQIGLNGSRLGFYEPIR----SVLNKTFYPAMDPHKVQNVAVNVVS 136
           G+R   +G++   +         LG +  ++    +   KT     D   + N+ V +  
Sbjct: 402 GLRLFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVV-LPM 460

Query: 137 GATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSI----YRAEGFKGL 192
           GA SG +GA +  P+ L++TR+Q+       G   H   ++NG   +       EG++GL
Sbjct: 461 GAFSGTVGASVVYPINLLRTRLQAQ------GTYAH-PYVYNGFKDVLLKTLEREGYQGL 513

Query: 193 YRGVDAAILRTGAGSSVQLPIYNTAKHFL 221
           ++G+   + +     S+    Y   K F+
Sbjct: 514 FKGLVPTLAKVCPAVSISYLCYENLKKFM 542

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 68/321 (21%), Positives = 128/321 (39%), Gaps = 37/321 (11%)

Query: 26  GSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMS----------------ADAQRIYKNP 69
           G FIAGG++  I+ T T P + +K  +  + ++S                AD  +I    
Sbjct: 229 GFFIAGGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSPL 288

Query: 70  MQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQN 129
            +A+K +++  GI+    G     I     +  + G +E  + ++ K      D   +  
Sbjct: 289 AKAVKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTK-LEGCRDTKDLSK 347

Query: 130 VAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGF 189
            +   ++G  +G+       P+  +K R+Q      ++        ++     ++R  G 
Sbjct: 348 FST-YIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNL---LFQTAKDMFREGGL 403

Query: 190 KGLYRGVDAAI--------LRTGAGSSV-QLPIYNTAKHFLLKHDLMKEGTGLHLVASTV 240
           +  YRGV   I        L  G  S++ +  I   AK   L  D +     + L     
Sbjct: 404 RLFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLPMGAF 463

Query: 241 SGFGVGVVMNPWDVILTRVYNQ----KGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFR 296
           SG     V+ P +++ TR+  Q       +Y G  D  +KT+  EG   L+KG    + +
Sbjct: 464 SGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVPTLAK 523

Query: 297 IAPH---TILCLTFMEQTMKV 314
           + P    + LC   +++ M +
Sbjct: 524 VCPAVSISYLCYENLKKFMNL 544

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 87/197 (44%), Gaps = 24/197 (12%)

Query: 128 QNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAE 187
           +    +++ G + G++ AI+  P  L+KTR+          QQ   +++W  L SI   E
Sbjct: 5   RRATTHLIGGFSGGLVSAIILQPFDLLKTRL----------QQDKTSTLWKTLKSI---E 51

Query: 188 GFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLK-HDLMKEGTGL--------HLVAS 238
               L+RG   + +RT  GS++ L + N+ +  + K  +    G+          ++ + 
Sbjct: 52  TPSQLWRGALPSCIRTSVGSAMYLTMLNSIRQAISKGKNTGSTGSSYLPQLNMYENMFSG 111

Query: 239 TVSGFGVGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIA 298
            V+    G++  P  VI  R Y      Y           R EG+   ++GF A   R A
Sbjct: 112 AVTRALTGLITMPITVIKVR-YESTLYQYTSLRYATSHIFRTEGLRGFFRGFGATALRDA 170

Query: 299 PHTILCLTFMEQTMKVV 315
           P+  L + F ++ MKV+
Sbjct: 171 PYAGLYMLFYDR-MKVL 186

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 69/296 (23%), Positives = 118/296 (39%), Gaps = 49/296 (16%)

Query: 25  TGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRG 84
           T   I G     ++  +  P +L+KTR+Q Q + S     ++K     LK I   E    
Sbjct: 8   TTHLIGGFSGGLVSAIILQPFDLLKTRLQ-QDKTST----LWKT----LKSI---ETPSQ 55

Query: 85  LQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNK---------TFYPAMDPHKVQNVAVNVV 135
           L +G   + I     +   L     IR  ++K         ++ P +      N+  N+ 
Sbjct: 56  LWRGALPSCIRTSVGSAMYLTMLNSIRQAISKGKNTGSTGSSYLPQL------NMYENMF 109

Query: 136 SGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRG 195
           SGA +  +  ++  P+ +IK R +S            YTS+    S I+R EG +G +RG
Sbjct: 110 SGAVTRALTGLITMPITVIKVRYES--------TLYQYTSLRYATSHIFRTEGLRGFFRG 161

Query: 196 VDAAILRTGAGSSVQLPIYNTAKHF---LLKHDLMKEGTG--LHLVASTV----SGFGVG 246
             A  LR    + + +  Y+  K     LL  +++K  +       AST+    S F   
Sbjct: 162 FGATALRDAPYAGLYMLFYDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSAA 221

Query: 247 VVMN----PWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIA 298
           V+      P+D + TR+  +    +      F      E +  L+ G   ++ R A
Sbjct: 222 VIATSITAPFDTVKTRMQLEPAKFHSFT-STFWHIATKESVRNLFAGISLRLTRKA 276

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 43/196 (21%), Positives = 83/196 (42%), Gaps = 26/196 (13%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
            +G +   +   +T PI ++K R +     S   Q  Y +   A   IF+ EG+RG  +G
Sbjct: 109 FSGAVTRALTGLITMPITVIKVRYE-----STLYQ--YTSLRYATSHIFRTEGLRGFFRG 161

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPA-----MDPHKVQNVAVNVVSGA---TS 140
                +      G  + FY+ ++ VL  T  P+        ++    A  +++G+   ++
Sbjct: 162 FGATALRDAPYAGLYMLFYDRMK-VLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSA 220

Query: 141 GIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTS-IWNGLSSIYRAEGFKGLYRGVDAA 199
            +I   + +P   +KTRMQ     ++  +   +TS  W+    I   E  + L+ G+   
Sbjct: 221 AVIATSITAPFDTVKTRMQ-----LEPAKFHSFTSTFWH----IATKESVRNLFAGISLR 271

Query: 200 ILRTGAGSSVQLPIYN 215
           + R    + +   IY 
Sbjct: 272 LTRKAFSAGIAWGIYE 287

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 33/77 (42%), Gaps = 7/77 (9%)

Query: 34  AACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGLSCAY 93
           AA IA ++T P + VKTRMQL+          + +       I   E +R L  G+S   
Sbjct: 220 AAVIATSITAPFDTVKTRMQLEPAK-------FHSFTSTFWHIATKESVRNLFAGISLRL 272

Query: 94  IYQIGLNGSRLGFYEPI 110
             +    G   G YE I
Sbjct: 273 TRKAFSAGIAWGIYEEI 289

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 71/328 (21%), Positives = 132/328 (40%), Gaps = 51/328 (15%)

Query: 26  GSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMS----------------ADAQRIYKNP 69
           G FIAGG +  I+ T T P + +K  +  + ++S                AD  +I    
Sbjct: 197 GFFIAGGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSPL 256

Query: 70  MQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMD-PHKVQ 128
           ++A   +++  GIR    G     I     +  + G +E     L K     ++  H   
Sbjct: 257 IKAATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFE-----LAKQLMAHLEGVHHTS 311

Query: 129 NVA--VNVVSGATSGIIGAIMGSPLFLIKTRMQ--SYSNAIQIGQQTHYTSIWNGLSSIY 184
            ++     ++G   G++      P+  +K R+Q      A++  +    T+       +Y
Sbjct: 312 ELSKFSTYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTA-----RQMY 366

Query: 185 RAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFG 244
           R  G K  YRGV   ++     +++ L  ++  K + +      + TG+ +   T+S F 
Sbjct: 367 RDGGLKLFYRGVTVGVMGIFPYAALDLGTFSALKKWYIAR--QAKMTGVPVDQVTISNFI 424

Query: 245 V-----------GVVMNPWDVILTRVYNQ----KGNLYKGPLDCFVKTVRIEGIGALYKG 289
           V             V+ P +++ TR+  Q      + Y G  D   KTV+ EG   L+KG
Sbjct: 425 VLPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKG 484

Query: 290 FEAQIFRIAPH---TILCLTFMEQTMKV 314
               + ++ P    + LC    ++ MK+
Sbjct: 485 LVPNLAKVCPAVSISYLCYENFKRLMKL 512

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/215 (23%), Positives = 94/215 (43%), Gaps = 32/215 (14%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQ---LQGEMSADAQRIYKNPMQALKVIFK 78
           +SK  ++IAGGM   +A     PI+ +K R+Q   L   +  +   I        + +++
Sbjct: 313 LSKFSTYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLI-----STARQMYR 367

Query: 79  NEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVS-- 136
           + G++   +G++   +         LG +  +     K +Y A    K+  V V+ V+  
Sbjct: 368 DGGLKLFYRGVTVGVMGIFPYAALDLGTFSAL-----KKWYIARQA-KMTGVPVDQVTIS 421

Query: 137 -------GATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTH---YTSIWNGLSSIYRA 186
                  GA SG +GA +  P+ L++TR+Q+       G   H   YT   + L    + 
Sbjct: 422 NFIVLPMGAFSGTVGATVVYPINLLRTRLQAQ------GTYAHPHTYTGFRDVLWKTVQR 475

Query: 187 EGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFL 221
           EG++GL++G+   + +     S+    Y   K  +
Sbjct: 476 EGYQGLFKGLVPNLAKVCPAVSISYLCYENFKRLM 510

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/284 (21%), Positives = 125/284 (44%), Gaps = 39/284 (13%)

Query: 37  IAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGLSCAYIYQ 96
           +++ +T P+  + TRMQ+  +      R  K+ ++A++ I++ EG+ G   GL  A    
Sbjct: 29  LSMALTMPLVTLATRMQVSEQDKEPGTR-SKSKLEAVREIYRKEGVVGFYYGLESA---M 84

Query: 97  IGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKT 156
            G+  + L +Y         T    +   +  N +  ++S A +G + AI  +P++++ T
Sbjct: 85  YGMAANSLNYYYFYELAARATM--RVRGSRRLNTSEAILSSAVAGSMTAIASNPIWVVNT 142

Query: 157 RMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNT 216
           RM      +   +Q+    + +    I R +G   L+ G+  A++   +   +Q  ++  
Sbjct: 143 RM-----TVAKSEQSTLAVLLD----IVRKDGVTALFNGLRPALMLV-SNPIIQYTVFEQ 192

Query: 217 AKHFLLK---HDLMKEGTGLHL-----VASTVSGFGVGVVMNPWDVILTRVYNQKG---- 264
            K+ +LK    D++       L     +A+T S +       P+  + TR++  KG    
Sbjct: 193 LKNVVLKWSGSDVLLPSWAFLLGAVGKLAATGSTY-------PYITLKTRMHLAKGKEDA 245

Query: 265 NLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFM 308
           +  +      V  V+ EGI  LY G   ++      +IL   F+
Sbjct: 246 DTQQSMWSLMVDIVKKEGIQGLYHGIGVKL----TQSILTAAFL 285

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 72/167 (43%), Gaps = 6/167 (3%)

Query: 150 PLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSV 209
           PL  + TRMQ      + G  T   S    +  IYR EG  G Y G+++A+    A S  
Sbjct: 36  PLVTLATRMQVSEQDKEPG--TRSKSKLEAVREIYRKEGVVGFYYGLESAMYGMAANSLN 93

Query: 210 QLPIYNTAKHFLLK-HDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQKGNLYK 268
               Y  A    ++     +  T   +++S V+G    +  NP  V+ TR+   K    +
Sbjct: 94  YYYFYELAARATMRVRGSRRLNTSEAILSSAVAGSMTAIASNPIWVVNTRMTVAKSE--Q 151

Query: 269 GPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVV 315
             L   +  VR +G+ AL+ G    +  ++ + I+  T  EQ   VV
Sbjct: 152 STLAVLLDIVRKDGVTALFNGLRPALMLVS-NPIIQYTVFEQLKNVV 197

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 77/180 (42%), Gaps = 39/180 (21%)

Query: 26  GSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGL 85
            S +AG M A      +NPI +V TRM +         +  ++ +  L  I + +G+  L
Sbjct: 122 SSAVAGSMTAI----ASNPIWVVNTRMTVA--------KSEQSTLAVLLDIVRKDGVTAL 169

Query: 86  QKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGA 145
             GL  A +              PI   +  T +  +    ++    +V+  + + ++GA
Sbjct: 170 FNGLRPALML----------VSNPI---IQYTVFEQLKNVVLKWSGSDVLLPSWAFLLGA 216

Query: 146 I-----MGS--PLFLIKTRMQSYSNAIQIGQQTHYT--SIWNGLSSIYRAEGFKGLYRGV 196
           +      GS  P   +KTRM      +  G++   T  S+W+ +  I + EG +GLY G+
Sbjct: 217 VGKLAATGSTYPYITLKTRMH-----LAKGKEDADTQQSMWSLMVDIVKKEGIQGLYHGI 271

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 71/297 (23%), Positives = 114/297 (38%), Gaps = 37/297 (12%)

Query: 34  AACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK------ 87
           A  + + V +P++ +  R+     MS   +    +  Q   VIF+      L K      
Sbjct: 19  AGILEIGVFHPVDTISKRL-----MSNHTK--IGSSSQLNSVIFREHAAEPLSKRVFTLF 71

Query: 88  -GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDP---HKVQNVAVNVVSGATSGII 143
            GL  A  Y+I     + G        LN+ F    D     K      +  +G+  GI 
Sbjct: 72  PGLGYAATYKILQRVYKYGGQPFANEFLNRNFKADFDNTFGEKTGKALRSATAGSMIGI- 130

Query: 144 GAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRT 203
           G I+  PL ++K + Q+   A +            G   I + EG  GLYRG      R 
Sbjct: 131 GEIVLLPLDVLKIKRQTNPEAFK----------GRGFVKILKDEGL-GLYRGWGWTAARN 179

Query: 204 GAGSSVQLPIYNTAKHFLLK-HDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQ 262
             GS         AK ++L   D  +     + V+S V      ++  P DVI TR+ N+
Sbjct: 180 APGSFALFGGNAFAKEYILGLKDYSQATWSQNFVSSIVGASASLIISAPLDVIKTRIQNK 239

Query: 263 KGNLYKGPLDCFV---KTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVY 316
               ++ P   F     T++ EG  A +KG   ++    P  +     + QT+  V+
Sbjct: 240 N---FENPESGFTIVKNTLKNEGFSAFFKGLTPKLLTTGPKLVFSFA-LAQTLIPVF 292

 Score = 32.3 bits (72), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 35/67 (52%), Gaps = 12/67 (17%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVI---FKNEGIR 83
           +F++  + A  ++ ++ P++++KTR+Q          + ++NP     ++    KNEG  
Sbjct: 211 NFVSSIVGASASLIISAPLDVIKTRIQ---------NKNFENPESGFTIVKNTLKNEGFS 261

Query: 84  GLQKGLS 90
              KGL+
Sbjct: 262 AFFKGLT 268

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/288 (22%), Positives = 108/288 (37%), Gaps = 31/288 (10%)

Query: 34  AACIAVTVTNPIELVKTR-MQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK----- 87
           A  + + V +P++ +  R M    ++++ AQ           VIF++       K     
Sbjct: 20  AGILEIGVFHPVDTISKRLMSNHTKITSGAQ--------LNSVIFRDHAAEAFGKRVFTL 71

Query: 88  --GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDP---HKVQNVAVNVVSGATSGI 142
             GL  A +Y+I     + G        LNK F    D     K      +  +G+  GI
Sbjct: 72  FPGLGYAAVYKILQRVYKYGGQPFANEFLNKHFKKDFDSAFGDKTGKALRSATAGSLIGI 131

Query: 143 IGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILR 202
            G I+  PL ++K + Q+   A +            G   I + EG   LYRG      R
Sbjct: 132 -GEIVLLPLDVLKIKRQTNPEAFK----------GRGFLKILKDEGIFNLYRGWGWTAAR 180

Query: 203 TGAGSSVQLPIYNTAKHFLLK-HDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYN 261
              GS         AK ++L   D  +     + ++S V      +V  P DVI TR+ N
Sbjct: 181 NAPGSFALFGGNAFAKEYILGLQDYSQATWSQNFISSIVGASASLIVSAPLDVIKTRIQN 240

Query: 262 QKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFME 309
           +  +  +        T++ EG  A +KG   ++    P  +      +
Sbjct: 241 RNFDNPESGFKIVKNTLKNEGFTAFFKGLTPKLLTTGPKLVFSFALAQ 288

>Scas_718.5
          Length = 324

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 82/188 (43%), Gaps = 27/188 (14%)

Query: 130 VAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGF 189
           V  ++++G   GI   I+G P    K RMQ+ + ++            + +  + + EG 
Sbjct: 39  VLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSV---------GALDIIRKLVKNEGV 89

Query: 190 KGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDL-----MKEGTGLHLVASTVSGFG 244
              Y+G    I+  GA  SVQ  +    K F  + +       ++GT L L    + G  
Sbjct: 90  WAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGT-LQLGQYYICGLT 148

Query: 245 VGVV----MNPWDVILTRVYNQKGN----LYKGPLDCFVKTVRIEGIGALYKGFEAQIFR 296
            GVV     +P + +  R+  Q GN     +KGPLDC  K V+ +   +L +G    + R
Sbjct: 149 GGVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKEK---SLMRGLRPMMLR 205

Query: 297 IAPHTILC 304
            A H + C
Sbjct: 206 -AGHGLGC 212

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 63/300 (21%), Positives = 123/300 (41%), Gaps = 33/300 (11%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           +AG       V V  P +  K RMQ   +            +  ++ + KNEG+    KG
Sbjct: 44  LAGTCGGISQVIVGQPFDTTKVRMQTSAKSVG--------ALDIIRKLVKNEGVWAFYKG 95

Query: 89  LSCAYIYQIGLNGS-RLGFYEPIRSVLNKTFYPAMDPHKVQNVAVN--VVSGATSGIIGA 145
            S   I  +G   S + G  E ++    +        H+   + +    + G T G++ +
Sbjct: 96  -SLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTGGVVNS 154

Query: 146 IMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGA 205
            + SP+  ++ R+Q+ +     G +  +    + +  + +    K L RG+   +LR G 
Sbjct: 155 FLASPIEHVRIRLQTQTGN---GNEREFKGPLDCIRKLVKE---KSLMRGLRPMMLRAGH 208

Query: 206 GSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVAS-------TVSGFGVGVVMNPWDVILTR 258
           G    L  Y      L+ +++ K+G     +AS       ++SG  + + + P DV+ + 
Sbjct: 209 G----LGCYFLTYEALIANEI-KKGKDRSEIASWKLCSYGSLSGVVLWLAIYPLDVVKSM 263

Query: 259 VYNQ--KGNLYKGPLDCFVKTV-RIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVV 315
           +     +   +K  +   +  + R +GI A +KGF   + R AP         E  M+++
Sbjct: 264 IQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFELVMRLL 323

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 65/308 (21%), Positives = 123/308 (39%), Gaps = 49/308 (15%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
            AG M     V V  P +  K R+Q          +     ++ ++ + +NEG     KG
Sbjct: 31  FAGTMGGVAQVLVGQPFDTTKVRLQ--------TSKTKIGVIEVVQNLLRNEGALAFYKG 82

Query: 89  LSCAYI-------YQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVN--VVSGAT 139
           +    +        Q G+N S   F+    +         +DP K   + ++   + G T
Sbjct: 83  MLTPLLGVGICVSVQFGVNESMKRFFAAYNA-------DRVDPQKHVPLPLHQYYLCGLT 135

Query: 140 SGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAA 199
            G++ + + +P+  ++ R+Q+ ++    G +  +   ++ +  + +A   K L RG+   
Sbjct: 136 GGVVNSFLAAPIEHVRIRLQTQTSQ---GNERQFKGPFDCIKKLAKA---KALMRGLLPT 189

Query: 200 ILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFG------VGVVMNPWD 253
           ++R G G    L  Y  A   L+  +  K      + A  +  FG      + + + P D
Sbjct: 190 MIRAGHG----LGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPVD 245

Query: 254 VILTRVYNQ--KGNLYKGPLDCFVKTVRI----EGIGALYKGFEAQIFRIAPHTILCLTF 307
           V+ + +     +   YK   +  +K  R      GI A +KGF   + R AP        
Sbjct: 246 VVKSVLQTDSIENPKYK---NSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVS 302

Query: 308 MEQTMKVV 315
            E TM+V+
Sbjct: 303 FEMTMRVL 310

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 74/185 (40%), Gaps = 24/185 (12%)

Query: 124 PHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSI 183
           P     V  ++ +G   G+   ++G P    K R+Q+    I          +   + ++
Sbjct: 20  PTPYGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKI---------GVIEVVQNL 70

Query: 184 YRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVAST---- 239
            R EG    Y+G+   +L  G   SVQ  +  + K F   ++  +     H+        
Sbjct: 71  LRNEGALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYY 130

Query: 240 VSGFGVGVVMN----PWDVILTRVYNQ--KGN--LYKGPLDCFVKTVRIEGIGALYKGFE 291
           + G   GVV +    P + +  R+  Q  +GN   +KGP DC  K  + +   AL +G  
Sbjct: 131 LCGLTGGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAKAK---ALMRGLL 187

Query: 292 AQIFR 296
             + R
Sbjct: 188 PTMIR 192

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 80/187 (42%), Gaps = 39/187 (20%)

Query: 25  TGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRG 84
           T +++  G   C+       +E+ + +    G +   +  ++KN       I+K EGIRG
Sbjct: 123 TQAYLTMGFCTCMKT-----VEITRHKSASAGGVPQSSWSVFKN-------IYKKEGIRG 170

Query: 85  LQKGLSCAYIYQIGLNGSRLGFY----EPIRSVLNKTFY-PAMDPHKVQNVAVNVVSGAT 139
           + KG++   I Q+   GSR G      + IR +  KT     ++P   + +  + + G  
Sbjct: 171 INKGVNAVAIRQMTNWGSRFGLSRLVEDGIRKITGKTNKDDKLNPF--EKIGASALGGGL 228

Query: 140 SGIIGAIMGSPLFLIKTRMQSYSNA------IQIGQQTHYTSIWNGLSSIYRAEGFKGLY 193
           S         P+ +I+  MQS          + +G+   Y         IY++ G KGLY
Sbjct: 229 SA-----WNQPIEVIRVEMQSKKEDPNRPKNLTVGKTFKY---------IYQSNGLKGLY 274

Query: 194 RGVDAAI 200
           RGV   I
Sbjct: 275 RGVTPRI 281

 Score = 35.0 bits (79), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 75/176 (42%), Gaps = 25/176 (14%)

Query: 33  MAACI----AVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           + AC+      T+  P+E+VKT       M+A+    +   ++++K ++   GI G  +G
Sbjct: 25  LGACLNLSEVTTLGQPLEVVKT------TMAANRNFTF---LESVKHVWSRGGILGYYQG 75

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGA--I 146
           L      +    G+ L F         K+         + N A  ++ G T G+  A   
Sbjct: 76  LIPWAWIEASTKGAVLLFVSAEAEYRFKSL-------GLNNFASGILGGVTGGVTQAYLT 128

Query: 147 MGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILR 202
           MG    +    +  + +A   G      S W+   +IY+ EG +G+ +GV+A  +R
Sbjct: 129 MGFCTCMKTVEITRHKSASAGGVPQ---SSWSVFKNIYKKEGIRGINKGVNAVAIR 181

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 61/323 (18%), Positives = 124/323 (38%), Gaps = 70/323 (21%)

Query: 26  GSFIAGGMAACIAVTVTNPIELVKTRMQLQGEM-SADAQRIYKNPMQALKVIFKNEGIRG 84
            + +AG  AA    T+++P E +KT  QL   + +A+A  ++ +             ++ 
Sbjct: 10  SNLLAGSAAAVFQTTLSHPFEFLKTGQQLHRSLPNAEAFNMFHH-------------VKS 56

Query: 85  LQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIG 144
              G S   I  +    +R   ++    +L     P      ++ +A    +G+ +G + 
Sbjct: 57  YFAGCSALNIGILLKTATRFATFDKACQLLKDPENPEAPVSGLRLIA----AGSITGFME 112

Query: 145 AIMGSPLFLIKTRM--------QSYSNAIQIG---------------------------- 168
           +++  P   IKTRM          Y   ++ G                            
Sbjct: 113 SMLIIPFENIKTRMIENALILSNRYQEEVETGGKDKPRSKSVNNMETKEQIRPKLYKQVK 172

Query: 169 -------------QQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYN 215
                        ++   T+I+  +  + +  GF   ++G    I R    S+V+   Y 
Sbjct: 173 KEINPRYEKFLYYEKHPSTNIFTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTYT 232

Query: 216 TAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQ-KGNLYKGPLDCF 274
           T K  +  +  + E     +     S   V  +  P DV+ TR+ ++   +LY+  L+C 
Sbjct: 233 TLKQMISPNKPLSEYYAFGI--GVFSSCAVVALTQPIDVVKTRMQSKYTWSLYRNSLNCV 290

Query: 275 VKTVRIEGIGALYKGFEAQIFRI 297
            +T   EG+ +L+KG+  ++F++
Sbjct: 291 YRTFIEEGLTSLWKGWVPRLFKV 313

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 51/94 (54%), Gaps = 7/94 (7%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG 81
           +S+  +F  G  ++C  V +T PI++VKTRMQ     S     +Y+N +  +   F  EG
Sbjct: 244 LSEYYAFGIGVFSSCAVVALTQPIDVVKTRMQ-----SKYTWSLYRNSLNCVYRTFIEEG 298

Query: 82  IRGLQKGLSCAYIYQIGLNGS-RLGFYEPIRSVL 114
           +  L KG     ++++GL+G    G Y+ + +++
Sbjct: 299 LTSLWKGW-VPRLFKVGLSGGVSFGVYQYVDNLM 331

 Score = 30.0 bits (66), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 37/89 (41%), Gaps = 12/89 (13%)

Query: 137 GATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRA---EGFKGLY 193
           G  S      +  P+ ++KTRMQS         +  ++   N L+ +YR    EG   L+
Sbjct: 253 GVFSSCAVVALTQPIDVVKTRMQS---------KYTWSLYRNSLNCVYRTFIEEGLTSLW 303

Query: 194 RGVDAAILRTGAGSSVQLPIYNTAKHFLL 222
           +G    + + G    V   +Y    + +L
Sbjct: 304 KGWVPRLFKVGLSGGVSFGVYQYVDNLML 332

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 61/137 (44%), Gaps = 18/137 (13%)

Query: 70  MQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQN 129
           +Q  K IF  EG+RG+ KG++   I Q+   GSR G    +   + +  +   D  K+  
Sbjct: 154 LQVFKQIFAAEGLRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRRVTHKRSD-EKLSA 212

Query: 130 VAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNA------IQIGQQTHYTSIWNGLSSI 183
           +   V S    G+  +    P+ +I+  MQS +N       + +G+   Y         I
Sbjct: 213 MEKIVASALGGGL--SAWNQPIEVIRVEMQSRTNDPNRPKNLTVGKTFRY---------I 261

Query: 184 YRAEGFKGLYRGVDAAI 200
           Y   G +GLYRGV   I
Sbjct: 262 YENNGLRGLYRGVTPRI 278

>Kwal_23.3042
          Length = 542

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 66/327 (20%), Positives = 132/327 (40%), Gaps = 49/327 (14%)

Query: 26  GSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMS----------------ADAQRIYKNP 69
           G FIAGG++  ++ T T P + +K  +  + ++S                AD  +I    
Sbjct: 226 GFFIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSPL 285

Query: 70  MQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQN 129
           ++A   +++  GIR    G     +     +  + G +E  + ++ +          VQ+
Sbjct: 286 VKAATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQL-------EGVQD 338

Query: 130 VA-----VNVVSGATSGIIGAIMGSPLFLIKTRMQSYS-NAIQIGQQTHYTSIWNGLSSI 183
            A        ++G   G++  +   P+  +K R+Q    N    G+Q     + +    +
Sbjct: 339 TAGLSRFSTYLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQL----LISTAKDM 394

Query: 184 YRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFL---------LKHDLMKEGTGLH 234
           Y+  G +  YRG+   I+     +++ L  ++  K +          L  D +       
Sbjct: 395 YKEGGLRIFYRGITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFV 454

Query: 235 LVASTVSGFGVGVVMNPWDVILTRVYNQ----KGNLYKGPLDCFVKTVRIEGIGALYKGF 290
           L+    SG      + P +++ TR+  Q      + Y G  D  +KTV+ EG   L+KG 
Sbjct: 455 LLMGAFSGTVGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGL 514

Query: 291 EAQIFRIAPH---TILCLTFMEQTMKV 314
              + ++ P    + LC   +++ MK+
Sbjct: 515 VPNLAKVCPAVSISYLCYENLKRGMKL 541

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 88/207 (42%), Gaps = 20/207 (9%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG 81
           +S+  +++AGG+   +A     PI+ +K R+Q     +    R  +  +   K ++K  G
Sbjct: 342 LSRFSTYLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGR--QLLISTAKDMYKEGG 399

Query: 82  IRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAM---------DPHKVQNVAV 132
           +R   +G++   +         LG +  +     K +Y A          D   + N+ V
Sbjct: 400 LRIFYRGITVGIMGIFPYAAMDLGTFSAL-----KKWYIARQARLTGLPEDQVTMSNMFV 454

Query: 133 NVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGL 192
            ++ GA SG +GA    P+ L++TR+Q+            Y    + L    + EG++GL
Sbjct: 455 -LLMGAFSGTVGATAVYPVNLLRTRLQAQGT---FAHPHRYNGFRDVLLKTVQREGYQGL 510

Query: 193 YRGVDAAILRTGAGSSVQLPIYNTAKH 219
           ++G+   + +     S+    Y   K 
Sbjct: 511 FKGLVPNLAKVCPAVSISYLCYENLKR 537

>Scas_687.15*
          Length = 328

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 65/137 (47%), Gaps = 11/137 (8%)

Query: 166 QIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHD 225
           Q+  +   ++I++ +  IY   G +G  +G    + R  + S+V+   Y T K  +    
Sbjct: 170 QVYSKYPSSNIFSVVKEIYLTRGLRGFAQGAMPTVFRQVSNSTVRFTAYTTLKQLISPTQ 229

Query: 226 LMKE----GTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQKGN-LYKGPLDCFVKTVRI 280
            + E    G GL       S   V  +  P DV+ TR+ ++  +  YK  L+C  +    
Sbjct: 230 PLNEVYAFGIGLF------SSCAVVALTQPIDVVKTRMQSKTAHYFYKNSLNCAYRVFVE 283

Query: 281 EGIGALYKGFEAQIFRI 297
           EG+ +L+KG+  ++F++
Sbjct: 284 EGMVSLWKGWLPRLFKV 300

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 41/75 (54%), Gaps = 6/75 (8%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           +F  G  ++C  V +T PI++VKTRMQ     S  A   YKN +     +F  EG+  L 
Sbjct: 236 AFGIGLFSSCAVVALTQPIDVVKTRMQ-----SKTAHYFYKNSLNCAYRVFVEEGMVSLW 290

Query: 87  KGLSCAYIYQIGLNG 101
           KG     ++++GL+G
Sbjct: 291 KGW-LPRLFKVGLSG 304

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/204 (21%), Positives = 81/204 (39%), Gaps = 26/204 (12%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           IAG +   +   V  P +L       Q      +  I+      +K I+   G+RG  +G
Sbjct: 144 IAGTLKKKVTFHVAKPKQLSPQEQWRQVYSKYPSSNIF----SVVKEIYLTRGLRGFAQG 199

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMG 148
                  Q+  +  R   Y  ++ +++    P    ++V    + + S  +  ++   + 
Sbjct: 200 AMPTVFRQVSNSTVRFTAYTTLKQLIS----PTQPLNEVYAFGIGLFS--SCAVVA--LT 251

Query: 149 SPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRA---EGFKGLYRGVDAAILRTGA 205
            P+ ++KTRMQS        +  HY    N L+  YR    EG   L++G    + + G 
Sbjct: 252 QPIDVVKTRMQS--------KTAHYF-YKNSLNCAYRVFVEEGMVSLWKGWLPRLFKVGL 302

Query: 206 GSSVQLPIYNTAKHFLLKHDLMKE 229
              +   +Y   ++  L H L KE
Sbjct: 303 SGGISFGVYQYVEN--LSHTLKKE 324

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 62/286 (21%), Positives = 106/286 (37%), Gaps = 27/286 (9%)

Query: 34  AACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK------ 87
           A  + + V +P++ +  R+          Q + +       VIF++     L K      
Sbjct: 20  AGIMEIAVFHPVDTISKRLMSNHTKITSGQELNR-------VIFRDHFSEPLGKRLFTLF 72

Query: 88  -GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIG-- 144
            GL  A  Y++     + G        LNK +    D    +     + S A   +IG  
Sbjct: 73  PGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAMRSAAAGSLIGIG 132

Query: 145 AIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTG 204
            I+  PL ++K + Q+   + +            G   I R EG   LYRG      R  
Sbjct: 133 EIVLLPLDVLKIKRQTNPESFK----------GRGFIKILRDEGLFNLYRGWGWTAARNA 182

Query: 205 AGSSVQLPIYNTAKHFLLK-HDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQK 263
            GS         AK ++L   D  +     + ++S V      +V  P DVI TR+ N+ 
Sbjct: 183 PGSFALFGGNAFAKEYILGLKDYSQATWSQNFISSIVGACSSLIVSAPLDVIKTRIQNRN 242

Query: 264 GNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFME 309
            +  +  L     T++ EG+ A +KG   ++    P  +      +
Sbjct: 243 FDNPESGLRIVKNTLKNEGVTAFFKGLTPKLLTTGPKLVFSFALAQ 288

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 38/67 (56%), Gaps = 12/67 (17%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVI---FKNEGIR 83
           +FI+  + AC ++ V+ P++++KTR+Q          R + NP   L+++    KNEG+ 
Sbjct: 213 NFISSIVGACSSLIVSAPLDVIKTRIQ---------NRNFDNPESGLRIVKNTLKNEGVT 263

Query: 84  GLQKGLS 90
              KGL+
Sbjct: 264 AFFKGLT 270

 Score = 35.0 bits (79), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 84/192 (43%), Gaps = 26/192 (13%)

Query: 124 PH--KVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLS 181
           PH  K Q+    ++  A++GI+   +  P+  I  R+ S    I  GQ+ +     +  S
Sbjct: 2   PHTDKKQSGLARLLGSASAGIMEIAVFHPVDTISKRLMSNHTKITSGQELNRVIFRDHFS 61

Query: 182 SIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNT-----AKHFLLKH------DLMKEG 230
                  F  L+ G+  A     A   V   +Y       A  FL KH      +L  E 
Sbjct: 62  EPLGKRLFT-LFPGLGYA-----ASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEK 115

Query: 231 TGLHL-VASTVSGFGVG-VVMNPWDVI-LTRVYNQKGNLYKGPLDCFVKTVRIEGIGALY 287
           TG  +  A+  S  G+G +V+ P DV+ + R  N +   +KG    F+K +R EG+  LY
Sbjct: 116 TGKAMRSAAAGSLIGIGEIVLLPLDVLKIKRQTNPES--FKG--RGFIKILRDEGLFNLY 171

Query: 288 KGFEAQIFRIAP 299
           +G+     R AP
Sbjct: 172 RGWGWTAARNAP 183

>Scas_715.45
          Length = 305

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 87/195 (44%), Gaps = 15/195 (7%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK 87
            ++   A   A  +  P E +K + Q       +      N ++  K ++  EG+ G  K
Sbjct: 119 LLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCN------NVIEGWKKMYAKEGLNGFYK 172

Query: 88  GLSCAYIYQIGLNGSRLGFYEPI-RSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146
           G++  +  QI     +   +E I  ++  +      +   +Q ++V+ V G  +GI+ AI
Sbjct: 173 GITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAI 232

Query: 147 MGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAG 206
           +  P  ++ +++   +N  ++ +  +       L  IY   GF GL+ G+   IL  G  
Sbjct: 233 VSHPADVMVSKI---NNERKVNESMNV-----ALKRIYSRIGFVGLWNGLPVRILMIGTL 284

Query: 207 SSVQLPIYNTAKHFL 221
           +S Q  IY++ K ++
Sbjct: 285 TSFQWLIYDSFKAYV 299

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 72/175 (41%), Gaps = 14/175 (8%)

Query: 149 SPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSS 208
           +PL LIK R+Q           T Y S  +G+  I + EG   L+ GV A  +      +
Sbjct: 35  TPLDLIKCRLQV--------DPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGA 86

Query: 209 VQLPIYNTAKHFLLKHDLMKEGTG------LHLVASTVSGFGVGVVMNPWDVILTRVYNQ 262
            +   Y   K     H +  E T       ++L++S  + F   +++ P++ I  +    
Sbjct: 87  GKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTT 146

Query: 263 KGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYA 317
                   ++ + K    EG+   YKG      R  P+T+   T  E+ ++ +YA
Sbjct: 147 MPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYA 201

>Kwal_47.19228
          Length = 281

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 56/119 (47%), Gaps = 3/119 (2%)

Query: 180 LSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVAST 239
           +  IYR+ G +G  +G    I+R  + S+V+   Y + K  +  +  + E     L    
Sbjct: 135 VQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMISPNKPLNEYYAFAL--GF 192

Query: 240 VSGFGVGVVMNPWDVILTRVYNQ-KGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRI 297
           +S   V  V  P DVI TR+ ++   + YK  L+C  +    EG    +KG+  ++ ++
Sbjct: 193 ISSCAVVAVTQPIDVIKTRMQSKYTWSNYKNSLNCAYRIFVEEGFTKFWKGWAPRLMKV 251

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 47/89 (52%), Gaps = 7/89 (7%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           +F  G +++C  V VT PI+++KTRMQ +   S      YKN +     IF  EG     
Sbjct: 187 AFALGFISSCAVVAVTQPIDVIKTRMQSKYTWSN-----YKNSLNCAYRIFVEEGFTKFW 241

Query: 87  KGLSCAYIYQIGLNGS-RLGFYEPIRSVL 114
           KG +   + ++GL+G    G Y+ + +++
Sbjct: 242 KGWA-PRLMKVGLSGGVSFGVYQYVDNLM 269

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 61/148 (41%), Gaps = 20/148 (13%)

Query: 70  MQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQN 129
           +  ++ I+++ GIRG  +G     I Q   +  R   Y  ++ +++        P+K  N
Sbjct: 132 LTTVQEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMIS--------PNKPLN 183

Query: 130 VAVNVVSGATSGIIGAIMGSPLFLIKTRMQS---YSNAIQIGQQTHYTSIWNGLSSIYRA 186
                  G  S      +  P+ +IKTRMQS   +SN         Y +  N    I+  
Sbjct: 184 EYYAFALGFISSCAVVAVTQPIDVIKTRMQSKYTWSN---------YKNSLNCAYRIFVE 234

Query: 187 EGFKGLYRGVDAAILRTGAGSSVQLPIY 214
           EGF   ++G    +++ G    V   +Y
Sbjct: 235 EGFTKFWKGWAPRLMKVGLSGGVSFGVY 262

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 84/195 (43%), Gaps = 21/195 (10%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           +A G +      +TNPI ++KTR+     M+      YK+    +  +++ EG+    +G
Sbjct: 118 LAAGSSGIATAVLTNPIWVIKTRI-----MATSRAGPYKSTFDGVYKLYQTEGVLAFWRG 172

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGAT--SGIIGAI 146
           +  +      L  S+   Y  +   L   +  +      + ++V+ + G T  S +I   
Sbjct: 173 VVPSL-----LGVSQGAIYFALYDTLKFHYLHSSTDKAERRLSVSEIIGITCISKMISVT 227

Query: 147 MGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAG 206
              P  L+K+++Q +     I Q          + ++Y  EG +G YRG+ A +LR    
Sbjct: 228 SVYPFQLLKSKLQDFGAPSGITQL---------VQTVYSREGIRGFYRGLSANLLRAVPA 278

Query: 207 SSVQLPIYNTAKHFL 221
           + +   +Y   K+ L
Sbjct: 279 TCITFFVYENIKYRL 293

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 81/176 (46%), Gaps = 17/176 (9%)

Query: 125 HKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIY 184
           H++ ++   V+SG T+G I  I   PL L+K R+Q  +        T YT +   +  I+
Sbjct: 3   HELTSLQREVISGLTAGTITTIASHPLDLLKLRLQLSAGN---RANTTYTGL---IRDIF 56

Query: 185 -RAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGL---------H 234
            R +  + LYRG+   +L      ++    Y  AK   L+H   +  TG+         +
Sbjct: 57  ERQQWGRELYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAY 116

Query: 235 LVASTVSGFGVGVVMNPWDVILTRVY-NQKGNLYKGPLDCFVKTVRIEGIGALYKG 289
           ++A+  SG    V+ NP  VI TR+    +   YK   D   K  + EG+ A ++G
Sbjct: 117 MLAAGSSGIATAVLTNPIWVIKTRIMATSRAGPYKSTFDGVYKLYQTEGVLAFWRG 172

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 79/295 (26%), Positives = 132/295 (44%), Gaps = 38/295 (12%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQ-----RIYKNPMQALKVIFKNEGIR 83
           I+G  A  I    ++P++L+K R+QL     A+       R      Q  + +++  G+ 
Sbjct: 13  ISGLTAGTITTIASHPLDLLKLRLQLSAGNRANTTYTGLIRDIFERQQWGRELYRGLGVN 72

Query: 84  GLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGII 143
            L  G S A+    G    R      +R + N++    MD  ++   A  + +G +SGI 
Sbjct: 73  LL--GNSVAWALYFGCY--RCAKDIALRHLGNESATGIMD-RRLPAHAYMLAAG-SSGIA 126

Query: 144 GAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRT 203
            A++ +P+++IKTR+ + S A        Y S ++G+  +Y+ EG    +RGV  ++L  
Sbjct: 127 TAVLTNPIWVIKTRIMATSRA------GPYKSTFDGVYKLYQTEGVLAFWRGVVPSLLGV 180

Query: 204 GAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQK 263
             G ++   +Y+T K   L     K    L     +VS   +G+      + +T VY  +
Sbjct: 181 SQG-AIYFALYDTLKFHYLHSSTDKAERRL-----SVSEI-IGITCISKMISVTSVYPFQ 233

Query: 264 GNLYKGPLDCF---------VKTV-RIEGIGALYKGFEAQIFRIAPHTILCLTFM 308
             L K  L  F         V+TV   EGI   Y+G  A + R  P T  C+TF 
Sbjct: 234 --LLKSKLQDFGAPSGITQLVQTVYSREGIRGFYRGLSANLLRAVPAT--CITFF 284

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 63/138 (45%), Gaps = 17/138 (12%)

Query: 65  IYKNPMQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDP 124
           I ++  Q  K I+K EGIRG+ KG++   I Q+   GSR G    +   + K        
Sbjct: 144 IPQSSWQVFKSIYKKEGIRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRKLTGKTGKD 203

Query: 125 HKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNA------IQIGQQTHYTSIWN 178
            K+  +   +++ A  G + A    P+ +I+  MQS          + +G+   Y     
Sbjct: 204 DKLTALE-KIMASAIGGGLSA-WNQPIEVIRVEMQSKKEDPNRPKNLTVGKTFKY----- 256

Query: 179 GLSSIYRAEGFKGLYRGV 196
               IY++ G KGLYRGV
Sbjct: 257 ----IYQSNGLKGLYRGV 270

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 70/307 (22%), Positives = 122/307 (39%), Gaps = 34/307 (11%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG 81
           VS +   +  G+      T+  P+E+VKT M    E          N +QA K ++   G
Sbjct: 10  VSFSNILLGAGLNLSEVTTLGQPLEVVKTTMAAHREF---------NFLQATKHVWSRGG 60

Query: 82  IRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSG 141
           I G  +GL      +    G+ L F         K          + N    ++ G T G
Sbjct: 61  IFGFYQGLIPWAWIEASTKGAVLLFVSAEAEYRFKVL-------GLNNFGAGIMGGITGG 113

Query: 142 IIGA--IMG--SPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVD 197
           +  A   MG  + +  ++   Q  +N   +  Q    S W    SIY+ EG +G+ +GV+
Sbjct: 114 VTQAYLTMGFCTCMKTVEITRQKAANVPGVIPQ----SSWQVFKSIYKKEGIRGINKGVN 169

Query: 198 AAILR--TGAGSSVQLP--IYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWD 253
           A  +R  T  GS   L   + +  +    K     + T L  + ++  G G+     P +
Sbjct: 170 AVAIRQMTNWGSRFGLSRLVEDGIRKLTGKTGKDDKLTALEKIMASAIGGGLSAWNQPIE 229

Query: 254 VILTRVYNQKGNLYKGPLDCFV-KTVRI----EGIGALYKGFEAQIFRIAPHTILCLTFM 308
           VI   + ++K +  + P +  V KT +      G+  LY+G   ++      T+  + F 
Sbjct: 230 VIRVEMQSKKEDPNR-PKNLTVGKTFKYIYQSNGLKGLYRGVTPRVGLGIWQTVFMVGFG 288

Query: 309 EQTMKVV 315
           +   + V
Sbjct: 289 DMAREFV 295

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 60/284 (21%), Positives = 113/284 (39%), Gaps = 32/284 (11%)

Query: 31  GGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGI-RGLQKGL 89
           G +A  +   +  P + VK R+Q QG      + ++ +    +   +KNEGI +G  +G+
Sbjct: 20  GSIAGALGKVIEYPFDTVKVRLQTQG------RHVFPDTWSCITYTYKNEGIIKGFFQGI 73

Query: 90  SCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGS 149
           +         N +    Y      L            V ++   ++SGA +G   + + +
Sbjct: 74  ASPLAGAAIENAALFLSYNQCSKFLQHY-------TNVSDLTNILISGAFAGSCASFVLT 126

Query: 150 PLFLIKTRMQ-SYSNAIQIGQ------QTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILR 202
           P+ LIK ++Q S   ++ +G          +T I   + ++ +  GF GL++G     +R
Sbjct: 127 PVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFIR 186

Query: 203 TGAGSSVQLPIYNTAKHFL-LKHD-----LMKEGTGLHLVASTVS-GFGVGVVMNPWDVI 255
              G       Y   K +L  +H+     L  +     L+AS  S G      + P D +
Sbjct: 187 ESFGGVAWFATYELMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPADTV 246

Query: 256 LTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAP 299
            + +  +   L       FV+    +G+   Y+G    + R  P
Sbjct: 247 KSMMQTEHLGLKTAIKKIFVE----KGLRGFYRGLGITLIRAIP 286

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 82/202 (40%), Gaps = 22/202 (10%)

Query: 25  TGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSA--------DAQRIYKNPMQALKVI 76
           T   I+G  A   A  V  P+EL+K ++Q+    S              +   +  ++ +
Sbjct: 108 TNILISGAFAGSCASFVLTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAV 167

Query: 77  FKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVN--V 134
            KN G  GL +G S  +I +     +    YE ++  L K+ +   DP    +      +
Sbjct: 168 IKNRGFIGLWQGQSGTFIRESFGGVAWFATYELMKKYL-KSRHNIEDPSLPNDNKTWELL 226

Query: 135 VSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYR 194
            SGA++G+       P   +K+ MQ           T +  +   +  I+  +G +G YR
Sbjct: 227 ASGASAGLAFNASIFPADTVKSMMQ-----------TEHLGLKTAIKKIFVEKGLRGFYR 275

Query: 195 GVDAAILRTGAGSSVQLPIYNT 216
           G+   ++R    ++    +Y T
Sbjct: 276 GLGITLIRAIPANATVFYVYET 297

 Score = 32.3 bits (72), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 40/89 (44%), Gaps = 11/89 (12%)

Query: 23  SKTGSFIAGGMAACIAVTVT-NPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG 81
           +KT   +A G +A +A   +  P + VK+ MQ +          +     A+K IF  +G
Sbjct: 220 NKTWELLASGASAGLAFNASIFPADTVKSMMQTE----------HLGLKTAIKKIFVEKG 269

Query: 82  IRGLQKGLSCAYIYQIGLNGSRLGFYEPI 110
           +RG  +GL    I  I  N +    YE +
Sbjct: 270 LRGFYRGLGITLIRAIPANATVFYVYETL 298

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 77/152 (50%), Gaps = 19/152 (12%)

Query: 38  AVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGLSCAYIYQI 97
           ++ +T P+  + T++Q QG    D     K+ ++ +K I++ +G+ G   GL  A IY +
Sbjct: 27  SMALTYPLVTITTKLQTQGN---DENNQVKSKLETIKEIYRKDGLLGFYAGLESA-IYGM 82

Query: 98  GL-NGSRLGFYE-PIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIK 155
            L N     FYE   R+VL       +  HK  N   ++++G  +G + AI  +P+++  
Sbjct: 83  ALTNFVYYYFYELTSRNVLK------VRKHKKLNTLESMLTGCVAGSVTAIASNPIWVAN 136

Query: 156 TRM-------QSYSNAIQIGQQTHYTSIWNGL 180
           TRM        + +  I+I ++    +++NGL
Sbjct: 137 TRMTVTKSEKTALATIIEIVKKDSAKTLFNGL 168

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 72/173 (41%), Gaps = 8/173 (4%)

Query: 150 PLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSV 209
           PL  I T++Q+  N     +     S    +  IYR +G  G Y G+++AI      + V
Sbjct: 33  PLVTITTKLQTQGN----DENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALTNFV 88

Query: 210 QLPIYN-TAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQKGNLYK 268
               Y  T+++ L      K  T   ++   V+G    +  NP  V  TR+   K    K
Sbjct: 89  YYYFYELTSRNVLKVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRMTVTKSE--K 146

Query: 269 GPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYAVEKQ 321
             L   ++ V+ +    L+ G +  +  +  + I+  T  EQ   +V A  KQ
Sbjct: 147 TALATIIEIVKKDSAKTLFNGLKPALVLVM-NPIVQYTVFEQLKNLVLAWNKQ 198

 Score = 28.5 bits (62), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 73/189 (38%), Gaps = 43/189 (22%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           S + G +A  +    +NPI +  TRM +         +  K  +  +  I K +  + L 
Sbjct: 114 SMLTGCVAGSVTAIASNPIWVANTRMTVT--------KSEKTALATIIEIVKKDSAKTLF 165

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVN---VVSGATSGII 143
            GL  A +  +           PI        Y   +  K   +A N   ++S + + ++
Sbjct: 166 NGLKPALVLVMN----------PIVQ------YTVFEQLKNLVLAWNKQGILSPSWAFLL 209

Query: 144 GAI-----MGS--PLFLIKTRMQ---------SYSNAIQIGQQTHYTSIWNGLSSIYRAE 187
           GA+      GS  P   +KTRM            S     G +    S+ + ++ I + +
Sbjct: 210 GALGKLAATGSTYPYITLKTRMHLSESGKHTDDDSGKKAKGHKASSKSMLSLITEIVKKD 269

Query: 188 GFKGLYRGV 196
           G  GLYRGV
Sbjct: 270 GVSGLYRGV 278

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 51/232 (21%), Positives = 87/232 (37%), Gaps = 33/232 (14%)

Query: 3   KEIDTXXXXXXXXXXXXXXVSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADA 62
           K+ DT              +S   + + G  A      +T PI ++K R +         
Sbjct: 86  KQFDTADSVVTGKSSNLPQLSMYENLVTGAFARGTVGYITMPITIIKVRYE-------ST 138

Query: 63  QRIYKNPMQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAM 122
              YK+  +A K I   EGIRG  +G     +     +G  +  YE ++  L     P +
Sbjct: 139 LYNYKSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSGLYVLLYEKLKHTL-----PTI 193

Query: 123 DPHKV------------QNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQ 170
            P  +             + A+N  S   S  +   + +P   IKTRMQ         + 
Sbjct: 194 LPKSLLQLDSEGRYTAYTSTAINSTSAILSASMATTVTAPFDTIKTRMQL--------EP 245

Query: 171 THYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTA-KHFL 221
           T + + W+ L++I   E    ++ G+   + R    + +   IY    KHF+
Sbjct: 246 TKFKTFWSTLTTIVTQEHPIKIFSGLSMRLTRKALSAGIAWGIYEELIKHFM 297

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 66/262 (25%), Positives = 111/262 (42%), Gaps = 48/262 (18%)

Query: 23  SKTGSFI---AGGMAACIAVTVTNPIELVKTRMQ-LQGEMSADAQRIYKNPMQALKVIFK 78
           S TG  I   AGG+++ +A+    P++L+KTR Q  +G       +    P Q    +++
Sbjct: 3   SSTGHLIGGFAGGLSSAVAL---QPLDLLKTRFQQTKGGTLWQTVKSLDTPWQ----LWR 55

Query: 79  NEGIRGLQKGLSCAYIYQIGLNGSRLGF-----YEPIRSVLN--KTFYPAMDPHKVQNVA 131
                 ++  +  A +Y   LN  R        ++   SV+    +  P +  ++     
Sbjct: 56  GTLPSAIRTSVGSA-LYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYE----- 109

Query: 132 VNVVSGA-TSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFK 190
            N+V+GA   G +G I   P+ +IK R +S           +Y SI     SI   EG +
Sbjct: 110 -NLVTGAFARGTVGYIT-MPITIIKVRYES--------TLYNYKSIAEAAKSIAAQEGIR 159

Query: 191 GLYRGVDAAILRTGAGSSVQLPIYNTAKHFL---LKHDLMK---EG-------TGLHLVA 237
           G +RG     LR    S + + +Y   KH L   L   L++   EG       T ++  +
Sbjct: 160 GFFRGFGPTCLRDAPYSGLYVLLYEKLKHTLPTILPKSLLQLDSEGRYTAYTSTAINSTS 219

Query: 238 STVSGFGVGVVMNPWDVILTRV 259
           + +S      V  P+D I TR+
Sbjct: 220 AILSASMATTVTAPFDTIKTRM 241

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 75/193 (38%), Gaps = 29/193 (15%)

Query: 133 NVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGL 192
           +++ G   G+  A+   PL L+KTR           QQT   ++W  + S+   +    L
Sbjct: 7   HLIGGFAGGLSSAVALQPLDLLKTRF----------QQTKGGTLWQTVKSL---DTPWQL 53

Query: 193 YRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGL---------------HLVA 237
           +RG   + +RT  GS++ L   N  +  L K         +               +LV 
Sbjct: 54  WRGTLPSAIRTSVGSALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVT 113

Query: 238 STVSGFGVGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRI 297
              +   VG +  P  +I  R  +   N YK   +        EGI   ++GF     R 
Sbjct: 114 GAFARGTVGYITMPITIIKVRYESTLYN-YKSIAEAAKSIAAQEGIRGFFRGFGPTCLRD 172

Query: 298 APHTILCLTFMEQ 310
           AP++ L +   E+
Sbjct: 173 APYSGLYVLLYEK 185

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 50.4 bits (119), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 62/252 (24%), Positives = 103/252 (40%), Gaps = 37/252 (14%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQL-QGEMSADAQRIYKNPMQALKVI--------- 76
           + +AGG+    AV   +P +L+K R Q  Q + + DA  I     ++L  +         
Sbjct: 24  ALVAGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAVSIILKEARSLSTVNGSLTTSLF 83

Query: 77  FKNEGIRGLQKG-----LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVA 131
           FKN  ++G  KG     +    I+ +   G  +G     R V  K         +  +  
Sbjct: 84  FKNS-VKGFYKGVIPPLIGVTPIFAVSFWGYDIG----KRLVTWK---------QASDAP 129

Query: 132 VNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKG 191
           +     AT+G I AI   P  L+    +     +Q   +   + I      I    G K 
Sbjct: 130 LTTAQMATAGFISAI---PTTLVTAPTERIKVVLQTNSEFKGSFI-KAAKHIVSTGGVKS 185

Query: 192 LYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHL----VASTVSGFGVGV 247
           L+ G  A + R G GS++    Y  +K FL K    K+   ++L    +A  ++G  + +
Sbjct: 186 LFNGSLATLARDGPGSALYFASYELSKAFLNKSVAKKDKDEVNLANVCLAGGIAGMSMWL 245

Query: 248 VMNPWDVILTRV 259
           V+ P D I TR+
Sbjct: 246 VVFPIDTIKTRL 257

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 81/176 (46%), Gaps = 21/176 (11%)

Query: 30  AGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGL 89
           AG ++A     VT P E +K  +Q   E            ++A K I    G++ L  G 
Sbjct: 138 AGFISAIPTTLVTAPTERIKVVLQTNSEFKGSF-------IKAAKHIVSTGGVKSLFNG- 189

Query: 90  SCAYIYQIGLNGSRLGF--YEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIM 147
           S A + + G  GS L F  YE  ++ LNK+     D  +V N+A   ++G  +G+   ++
Sbjct: 190 SLATLARDG-PGSALYFASYELSKAFLNKS-VAKKDKDEV-NLANVCLAGGIAGMSMWLV 246

Query: 148 GSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRT 203
             P+  IKTR+Q  +  I + Q T    I  G        G KG + G+  A+LR+
Sbjct: 247 VFPIDTIKTRLQVATTPISMVQATKDIYIQRG--------GIKGFFPGLGPALLRS 294

 Score = 32.7 bits (73), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 74/184 (40%), Gaps = 19/184 (10%)

Query: 134 VVSGATSGIIGAIMGSPLFLIKTRMQSYS-----NAIQ-IGQQTHYTSIWNG--LSSIYR 185
           +V+G   G+   + G P  LIK R QS       +A+  I ++    S  NG   +S++ 
Sbjct: 25  LVAGGVGGVCAVLTGHPFDLIKVRCQSNQAKSTMDAVSIILKEARSLSTVNGSLTTSLFF 84

Query: 186 AEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKE--GTGLHLVASTVSGF 243
               KG Y+GV   ++      +V    Y+  K  +           T     A  +S  
Sbjct: 85  KNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRLVTWKQASDAPLTTAQMATAGFISAI 144

Query: 244 GVGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKT----VRIEGIGALYKGFEAQIFRIAP 299
              +V  P + I  +V  Q  + +KG    F+K     V   G+ +L+ G  A + R  P
Sbjct: 145 PTTLVTAPTERI--KVVLQTNSEFKG---SFIKAAKHIVSTGGVKSLFNGSLATLARDGP 199

Query: 300 HTIL 303
            + L
Sbjct: 200 GSAL 203

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 50.8 bits (120), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 73/324 (22%), Positives = 137/324 (42%), Gaps = 43/324 (13%)

Query: 26  GSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSAD-----AQRIYKNP----------- 69
           G FIAGG++  I+ T T P + +K  +  + ++S+         + KNP           
Sbjct: 202 GFFIAGGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPL 261

Query: 70  MQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQN 129
           ++A+  +++  GI+    G     +     +  + G +E  + ++ K      D   +  
Sbjct: 262 VKAIISLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTKV-ENCKDTKDLSK 320

Query: 130 VAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYS-NAIQIGQQTHYTSIWNGLSSIYRAEG 188
           ++   ++G  +G+       P+  +K RMQ    NA   G++    +       +Y   G
Sbjct: 321 LST-FIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTA----KEMYTEGG 375

Query: 189 FKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLK---HDLMKEGTGLHLVASTV----- 240
            K  YRGV   +L     +++ L  ++  K + +      L K+   + L    V     
Sbjct: 376 LKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGA 435

Query: 241 -SG-FGVGVVMNPWDVILTRVYNQKGNL-----YKGPLDCFVKTVRIEGIGALYKGFEAQ 293
            SG FG  VV  P +++ TR+  Q G       Y G  D  +KT++ EG   L+KG    
Sbjct: 436 FSGTFGATVVY-PINLLRTRLQAQ-GTFAHPYRYDGFRDVLLKTIQREGYPGLFKGLVPT 493

Query: 294 IFRIAPH---TILCLTFMEQTMKV 314
           + ++ P    + LC   +++ MK+
Sbjct: 494 LAKVCPAVSISYLCYENLKKLMKL 517

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 87/207 (42%), Gaps = 16/207 (7%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQ---LQGEMSADAQRIYKNPMQALKVIFK 78
           +SK  +FIAGG+A   A     PI+ +K RMQ   L  E+      I     Q  K ++ 
Sbjct: 318 LSKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNAELKGRKLMI-----QTAKEMYT 372

Query: 79  NEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIR----SVLNKTFYPAMDPHKVQNVAVNV 134
             G++   +G++   +         LG +  ++    S   K      +  ++ N+ V +
Sbjct: 373 EGGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVV-L 431

Query: 135 VSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYR 194
             GA SG  GA +  P+ L++TR+Q+            Y    + L    + EG+ GL++
Sbjct: 432 PMGAFSGTFGATVVYPINLLRTRLQAQGT---FAHPYRYDGFRDVLLKTIQREGYPGLFK 488

Query: 195 GVDAAILRTGAGSSVQLPIYNTAKHFL 221
           G+   + +     S+    Y   K  +
Sbjct: 489 GLVPTLAKVCPAVSISYLCYENLKKLM 515

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/321 (18%), Positives = 130/321 (40%), Gaps = 37/321 (11%)

Query: 26  GSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMS----------------ADAQRIYKNP 69
           G FIAGG +  ++ T T P + +K  +  + ++S                AD  +I    
Sbjct: 201 GFFIAGGCSGVVSRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSPL 260

Query: 70  MQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQN 129
           ++A   +++  G+R    G     +     +  + G +E  + ++ +      D  ++  
Sbjct: 261 IKAATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMAR-LENVKDTSELSR 319

Query: 130 VAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGF 189
           ++   ++G   G+       P+  +K R+Q       + + +    +      +Y+  G 
Sbjct: 320 LST-YIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSS---ILLQTAKEMYQQGGI 375

Query: 190 KGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTG---------LHLVASTV 240
           +  YRGV   ++     +++ L  ++  K + +K +  K G           + L     
Sbjct: 376 RLFYRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIISNLIVLPMGAF 435

Query: 241 SGFGVGVVMNPWDVILTRVYNQ----KGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFR 296
           SG     ++ P +++ TR+  Q      + Y G  D   KT++ EG   L+KG    + +
Sbjct: 436 SGTVGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPNLAK 495

Query: 297 IAPH---TILCLTFMEQTMKV 314
           + P    + LC   +++ MK+
Sbjct: 496 VCPAVSISYLCYENLKRLMKL 516

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 94/209 (44%), Gaps = 20/209 (9%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG 81
           +S+  ++IAGG+    A     PI+ +K R+Q    ++ + ++     +Q  K +++  G
Sbjct: 317 LSRLSTYIAGGLGGVAAQFSVYPIDTLKYRIQC-APLNTNLKK-SSILLQTAKEMYQQGG 374

Query: 82  IRGLQKGLSCAYIYQIGLNGSRLGFYEP-----IRSVLNKTFYPAMDPHKVQNVAVNVVS 136
           IR   +G+    +         LG +       I+    KT  P  D   + N+ V +  
Sbjct: 375 IRLFYRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPE-DEVIISNLIV-LPM 432

Query: 137 GATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRA----EGFKGL 192
           GA SG +GA +  P+ L++TR+Q+       G   H    +NG S + +     EG++GL
Sbjct: 433 GAFSGTVGATLVYPINLLRTRLQAQ------GTYAH-PHTYNGFSDVLKKTIQREGYQGL 485

Query: 193 YRGVDAAILRTGAGSSVQLPIYNTAKHFL 221
           ++G+   + +     S+    Y   K  +
Sbjct: 486 FKGLVPNLAKVCPAVSISYLCYENLKRLM 514

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 67/294 (22%), Positives = 112/294 (38%), Gaps = 31/294 (10%)

Query: 34  AACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK------ 87
           A  + + V +P++ +  R+       A   ++         VIF++     L +      
Sbjct: 20  AGILEIGVFHPVDTISKRLMSNHTKIASTSQLNS-------VIFRDFASEPLGRRLLSLF 72

Query: 88  -GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDP---HKVQNVAVNVVSGATSGII 143
            GL  A  Y+I     + G        LNK F    D     K      +  +G+  GI 
Sbjct: 73  PGLGYAAAYKILQRVYKYGGQPFANEFLNKNFKGDFDQAFGEKTGKALRSATAGSLIGI- 131

Query: 144 GAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRT 203
           G I+  PL ++K + Q+   + +            G   I + EGF GLYRG      R 
Sbjct: 132 GEIVLLPLDVLKIKRQTNPESFK----------GRGFLKIIKDEGF-GLYRGWGWTAARN 180

Query: 204 GAGSSVQLPIYNTAKHFLLK-HDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQ 262
             GS         AK ++L   D  +     + V+S V      +V  P DVI TR+ N+
Sbjct: 181 APGSFALFGGNAFAKEYILGLKDYGQATWSQNFVSSIVGASASLIVSAPLDVIKTRIQNR 240

Query: 263 KGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVY 316
             +  +        T++ EG  A +KG   ++    P  +     + QT+  ++
Sbjct: 241 NFDNPESGFKIIKNTLKNEGFTAFFKGLTPKLLTTGPKLVFSFA-LAQTLIPIF 293

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 12/67 (17%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVI---FKNEGIR 83
           +F++  + A  ++ V+ P++++KTR+Q          R + NP    K+I    KNEG  
Sbjct: 212 NFVSSIVGASASLIVSAPLDVIKTRIQ---------NRNFDNPESGFKIIKNTLKNEGFT 262

Query: 84  GLQKGLS 90
              KGL+
Sbjct: 263 AFFKGLT 269

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 80/197 (40%), Gaps = 30/197 (15%)

Query: 31  GGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK--- 87
           G + AC+   V  P E+VK R Q+    S+          Q L+ I +N+   GL+K   
Sbjct: 104 GEICACL---VRVPAEVVKQRTQVHSTNSS---------WQTLQSILRNDNKEGLRKNLY 151

Query: 88  -GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146
            G S   + +I     +   YE     L KT+  A    +V+      + G+ +G I A 
Sbjct: 152 RGWSTTIMREIPFTCIQFPLYE----YLKKTWAKANGQSQVEPWK-GAICGSIAGGIAAA 206

Query: 147 MGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAG 206
             +PL  +KTR+        +G           +  IYR EG    + GV    +   AG
Sbjct: 207 TTTPLDFLKTRLMLNKTTASLGSV---------IIRIYREEGPAVFFSGVGPRTMWISAG 257

Query: 207 SSVQLPIYNTAKHFLLK 223
            ++ L +Y T    L K
Sbjct: 258 GAIFLGMYETVHSLLSK 274

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 61/272 (22%), Positives = 104/272 (38%), Gaps = 41/272 (15%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           S ++G  A      V  PI+ +KTR+Q +G                    F N G +G+ 
Sbjct: 7   SLLSGAAAGTSTDLVFFPIDTIKTRLQAKGGF------------------FANGGYKGIY 48

Query: 87  KGLSCAYIYQIGLNGSRLGF----YEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGI 142
           +GL  A +      G+ L F    Y  ++S    +   +    ++ +   +++S +   I
Sbjct: 49  RGLGSAVV--ASAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEI 106

Query: 143 IGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYR---AEGF-KGLYRGVDA 198
              ++  P  ++K R Q +S            S W  L SI R    EG  K LYRG   
Sbjct: 107 CACLVRVPAEVVKQRTQVHST----------NSSWQTLQSILRNDNKEGLRKNLYRGWST 156

Query: 199 AILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLH-LVASTVSGFGVGVVMNPWDVILT 257
            I+R    + +Q P+Y   K    K +   +       +  +++G        P D + T
Sbjct: 157 TIMREIPFTCIQFPLYEYLKKTWAKANGQSQVEPWKGAICGSIAGGIAAATTTPLDFLKT 216

Query: 258 RVYNQKGNLYKGPLDCFVKTVRIEGIGALYKG 289
           R+   K     G +   ++  R EG    + G
Sbjct: 217 RLMLNKTTASLGSV--IIRIYREEGPAVFFSG 246

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 87/206 (42%), Gaps = 51/206 (24%)

Query: 132 VNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKG 191
           ++++SGA +G    ++  P+  IKTR+Q+       G                   G+KG
Sbjct: 6   LSLLSGAAAGTSTDLVFFPIDTIKTRLQAKGGFFANG-------------------GYKG 46

Query: 192 LYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMK------------EG------TGL 233
           +YRG+ +A++ +  G+S+          F + +D MK            +G      T  
Sbjct: 47  IYRGLGSAVVASAPGASL----------FFISYDYMKVKSRPYISKLYSQGSEQLIDTTT 96

Query: 234 HLVASTVSGFGVGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGA-LYKGFEA 292
           H+++S++      +V  P +V+  R      N     L   ++    EG+   LY+G+  
Sbjct: 97  HMLSSSIGEICACLVRVPAEVVKQRTQVHSTNSSWQTLQSILRNDNKEGLRKNLYRGWST 156

Query: 293 QIFRIAPHTILCLTF-MEQTMKVVYA 317
            I R  P T  C+ F + + +K  +A
Sbjct: 157 TIMREIPFT--CIQFPLYEYLKKTWA 180

 Score = 35.8 bits (81), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 41/93 (44%), Gaps = 14/93 (15%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQ---RIYKNPMQALKVIFKNEGIRGL 85
           I G +A  IA   T P++ +KTR+ L    ++      RIY+    A  V F   G R +
Sbjct: 195 ICGSIAGGIAAATTTPLDFLKTRLMLNKTTASLGSVIIRIYREEGPA--VFFSGVGPRTM 252

Query: 86  QKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTF 118
                 A           LG YE + S+L+K+F
Sbjct: 253 WISAGGAIF---------LGMYETVHSLLSKSF 276

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 88/211 (41%), Gaps = 16/211 (7%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGI-RGL 85
             + GG+A  +   V  P + VK R+Q Q      +  ++      +   +K EG+ RG 
Sbjct: 11  DLLYGGVAGSLGKLVEYPFDTVKVRLQTQ------SAALFPTTWSCVSHTYKQEGLWRGF 64

Query: 86  QKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGA 145
            +G++         +      +   ++VL    Y      KV      V +GA +G   +
Sbjct: 65  YQGMASPVFGAFLEHAVLFVSFNRAQAVLENC-YSCGPLEKV------VFAGAIAGACTS 117

Query: 146 IMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGA 205
            + +P+ L+K ++Q  SN   +     YT++   L +I +  G  GL++G     +R  A
Sbjct: 118 YVLTPVELVKCKLQ-VSNLTGV-SGPRYTAVLPTLRAIVKQNGLGGLWQGQSGTFIRESA 175

Query: 206 GSSVQLPIYNTAKHFLLKHDLMKEGTGLHLV 236
           G +V    Y   K +L +     E T   L+
Sbjct: 176 GGAVWFTAYEVLKGWLARRRGSTENTVWELL 206

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/190 (21%), Positives = 73/190 (38%), Gaps = 21/190 (11%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
            AG +A      V  P+ELVK ++Q+         R Y   +  L+ I K  G+ GL +G
Sbjct: 107 FAGAIAGACTSYVLTPVELVKCKLQVSNLTGVSGPR-YTAVLPTLRAIVKQNGLGGLWQG 165

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMG 148
            S  +I +          YE ++  L +                    G+T   +  ++ 
Sbjct: 166 QSGTFIRESAGGAVWFTAYEVLKGWLARR------------------RGSTENTVWELLA 207

Query: 149 SPLFLIKTRMQSY--SNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAG 206
           S          S   ++ ++   QT +  +   + ++ +  G  G YRGV   +LR    
Sbjct: 208 SGAGAGAAFHASIFPADTVKSTMQTEHLGLGPAVRTVLKKHGPTGFYRGVGITLLRALPA 267

Query: 207 SSVQLPIYNT 216
           ++V   +Y +
Sbjct: 268 NAVIFYVYES 277

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/171 (21%), Positives = 76/171 (44%), Gaps = 16/171 (9%)

Query: 133 NVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEG-FKG 191
           +++ G  +G +G ++  P   +K R+Q+ S A+       + + W+ +S  Y+ EG ++G
Sbjct: 11  DLLYGGVAGSLGKLVEYPFDTVKVRLQTQSAAL-------FPTTWSCVSHTYKQEGLWRG 63

Query: 192 LYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLV-ASTVSGFGVGVVMN 250
            Y+G+ + +       +V    +N A+  L   +    G    +V A  ++G     V+ 
Sbjct: 64  FYQGMASPVFGAFLEHAVLFVSFNRAQAVL--ENCYSCGPLEKVVFAGAIAGACTSYVLT 121

Query: 251 PWDVI-----LTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFR 296
           P +++     ++ +    G  Y   L      V+  G+G L++G      R
Sbjct: 122 PVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQSGTFIR 172

 Score = 28.9 bits (63), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 29/63 (46%), Gaps = 2/63 (3%)

Query: 247 VVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIG-ALYKGFEAQIF-RIAPHTILC 304
           +V  P+D +  R+  Q   L+     C   T + EG+    Y+G  + +F     H +L 
Sbjct: 24  LVEYPFDTVKVRLQTQSAALFPTTWSCVSHTYKQEGLWRGFYQGMASPVFGAFLEHAVLF 83

Query: 305 LTF 307
           ++F
Sbjct: 84  VSF 86

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 84/200 (42%), Gaps = 31/200 (15%)

Query: 128 QNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAE 187
           Q    ++VSGA +G    +   P+  +KTR+Q+       G                   
Sbjct: 4   QMFIASLVSGAAAGTSTDLAFFPIDTLKTRLQAKGGFFANG------------------- 44

Query: 188 GFKGLYRGVDAAILRTGAGSSVQLPIYNTAK--------HFLLKHDLMKEGTGLHLVAST 239
           G+KG+YRG+ +A++ +   +S+    Y++ K          L K +     T  H+V+S+
Sbjct: 45  GYKGVYRGLGSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTADTLSHMVSSS 104

Query: 240 VSGFGVGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGA-LYKGFEAQIFRIA 298
                  +V  P +VI  R    + N     L   ++    EG+   LY+G+   I R  
Sbjct: 105 FGEISACMVRVPAEVIKQRTQTHRTNSSLQTLQALLRNENGEGLRRNLYRGWSTTIMREI 164

Query: 299 PHTILCLTF-MEQTMKVVYA 317
           P T  C+ F + + MK  +A
Sbjct: 165 PFT--CIQFPLYEYMKKRWA 182

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 80/204 (39%), Gaps = 44/204 (21%)

Query: 28  FIAGGMAACIAVTVTN----PIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIR 83
           FIA  ++   A T T+    PI+ +KTR+Q +G                    F N G +
Sbjct: 6   FIASLVSGAAAGTSTDLAFFPIDTLKTRLQAKGG------------------FFANGGYK 47

Query: 84  GLQKGLSCAYIYQIGLNGSRLGFYEPI----RSVLNKTFYPAMDPHKVQNVAVNVVSGAT 139
           G+ +GL  A +            Y+ +    R V+ +      D  +  +   ++VS + 
Sbjct: 48  GVYRGLGSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGED--QTADTLSHMVSSSF 105

Query: 140 SGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYT-SIWNGLSSIYRAEGFKGL----YR 194
             I   ++  P  +IK R Q           TH T S    L ++ R E  +GL    YR
Sbjct: 106 GEISACMVRVPAEVIKQRTQ-----------THRTNSSLQTLQALLRNENGEGLRRNLYR 154

Query: 195 GVDAAILRTGAGSSVQLPIYNTAK 218
           G    I+R    + +Q P+Y   K
Sbjct: 155 GWSTTIMREIPFTCIQFPLYEYMK 178

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 79/190 (41%), Gaps = 30/190 (15%)

Query: 31  GGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK--- 87
           G ++AC+   V  P E++K R Q     S+         +Q L+ + +NE   GL++   
Sbjct: 106 GEISACM---VRVPAEVIKQRTQTHRTNSS---------LQTLQALLRNENGEGLRRNLY 153

Query: 88  -GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146
            G S   + +I     +   YE +     K  +  +   +        V G  +G I A 
Sbjct: 154 RGWSTTIMREIPFTCIQFPLYEYM-----KKRWAEVQGKERAAPWQGSVCGCIAGGIAAA 208

Query: 147 MGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAG 206
             +PL ++KTR+  +  ++         S  +   ++ + EG K  + GV    +   AG
Sbjct: 209 ATTPLDVLKTRIMLHHKSV---------SALHLAKTMLQEEGVKVFFSGVGPRTMWISAG 259

Query: 207 SSVQLPIYNT 216
            ++ L +Y T
Sbjct: 260 GAIFLGVYET 269

>Scas_714.18
          Length = 305

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 63/307 (20%), Positives = 114/307 (37%), Gaps = 38/307 (12%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGI-RGLQK 87
           +AG +A  I   +  P + VK R+Q Q         ++ +    +K  ++NEGI  G  +
Sbjct: 17  LAGSIAGAIGKFIEYPFDTVKVRLQTQ------EAYMFPSTWSCIKYTYENEGILEGFYQ 70

Query: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIM 147
           G+    I     N      Y    S LN          +     + ++S   +G   + +
Sbjct: 71  GIESPLIGAALENAILFLAYNQCSSFLNAF-------TEFSAFLIILISAGFAGSCASFV 123

Query: 148 GSPLFLIKTRMQ----SYS---------------NAIQIGQQTHYTSIWNGLSSIYRAEG 188
            +P+ LIK ++Q     YS                 + IG+  H T I   + SI + +G
Sbjct: 124 LTPVELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRH-TRIIPTIKSIIKEKG 182

Query: 189 FKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVV 248
             GL++G  +  +R   GS V    Y   K  L         T   L++   +G      
Sbjct: 183 LFGLWQGQSSTFIRESIGSVVWFATYELMKQTLRDPKSEVNTTWQLLISGATAGLAFNGS 242

Query: 249 MNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFM 308
           + P D + + +  +   L    ++     +  +G+   Y+G    + R  P         
Sbjct: 243 VFPADTVKSIMQTEHLAL----METVRSILERDGVAGFYRGLGITLLRAVPSNAAVFYTY 298

Query: 309 EQTMKVV 315
           E+  K++
Sbjct: 299 EKLSKIL 305

>Scas_562.12
          Length = 300

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 66/287 (22%), Positives = 108/287 (37%), Gaps = 29/287 (10%)

Query: 34  AACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQK------ 87
           A  + + V +P++ +  R+     MS   +    N  +  +VIF+      L K      
Sbjct: 20  AGILEIGVFHPVDTISKRL-----MSNHTK--IGNSHELNRVIFREHFSEPLGKRLFTLF 72

Query: 88  -GLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDP---HKVQNVAVNVVSGATSGII 143
            GL  A  Y++     + G        LNK +    D     K      +  +G+  GI 
Sbjct: 73  PGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDSAFGEKTGKAMRSATAGSLIGI- 131

Query: 144 GAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRT 203
           G I+  PL ++K + Q+   A +            G   I + EG   LYRG      R 
Sbjct: 132 GEIVLLPLDVLKIKRQTNPEAFK----------GRGFVKILKDEGIFNLYRGWGWTAARN 181

Query: 204 GAGSSVQLPIYNTAKHFLLK-HDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQ 262
             GS         AK ++L   D  +     + ++S V      +V  P DVI TR+ N+
Sbjct: 182 APGSFALFGGNAFAKEYILGLEDYSQASWSQNFISSIVGASCSLIVSAPLDVIKTRIQNR 241

Query: 263 KGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFME 309
             +  +  L     T + EGI A +KG   ++    P  +      +
Sbjct: 242 SFDNPETGLTIVKNTFKNEGITAFFKGLTPKLLTTGPKLVFSFALAQ 288

>Scas_328.1
          Length = 227

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 65/155 (41%), Gaps = 17/155 (10%)

Query: 151 LFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQ 210
           L L K  + S + +I+ G    +  I +        +G  GLYRG   +++       + 
Sbjct: 57  LRLCKNEIGSDAKSIKSGAPRKFNGILDVYKKTLFTDGVLGLYRGFLPSVVGIMVYRGLY 116

Query: 211 LPIYNTAKHFLLKHDLMKE-------GTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQK 263
             +Y++ K  LL              G  + + AST S         P D +  R+    
Sbjct: 117 FGLYDSLKPVLLTGSFENAFLPSFLLGWAVTISASTTS--------YPLDTVRRRMMMTS 168

Query: 264 GNL--YKGPLDCFVKTVRIEGIGALYKGFEAQIFR 296
           G    YKG +DCF + V  EG+ +L+KG  A IFR
Sbjct: 169 GQAVKYKGAIDCFQQIVSQEGVYSLFKGCGANIFR 203

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 75/187 (40%), Gaps = 23/187 (12%)

Query: 44  PIELVKTRMQLQGEMSADAQRI-------YKNPMQALKVIFKNEGIRGLQKGLSCAYIYQ 96
           PI  +  R+  + E+ +DA+ I       +   +   K     +G+ GL +G   + +  
Sbjct: 51  PIVCLFLRL-CKNEIGSDAKSIKSGAPRKFNGILDVYKKTLFTDGVLGLYRGFLPSVVGI 109

Query: 97  IGLNGSRLGFYEPIRSV-LNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIK 155
           +   G   G Y+ ++ V L  +F  A  P  +   AV + +  TS         PL  ++
Sbjct: 110 MVYRGLYFGLYDSLKPVLLTGSFENAFLPSFLLGWAVTISASTTS--------YPLDTVR 161

Query: 156 TRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYN 215
            RM   S     GQ   Y    +    I   EG   L++G  A I R  A + V + +Y+
Sbjct: 162 RRMMMTS-----GQAVKYKGAIDCFQQIVSQEGVYSLFKGCGANIFRGVAAAGV-ISLYD 215

Query: 216 TAKHFLL 222
             +  L 
Sbjct: 216 QLQLLLF 222

 Score = 28.5 bits (62), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 4/62 (6%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           SF+ G      A T + P++ V+ RM     M++     YK  +   + I   EG+  L 
Sbjct: 139 SFLLGWAVTISASTTSYPLDTVRRRMM----MTSGQAVKYKGAIDCFQQIVSQEGVYSLF 194

Query: 87  KG 88
           KG
Sbjct: 195 KG 196

>Scas_578.3*
          Length = 524

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/305 (21%), Positives = 127/305 (41%), Gaps = 40/305 (13%)

Query: 26  GSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSA--------------DAQRIYKNPMQ 71
           G FIAGG++  I+ T T P++ +K  +  + ++S+              +  +I    ++
Sbjct: 210 GYFIAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSPIIK 269

Query: 72  ALKVIFKNEGIRGLQKGLSCAYIYQIGLNGS-RLGFYEPIRSVLNKTFYPAMDPHKVQNV 130
           A++ +++  G+R    G   + +++I    S + G +E     L K     +   K+ N 
Sbjct: 270 AIRSLYRQGGLRAFYVGNGLS-VFKICPESSIKFGTFE-----LAKRLMANLSGDKLVND 323

Query: 131 AVNV---VSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAE 187
              +   V+G  +G++  I   P+  +K R+Q    A   G       + +    +Y+  
Sbjct: 324 LSKLQTYVAGGIAGVMAQISIYPIDTLKFRIQC---APLEGNLKGNALLISTAKEMYKEG 380

Query: 188 GFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTG---------LHLVAS 238
           G +  YRGV    L     +++ L  ++  K + +K    K             L L   
Sbjct: 381 GIRVFYRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMG 440

Query: 239 TVSGFGVGVVMNPWDVILTRVYNQ----KGNLYKGPLDCFVKTVRIEGIGALYKGFEAQI 294
             SG      + P +++ TR+  Q        Y G  D F++T++ EG+   YKG    +
Sbjct: 441 AFSGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPTL 500

Query: 295 FRIAP 299
            ++ P
Sbjct: 501 VKVCP 505

 Score = 47.4 bits (111), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 90/206 (43%), Gaps = 20/206 (9%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQ---LQGEMSADAQRIYKNPMQALKVIFK 78
           +SK  +++AGG+A  +A     PI+ +K R+Q   L+G +  +A  I        K ++K
Sbjct: 324 LSKLQTYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALLI-----STAKEMYK 378

Query: 79  NEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMD-PHKVQNVAVNVV-- 135
             GIR   +G+    +         LG +  ++    K     ++ P K   ++  +V  
Sbjct: 379 EGGIRVFYRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLP 438

Query: 136 SGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTH---YTSIWNGLSSIYRAEGFKGL 192
            GA SG +GA    P+ L++TR+Q+       G   H   YT   +      + EG  G 
Sbjct: 439 MGAFSGTVGATAVYPINLLRTRLQAQ------GTYAHPYTYTGFRDVFMQTLKREGVPGF 492

Query: 193 YRGVDAAILRTGAGSSVQLPIYNTAK 218
           Y+G+   +++     S+    Y   K
Sbjct: 493 YKGLVPTLVKVCPAVSIGYLCYEKFK 518

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 73/168 (43%), Gaps = 19/168 (11%)

Query: 33  MAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQAL-KVIFKNEGIRGLQKGLSC 91
           +AA  +   TNPI +V T+ Q +  +  D      N  +A+ K ++  +GI G  K L  
Sbjct: 159 LAAATSQLFTNPINIVSTKQQTRRGLEGD------NSFKAIAKEVYDEDGITGFWKSLKV 212

Query: 92  AYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQ---NVAVNVVSGATSGIIGAIMG 148
           + +  I  + +     E ++ +L    + A D +          N + G  S II   + 
Sbjct: 213 SLVLTINPSITYAS-AEKLKDILYHVEWNAKDLNDSSLQLKPGQNFLIGVLSKIISTCLT 271

Query: 149 SPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGV 196
            PL + K  +Q  S        + +TS    L+ +YR EG   L++G+
Sbjct: 272 HPLIVAKASLQRSS--------SKFTSFQEVLTYLYRHEGAHALWKGL 311

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 61/144 (42%), Gaps = 9/144 (6%)

Query: 183 IYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYN-TAKHFL----LKHDLMKEGTGLHLVA 237
           +YR EGF GLY G+ A++L T   S      Y    +H+     +K +  +  T   L+ 
Sbjct: 97  VYRNEGFGGLYHGLSASLLGTFIQSFSYFFWYTLIRRHYFRVKKVKGEAARFSTIEELLL 156

Query: 238 STVSGFGVGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIE-GIGALYKGFEAQ-IF 295
           S ++     +  NP +++ T+   ++G           K V  E GI   +K  +   + 
Sbjct: 157 SMLAAATSQLFTNPINIVSTKQQTRRGLEGDNSFKAIAKEVYDEDGITGFWKSLKVSLVL 216

Query: 296 RIAPHTILCLTFMEQTMKVVYAVE 319
            I P   +     E+   ++Y VE
Sbjct: 217 TINPS--ITYASAEKLKDILYHVE 238

 Score = 31.6 bits (70), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 54/278 (19%), Positives = 111/278 (39%), Gaps = 46/278 (16%)

Query: 45  IELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRL 104
           I+ +K + +         ++ YK+ +  +  +++NEG  GL  GLS + +     + S  
Sbjct: 66  IQQIKPKPEPPTATKESLEQRYKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYF 125

Query: 105 GFYEPIRS---VLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSY 161
            +Y  IR     + K    A     ++ + +++++ ATS     +  +P+ ++ T+ Q+ 
Sbjct: 126 FWYTLIRRHYFRVKKVKGEAARFSTIEELLLSMLAAATS----QLFTNPINIVSTKQQTR 181

Query: 162 SN----------AIQIGQQTHYTSIWNGLS-----------SIYRAEGFKG-LY------ 193
                       A ++  +   T  W  L            +   AE  K  LY      
Sbjct: 182 RGLEGDNSFKAIAKEVYDEDGITGFWKSLKVSLVLTINPSITYASAEKLKDILYHVEWNA 241

Query: 194 RGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWD 253
           + ++ + L+   G +  + + +      L H L+     L   +S  + F          
Sbjct: 242 KDLNDSSLQLKPGQNFLIGVLSKIISTCLTHPLIVAKASLQRSSSKFTSF---------Q 292

Query: 254 VILTRVYNQKGN--LYKGPLDCFVKTVRIEGIGALYKG 289
            +LT +Y  +G   L+KG L    K V ++G+  ++KG
Sbjct: 293 EVLTYLYRHEGAHALWKGLLPQLTKGVIVQGLLFMFKG 330

>Kwal_55.21106
          Length = 328

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 76/306 (24%), Positives = 135/306 (44%), Gaps = 58/306 (18%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEM-----------SADAQRI----YKNPMQ 71
           S I G +A+ +A  V  P++LVKT +Q Q +             A   R+    YK+ + 
Sbjct: 6   SAITGAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLD 65

Query: 72  ALKVIFKNEGIRGLQKGL----------SCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPA 121
           AL  IFK +G+ GL +GL          S +Y +   +       Y+ +R  L K   P 
Sbjct: 66  ALIKIFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLGKFSTP- 124

Query: 122 MDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIW---N 178
                 + + + +V+ A S     I  SP+ +I TR Q+ ++  + G +     I+   N
Sbjct: 125 ------EELLLGIVAAAVS----QIFTSPIGVISTRQQTSTSGSKGGFREVLHQIYSEQN 174

Query: 179 GLSSIYRAEGFK-GLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVA 237
            ++  +R  GFK  L   V+ +I  T A       I+ T+K  + ++  + E +G     
Sbjct: 175 NITGFWR--GFKVSLILTVNPSI--TFASYEKLQDIFITSKRAVDENGQLLETSG---QL 227

Query: 238 STVSGFGVGV--------VMNPWDVILTRVYNQK-GNLYKGPLDCFVKTVRIEGIGALYK 288
           S    F +GV        +  P  +I+++ Y Q+ G+ ++      +   + EG+ +L+K
Sbjct: 228 SPRQNFLLGVFSKVISTLITQP--LIVSKAYLQRTGSNFQSFQQVLLYLYKQEGLISLWK 285

Query: 289 GFEAQI 294
           G   Q+
Sbjct: 286 GLAPQL 291

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 49/89 (55%), Gaps = 7/89 (7%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           +F+ G +++C  V VT PI+++KTRMQ     S  A   YKN +     IF  EGI    
Sbjct: 326 AFVLGFISSCAVVAVTQPIDVIKTRMQ-----SKYAWANYKNSLNCAYRIFVEEGIPKFW 380

Query: 87  KGLSCAYIYQIGLNGS-RLGFYEPIRSVL 114
           KG +   + ++GL+G    G Y+ + +++
Sbjct: 381 KGWA-PRLMKVGLSGGVSFGVYQYVENLI 408

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 58/130 (44%), Gaps = 4/130 (3%)

Query: 170 QTHYTS-IWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMK 228
           + H TS  ++ +  IY   G +G  +G    I R    S+V+   Y + K  +  +  + 
Sbjct: 263 EEHPTSRFFSTVKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLKQLISPNKPLN 322

Query: 229 EGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQKGNL-YKGPLDCFVKTVRIEGIGALY 287
           E      V   +S   V  V  P DVI TR+ ++     YK  L+C  +    EGI   +
Sbjct: 323 EYYAF--VLGFISSCAVVAVTQPIDVIKTRMQSKYAWANYKNSLNCAYRIFVEEGIPKFW 380

Query: 288 KGFEAQIFRI 297
           KG+  ++ ++
Sbjct: 381 KGWAPRLMKV 390

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 67/156 (42%), Gaps = 18/156 (11%)

Query: 73  LKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAV 132
           +K I+   G+RG  +G +     Q+G +  R   Y  ++ +++        P+K  N   
Sbjct: 274 VKEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLKQLIS--------PNKPLNEYY 325

Query: 133 NVVSGATSGIIGAIMGSPLFLIKTRMQS-YSNAIQIGQQTHYTSIWNGLSSIYRAEGFKG 191
             V G  S      +  P+ +IKTRMQS Y+ A       +Y +  N    I+  EG   
Sbjct: 326 AFVLGFISSCAVVAVTQPIDVIKTRMQSKYAWA-------NYKNSLNCAYRIFVEEGIPK 378

Query: 192 LYRGVDAAILRTGAGSSVQLPIYNTAKHF--LLKHD 225
            ++G    +++ G    V   +Y   ++   L+ H+
Sbjct: 379 FWKGWAPRLMKVGLSGGVSFGVYQYVENLIKLMAHE 414

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 75/181 (41%), Gaps = 21/181 (11%)

Query: 125 HKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIY 184
           H    V  ++++G   G+   ++G P    K R+Q+ S           T+  + +  + 
Sbjct: 18  HDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVP---------TTALDVVKKLV 68

Query: 185 RAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFL-LKHDLMKEGTGLHLVASTVSGF 243
           + EGF+G Y+G    ++  GA  SVQ  +    K F   ++        L L+   + GF
Sbjct: 69  KNEGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGF 128

Query: 244 GVGV----VMNPWDVILTRVYNQKGN----LYKGPLDCFVKTVRIEGIGALYKGFEAQIF 295
             G     + +P + +  R+  Q G      + GPLDC  K   +    +L +G    + 
Sbjct: 129 AGGTANSFLASPIEHVRIRLQTQTGTGAAAQFHGPLDCIKK---LTANNSLMRGLTPTML 185

Query: 296 R 296
           R
Sbjct: 186 R 186

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 65/309 (21%), Positives = 109/309 (35%), Gaps = 50/309 (16%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
             +AG       V +  P +  K R+Q           +    +  +K + KNEG RG  
Sbjct: 26  DLLAGTAGGVSQVLIGQPFDTTKVRLQ--------TSSVPTTALDVVKKLVKNEGFRGFY 77

Query: 87  KGL--------SCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGA 138
           KG         +C  + Q G+N +   F+                P++   +    + G 
Sbjct: 78  KGTLTPLVGVGACVSV-QFGVNEAMKRFFHSRNG--------NSGPNETLGLLQYYLCGF 128

Query: 139 TSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDA 198
             G   + + SP+  ++ R+Q+ +      Q          L  I +      L RG+  
Sbjct: 129 AGGTANSFLASPIEHVRIRLQTQTGTGAAAQ------FHGPLDCIKKLTANNSLMRGLTP 182

Query: 199 AILRTGAGSSVQLPIYNTAKHFLLKHDLMK-------EGTGLHLVASTVSGFGVGVVMNP 251
            +LR   G  V    Y      L+ ++L K           L L  +T SG  + +++ P
Sbjct: 183 TMLRESHGCGVYFLTYEA----LIANELHKGVSRSEIPTWKLCLFGAT-SGTTLWLMIYP 237

Query: 252 WDVILTRVYNQKGNLY-----KGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLT 306
            DVI  +   Q  +L      K  L          G+ + +KGF   + R AP       
Sbjct: 238 LDVI--KSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFA 295

Query: 307 FMEQTMKVV 315
             E  M+V+
Sbjct: 296 TFELAMRVL 304

>Kwal_33.12988
          Length = 303

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/184 (21%), Positives = 74/184 (40%), Gaps = 21/184 (11%)

Query: 123 DPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSS 182
           D   ++    ++ +G T GI   ++G P  + K R+Q+ S           T+    +  
Sbjct: 16  DKSDIRRTLKDITAGTTGGIAQVLVGQPFDITKVRLQTSSTP---------TTALRVVQD 66

Query: 183 IYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHL----VAS 238
           + + EG +G Y+G    ++  G   S Q       K +  K +   + T L L       
Sbjct: 67  LVKNEGLRGFYKGTTLPLIGVGLCVSSQFGTNEAMKRYFHKRNNF-QSTSLRLPEYYACG 125

Query: 239 TVSGFGVGVVMNPWD----VILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQI 294
            VSG     +  P +    ++  +  ++    Y+G +DC  K ++    G L +GF   I
Sbjct: 126 FVSGCANAFLATPIEHVRILLQVQTKSRADAEYQGAMDCIKKLLK---EGKLMRGFTPTI 182

Query: 295 FRIA 298
            R +
Sbjct: 183 LRTS 186

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 74/315 (23%), Positives = 128/315 (40%), Gaps = 53/315 (16%)

Query: 22  VSKTGSFIAGGMAACIA-VTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVI---F 77
           + +T   I  G    IA V V  P ++ K R+Q               P  AL+V+    
Sbjct: 20  IRRTLKDITAGTTGGIAQVLVGQPFDITKVRLQTSS-----------TPTTALRVVQDLV 68

Query: 78  KNEGIRGLQKGLSCAYIYQIGLN-GSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNV-- 134
           KNEG+RG  KG +   I  +GL   S+ G  E ++   +K        +  Q+ ++ +  
Sbjct: 69  KNEGLRGFYKGTTLPLI-GVGLCVSSQFGTNEAMKRYFHKR-------NNFQSTSLRLPE 120

Query: 135 --VSGATSGIIGAIMGSPL----FLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEG 188
               G  SG   A + +P+     L++ + +S ++A        Y    + +  + + EG
Sbjct: 121 YYACGFVSGCANAFLATPIEHVRILLQVQTKSRADA-------EYQGAMDCIKKLLK-EG 172

Query: 189 FKGLYRGVDAAILRTGAG-----SSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGF 243
              L RG    ILRT  G     +S +  I +  +  + + D+      L+      SG 
Sbjct: 173 --KLMRGFTPTILRTSHGFGVYFTSYEAMICSEQRKGIARKDIPAWKLCLY---GAFSGS 227

Query: 244 GVGVVMNPWDVILTRVYNQK--GNLYKGPLDCFVKTVRIE-GIGALYKGFEAQIFRIAPH 300
            +  ++ P+DVI + + + K    +Y   +    K +  E G  A  KGF   + R  P 
Sbjct: 228 LLWAMVYPFDVIKSVMQSDKLRTPVYGTNVFQVAKNIYNERGPKAFVKGFGPTMLRSLPV 287

Query: 301 TILCLTFMEQTMKVV 315
                T  E  M+++
Sbjct: 288 NGATFTAFEMAMRIL 302

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 66/295 (22%), Positives = 110/295 (37%), Gaps = 31/295 (10%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIR----- 83
           +    A  + + V +P++ +  R+        +AQ++         V+F+    +     
Sbjct: 14  VGSASAGILEIGVFHPVDTISKRLMSNHTKITNAQQLND-------VVFREHASKPFGQR 66

Query: 84  --GLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDP---HKVQNVAVNVVSGA 138
              L  GL  A  Y+I     + G        LNK F    D     K      +  +G+
Sbjct: 67  LFTLFPGLGYAATYKIFQRVYKYGGQPFANEFLNKHFKADFDGAFGEKTGKALRSATAGS 126

Query: 139 TSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDA 198
             GI G I+  PL ++K + Q+   + +            G   I R EG  GLYRG   
Sbjct: 127 LIGI-GEIVLLPLDVLKIKRQTNPESFR----------GRGFLRILRDEGM-GLYRGWGW 174

Query: 199 AILRTGAGSSVQLPIYNTAKHFLLK-HDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILT 257
              R   GS         AK ++L   D  +   G + V+S        +V  P DVI T
Sbjct: 175 TAARNAPGSFALFGGNAFAKEYILGLKDYSQATWGQNFVSSIFGASASLIVSAPLDVIKT 234

Query: 258 RVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTM 312
           R+ ++     +        T++ EG  A +KG   ++    P  +     + QT+
Sbjct: 235 RIQSRNFESAESGFTIVKNTLKNEGATAFFKGLTPKLLTTGPKLVFSFA-IAQTL 288

 Score = 31.2 bits (69), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 36/65 (55%), Gaps = 8/65 (12%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQ-RIYKNPMQALKVIFKNEGIRGL 85
           +F++    A  ++ V+ P++++KTR+Q +   SA++   I KN +       KNEG    
Sbjct: 211 NFVSSIFGASASLIVSAPLDVIKTRIQSRNFESAESGFTIVKNTL-------KNEGATAF 263

Query: 86  QKGLS 90
            KGL+
Sbjct: 264 FKGLT 268

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 62/253 (24%), Positives = 97/253 (38%), Gaps = 46/253 (18%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPM-QALKVIFKNEGIRGLQK 87
           +AG +      +   PI++VKTR+QL+         +Y   M  + K I  +EG   L  
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLE-------PTVYNKGMISSFKQIISSEGAGALLT 70

Query: 88  GLSCAYIYQIGLNGS-RLGFYEPIRSVLNKTFYPAMDPHKVQNV--AVNVVSGATSGIIG 144
           G     +    L GS + G YE    V  K F   +   +  N   ++ + S A +    
Sbjct: 71  GFGPT-LLGYSLQGSFKFGGYE----VFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFA 125

Query: 145 AIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTG 204
            I   PL   + R+ S        Q T    +  G S I + EG    Y G    + +  
Sbjct: 126 DIALCPLEATRIRLVS--------QPTFANGLVGGFSRILKEEGAGSFYNGFTPILFK-- 175

Query: 205 AGSSVQLPIYNTAKHFLL-------------KHDL-MKEGTGLHLVASTVSGFGVGVVMN 250
                Q+P YN AK  +              K  L     TG++L++   +G    +V  
Sbjct: 176 -----QIP-YNIAKFLVFERAAEVYFGMAGPKESLSTASTTGINLLSGLTAGLAAAIVSQ 229

Query: 251 PWDVILTRVYNQK 263
           P D +L++V   K
Sbjct: 230 PADTLLSKVNKTK 242

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 64/159 (40%), Gaps = 7/159 (4%)

Query: 76  IFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVV 135
           I K EG      G +     QI  N ++   +E    V      P           +N++
Sbjct: 156 ILKEEGAGSFYNGFTPILFKQIPYNIAKFLVFERAAEVYFGMAGPKESLSTASTTGINLL 215

Query: 136 SGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRG 195
           SG T+G+  AI+  P   + +++     A   GQ T        L+ + +  GF G + G
Sbjct: 216 SGLTAGLAAAIVSQPADTLLSKVNKTKKA--PGQST-----IGLLAQLAKQLGFVGSFAG 268

Query: 196 VDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLH 234
           +   ++  G  +S+Q  IY + K  L     ++ G G H
Sbjct: 269 LPTRLVMVGTLTSLQFGIYGSLKKTLGCAPAIEIGGGGH 307

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 34/173 (19%), Positives = 70/173 (40%), Gaps = 12/173 (6%)

Query: 150 PLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSV 209
           P+ ++KTR       IQ+    +   + +    I  +EG   L  G    +L      S 
Sbjct: 33  PIDVVKTR-------IQLEPTVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGSF 85

Query: 210 QLPIYNTAKHFL---LKHD-LMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQKGN 265
           +   Y   K      L +D  +     +++ ++ ++ F   + + P +    R+ +Q   
Sbjct: 86  KFGGYEVFKKLFIDVLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLVSQP-T 144

Query: 266 LYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYAV 318
              G +  F + ++ EG G+ Y GF   +F+  P+ I      E+  +V + +
Sbjct: 145 FANGLVGGFSRILKEEGAGSFYNGFTPILFKQIPYNIAKFLVFERAAEVYFGM 197

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%)

Query: 249 MNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGF 290
           M P DV+ TR+  +     KG +  F + +  EG GAL  GF
Sbjct: 31  MVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLTGF 72

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 72/315 (22%), Positives = 126/315 (40%), Gaps = 39/315 (12%)

Query: 24  KTGSFIAGGMAACI-AVTVTNPIELVKTRMQLQGEMSA-DAQRIYKNPMQALKVIFKNEG 81
           KT S + GG    + +  V  P +L+KTR+Q   + +     +  ++P Q    +++   
Sbjct: 6   KTSSHLIGGFVGGLTSAIVLQPFDLLKTRLQQNKDTTLWGTLKEIRSPKQ----LWRGAL 61

Query: 82  IRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLN--KTFYPAMDPHKVQNVAVNVVSGA- 138
              L+  +  A +Y   LN  R    +     LN   +F P +  ++      N+ SGA 
Sbjct: 62  PSSLRTSIGSA-LYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYE------NLASGAF 114

Query: 139 TSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDA 198
           T G++G I   P+ +IK R +S            Y S+      IY  EG +G + G  A
Sbjct: 115 TRGVVGFIT-MPITIIKVRYES--------TMYSYKSLGEATRHIYSTEGIRGFFNGCGA 165

Query: 199 AILRTGAGSSVQLPIYNTAK----HFLLKHDLMKEGTGL-----HLVASTVSGFGVG--- 246
            ++R    + + + +Y  AK      L    +  +  G+       V +++S F      
Sbjct: 166 TVMRDAPYAGLYVLLYEKAKLLVPMMLPSSTISYDEAGMFTTYTSTVVNSISAFMSASLA 225

Query: 247 -VVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCL 305
             + +P+D I TR+       + G     V  V  E    L+ G   ++ R A    +  
Sbjct: 226 TTITSPFDTIKTRM-QLDPTKFSGFYKTLVLIVSKEKFKNLFDGLTLRLTRKAFSAGIAW 284

Query: 306 TFMEQTMKVVYAVEK 320
              E+ +K   A  K
Sbjct: 285 GIYEELIKRFMAYSK 299

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 75/306 (24%), Positives = 114/306 (37%), Gaps = 24/306 (7%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSA-DA-QRIYKNPMQALKVIFKNEGIRG 84
           S  AGG+    AV   +P +LVK R Q     SA DA   I +   QA      N  +RG
Sbjct: 31  SLAAGGVGGVCAVLTGHPFDLVKVRCQSNQARSAMDAVSHILQAARQAAGPTSLN-AVRG 89

Query: 85  LQKG-----LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGAT 139
             KG     L    I+ +   G  +G     + ++      A          + +   A 
Sbjct: 90  FYKGVVPPLLGVTPIFAVSFWGYDVG-----KKLVTSVPSSAASGAAAVEPELTLSQMAA 144

Query: 140 SGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAA 199
           +G I AI   P  L+    +     +Q  Q     S  +    I R +GF+ L++G  A 
Sbjct: 145 AGFISAI---PTTLVTAPTERVKVVLQTTQ--GKASFLDAAKQIVRTQGFQSLFKGSLAT 199

Query: 200 ILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVG----VVMNPWDVI 255
           + R G GS++    Y   K +L K      G  L +    +SG   G    VV+ P D +
Sbjct: 200 LSRDGPGSALYFASYEICKEYLNKASGHTSGE-LSITNVCISGGMAGVSMWVVVFPIDTV 258

Query: 256 LTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVV 315
            T++ +         +   +   R  GI   + G    I R  P        +E T  + 
Sbjct: 259 KTQLQSSSKRQSMLEVTRMIYNTR-GGIKGFFPGVGPAILRSFPANAATFLGVELTHSLF 317

Query: 316 YAVEKQ 321
              E+Q
Sbjct: 318 KKFEQQ 323

>Kwal_56.23011
          Length = 303

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 73/188 (38%), Gaps = 27/188 (14%)

Query: 122 MDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLS 181
           +D H  +    +V  G   G+   ++G P  + K R+Q+        Q          + 
Sbjct: 15  VDTHDFKQALKDVFCGTVGGVAQVLVGQPFDITKVRLQTSPVPTTAAQV---------IK 65

Query: 182 SIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHD-------LMKEGTGLH 234
           S+ + EG    Y+G  A +   GA  S Q  +    K +  K D        +++     
Sbjct: 66  SLVKNEGLLAFYKGTLAPLAGVGACVSCQFGVNEALKKWFRKKDGNFDQPLALRQYYACG 125

Query: 235 LVASTVSGFGVGVVMNPWDVILTRVYNQKGNL----YKGPLDCFVKTVRIEGIGALYKGF 290
            V+ T + F    +  P + +  R+  Q  +     Y G LDC  K ++    GAL +GF
Sbjct: 126 FVSGTANAF----LATPIEHVRIRLQLQTASSSAAEYHGSLDCARKLLK---QGALMRGF 178

Query: 291 EAQIFRIA 298
            A   R +
Sbjct: 179 TATTLRTS 186

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 71/293 (24%), Positives = 110/293 (37%), Gaps = 31/293 (10%)

Query: 31  GGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGLS 90
           GG+A    V V  P ++ K R+Q     +  AQ I        K + KNEG+    KG +
Sbjct: 33  GGVAQ---VLVGQPFDITKVRLQTSPVPTTAAQVI--------KSLVKNEGLLAFYKG-T 80

Query: 91  CAYIYQIGLNGS-RLGFYEPIRSVLNKTFYPAMDPHKVQNVAVN--VVSGATSGIIGAIM 147
            A +  +G   S + G  E ++    K      D +  Q +A+      G  SG   A +
Sbjct: 81  LAPLAGVGACVSCQFGVNEALKKWFRKK-----DGNFDQPLALRQYYACGFVSGTANAFL 135

Query: 148 GSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGS 207
            +P+  ++ R+Q    A     + H       L    +      L RG  A  LRT  G 
Sbjct: 136 ATPIEHVRIRLQ-LQTASSSAAEYH-----GSLDCARKLLKQGALMRGFTATTLRTSHGF 189

Query: 208 SVQLPIYNTAKHFLLKHDLMKEGTGLHLVA--STVSGFGVGVVMNPWDVI--LTRVYNQK 263
            +    Y T       H +++E      V      SG     +  P+DV+  + +    K
Sbjct: 190 GIYFLTYETLIANQAHHGVLRENIPAWKVCVYGAFSGAFFWAMTYPFDVVKSVMQADKLK 249

Query: 264 GNLY-KGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVV 315
             +Y + PL       R  G  A  KGF   + R  P         E TM+++
Sbjct: 250 NPVYGRNPLAVAKAIYRERGPRAFTKGFTPTMLRSLPVNGATFAAFEITMRLI 302

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 42/90 (46%), Gaps = 9/90 (10%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQR--IY-KNPMQALKVIFKNEGIRGL 85
           + G  +      +T P ++VK+ MQ      AD  +  +Y +NP+   K I++  G R  
Sbjct: 220 VYGAFSGAFFWAMTYPFDVVKSVMQ------ADKLKNPVYGRNPLAVAKAIYRERGPRAF 273

Query: 86  QKGLSCAYIYQIGLNGSRLGFYEPIRSVLN 115
            KG +   +  + +NG+    +E    ++N
Sbjct: 274 TKGFTPTMLRSLPVNGATFAAFEITMRLIN 303

>Scas_705.9
          Length = 323

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 64/302 (21%), Positives = 126/302 (41%), Gaps = 47/302 (15%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQ------GEMSADAQRIYK--NPMQAL 73
           +S   S I G +A+ +A  +  P+++ KT +Q +       E+S   +RI +  N ++ L
Sbjct: 1   MSNLESAITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCL 60

Query: 74  KVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVN 133
             IF+  G+RGL +G+S +   +   +     +Y    S L + ++        Q   +N
Sbjct: 61  IRIFRKRGLRGLYQGMSTSVFSKFVQSFCYFFWY----SFLRRKYFSLKLLRNTQARPIN 116

Query: 134 VVSGATSGIIGA-------IMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIW---NGLSSI 183
            +S     I+G        ++ +P+ +I T+ Q+  +   +   +    I+   NG  S 
Sbjct: 117 SISTVEELIVGVGAAALTQVVNNPIEVILTKQQTTDDKDNVDFYSVLKQIYVESNGKLSS 176

Query: 184 YRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGT-------GLHLV 236
           Y        ++G   +++ T    S+    Y   K  LLK     E +         + +
Sbjct: 177 Y--------WKGFKVSLILT-VNPSITFAAYQRFKDILLKQVSNSEKSYSGQLTVNQNFI 227

Query: 237 ASTVSGFGVGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRI----EGIGALYKGFEA 292
              ++     ++  P  +I+ +V  Q+ N        F + +R     EG+ AL+KG   
Sbjct: 228 LGALAKIISTIITQP--LIVAKVSLQRSN---SKFKHFEEVLRYLYKEEGVLALWKGVGP 282

Query: 293 QI 294
           Q+
Sbjct: 283 QL 284

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 79/184 (42%), Gaps = 32/184 (17%)

Query: 133 NVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGL 192
           ++VSGA +G    ++  P+  +KTR+Q+       G                   G++G+
Sbjct: 8   SLVSGAAAGTSTDVVFFPIDTLKTRLQAKGGFFHNG-------------------GYRGI 48

Query: 193 YRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTG--------LHLVASTVSGFG 244
           YRG+ +A++ +  G+S+    Y++ K  L    +M   T          H+++S++    
Sbjct: 49  YRGLGSAVVASAPGASLFFVTYDSMKQQL--RPVMGRWTASEQLAEVLTHMLSSSLGEMS 106

Query: 245 VGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEG-IGALYKGFEAQIFRIAPHTIL 303
             +V  P +VI  R      N     L   ++    EG +  LY+G+   I R  P T  
Sbjct: 107 ACLVRVPAEVIKQRTQTHHTNSSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREIPFT-- 164

Query: 304 CLTF 307
           C+ F
Sbjct: 165 CIQF 168

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/272 (22%), Positives = 108/272 (39%), Gaps = 41/272 (15%)

Query: 26  GSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGL 85
            S ++G  A      V  PI+ +KTR+Q +G                    F N G RG+
Sbjct: 7   ASLVSGAAAGTSTDVVFFPIDTLKTRLQAKGG------------------FFHNGGYRGI 48

Query: 86  QKGLSCAYIYQIGLNGSRLGF--YEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGII 143
            +GL  A +      G+ L F  Y+ ++  L           ++  V  +++S +   + 
Sbjct: 49  YRGLGSAVV--ASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMS 106

Query: 144 GAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYR---AEG-FKGLYRGVDAA 199
             ++  P  +IK R Q++          H  S    L  I R    EG  +GLYRG    
Sbjct: 107 ACLVRVPAEVIKQRTQTH----------HTNSSLQTLRLILRDPTGEGVVRGLYRGWWTT 156

Query: 200 ILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLH-LVASTVSGFGVGVVMNPWDVILTR 258
           I+R    + +Q P+Y   K     +  ++  +     V  +++G        P DV+ TR
Sbjct: 157 IMREIPFTCIQFPLYEYLKKKWAAYAEIERVSAWQGAVCGSLAGGIAAAATTPLDVLKTR 216

Query: 259 VYNQKGNLYKGPLDCFVKTV-RIEGIGALYKG 289
           +   +  +   P+    +T+ R EG    ++G
Sbjct: 217 MMLHERRV---PMLHLARTLFREEGARVFFRG 245

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 40/87 (45%), Gaps = 10/87 (11%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQAL-KVIFKNEGIRGLQK 87
           + G +A  IA   T P++++KTRM L            + PM  L + +F+ EG R   +
Sbjct: 194 VCGSLAGGIAAAATTPLDVLKTRMMLHER---------RVPMLHLARTLFREEGARVFFR 244

Query: 88  GLSCAYIYQIGLNGSRLGFYEPIRSVL 114
           G+    ++        LG YE + S+ 
Sbjct: 245 GIGPRTMWISAGGAIFLGVYEAVHSLF 271

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 68/296 (22%), Positives = 119/296 (40%), Gaps = 45/296 (15%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQ---------RIYKNPMQALKVIF 77
           S + G +A+ +A     P++L KT +Q Q   S+            R YKN +  +  IF
Sbjct: 6   SALTGAVASAMANIAVYPLDLSKTIIQSQVSPSSSEDSNEGKVLPNRRYKNVVDCMINIF 65

Query: 78  KNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAV----- 132
           K +GI GL +G++   +     N     +Y  IR    K     +   K ++  +     
Sbjct: 66  KEKGILGLYQGMTVTTVATFVQNFVYFFWYTFIRKSYMKHKLLGLQSLKNRDGPITPSTI 125

Query: 133 -NVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEG--F 189
             +V G  +  I  +  SP+ ++ TR Q+  +A    +   +T   N +  IYR      
Sbjct: 126 EELVLGVAAASISQLFTSPMAVVATRQQTVHSA----ESAKFT---NVIKDIYRENNGDI 178

Query: 190 KGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLK----HDLMKEGTGLHLVASTVSGFGV 245
              ++G     LRTG   ++  P    A    LK    HD   +   L    S V  F +
Sbjct: 179 TAFWKG-----LRTGLALTIN-PSITYASFQRLKEVFFHDHSNDAGSL----SAVQNFIL 228

Query: 246 GVVMNPWDVILTR-------VYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQI 294
           GV+      ++T+       +    G+ +    +  +   + EG+ +L+KG   Q+
Sbjct: 229 GVLSKMISTLVTQPLIVAKAMLQSAGSKFTTFQEALLYLYKNEGLKSLWKGVLPQL 284

 Score = 35.0 bits (79), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 7/68 (10%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG 81
           +S   +FI G ++  I+  VT P+ + K  +Q  G      Q       +AL  ++KNEG
Sbjct: 220 LSAVQNFILGVLSKMISTLVTQPLIVAKAMLQSAGSKFTTFQ-------EALLYLYKNEG 272

Query: 82  IRGLQKGL 89
           ++ L KG+
Sbjct: 273 LKSLWKGV 280

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 67/312 (21%), Positives = 125/312 (40%), Gaps = 55/312 (17%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRI--------------------- 65
           S ++G +A+ +A TV  P++LVKT +Q Q +     +++                     
Sbjct: 6   SALSGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDIPPVPI 65

Query: 66  ---------YKNPMQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNK 116
                    Y +   A+  I+K EGIRGL +GL+ + +       S   +Y  +R    +
Sbjct: 66  KLNENNYLQYNSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFR 125

Query: 117 TFYPAMDPHK---VQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHY 173
                    K   ++ + + +V+ ATS     I  +P+ LI  R Q+      I     +
Sbjct: 126 VKLINRKNTKFTTIEELLLGIVAAATS----QIFTNPISLISARQQTRQG---IDGDNDF 178

Query: 174 TSIWNGLSSIYRAE-GFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTG 232
            ++      IY+ +   KG ++G+  +++ T    S+    Y   K  L   D M     
Sbjct: 179 LTV---AKEIYKEQRSIKGFWKGLKVSLMLT-INPSITYTSYEKLKDALFTTDTMNLKKE 234

Query: 233 LHLVASTVS---GFGVGVVMNPWDVILT------RVYNQK-GNLYKGPLDCFVKTVRIEG 282
           L   +S +S    F +GV+      I+T      + + Q+ G+ +           + EG
Sbjct: 235 LVDSSSQLSPYQNFTLGVLSKMISAIITMPLIISKAWLQRNGSNFSSFQQVLYYLYKNEG 294

Query: 283 IGALYKGFEAQI 294
           + + +KG   Q+
Sbjct: 295 LRSWWKGLSPQL 306

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 102/257 (39%), Gaps = 54/257 (21%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPM-QALKVIFKNEGIRGLQK 87
           +AG +   I  +   PI++VKTR+QL+         +Y   M  + K I  +EG   L  
Sbjct: 18  LAGAIGCGITHSSMVPIDVVKTRIQLE-------PTVYNKGMVSSFKQIISSEGAGALLT 70

Query: 88  GLSCAYIYQIGLNGS-RLGFYEPIRSVLNKTFYPAMDPHKVQNVAVN------VVSGATS 140
           G     +    L GS + G YE  + +       A+D     N AVN      + S A +
Sbjct: 71  GFGPT-LLGYSLQGSFKFGGYELFKKL-------AIDNMGYDN-AVNYKNTIYIGSAAIA 121

Query: 141 GIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAI 200
                I   PL   + R+        + Q T    ++ G S I + EG    Y G    +
Sbjct: 122 EFFADIALCPLEATRIRL--------VSQPTFANGLFGGFSRILKEEGVGSFYNGFTPIL 173

Query: 201 LRTGAGSSVQLPIYNTAKHFLLKH------------DLMKEG--TGLHLVASTVSGFGVG 246
            +       Q+P YN AK F+ +H            + M E   T ++L A   +G    
Sbjct: 174 FK-------QIP-YNIAKFFVFEHAANAYFGLAGPKETMSETTHTAINLAAGLTAGLAAA 225

Query: 247 VVMNPWDVILTRVYNQK 263
           VV  P D +L++V   K
Sbjct: 226 VVSQPADTLLSKVNKTK 242

 Score = 35.0 bits (79), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 31/173 (17%), Positives = 67/173 (38%), Gaps = 12/173 (6%)

Query: 150 PLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSV 209
           P+ ++KTR       IQ+    +   + +    I  +EG   L  G    +L      S 
Sbjct: 33  PIDVVKTR-------IQLEPTVYNKGMVSSFKQIISSEGAGALLTGFGPTLLGYSLQGSF 85

Query: 210 QLPIYNTAKHFLLKH----DLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQKGN 265
           +   Y   K   + +    + +     +++ ++ ++ F   + + P +    R+ +Q   
Sbjct: 86  KFGGYELFKKLAIDNMGYDNAVNYKNTIYIGSAAIAEFFADIALCPLEATRIRLVSQP-T 144

Query: 266 LYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYAV 318
              G    F + ++ EG+G+ Y GF   +F+  P+ I      E      + +
Sbjct: 145 FANGLFGGFSRILKEEGVGSFYNGFTPILFKQIPYNIAKFFVFEHAANAYFGL 197

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%)

Query: 249 MNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGF 290
           M P DV+ TR+  +     KG +  F + +  EG GAL  GF
Sbjct: 31  MVPIDVVKTRIQLEPTVYNKGMVSSFKQIISSEGAGALLTGF 72

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/276 (23%), Positives = 114/276 (41%), Gaps = 16/276 (5%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           SF+AG  A  I   VT P E  KTR+QL  + S ++    +NP+  L    + +G   L 
Sbjct: 13  SFVAGAAAGAIEGCVTYPFEFAKTRLQLAQQGSGES----RNPLVLLYRTARTQGAGALY 68

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146
            G     +      G R   ++ +R  L        D     +    +++G  +G++ ++
Sbjct: 69  VGCPAFVVGNTCKAGVRFLGFDALRRALQ-------DERGALSGPRGMLAGLGAGLLESV 121

Query: 147 MG-SPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGA 205
           +  +P   +KT +     A +   Q +        + + R  G +GLY G+    LR  +
Sbjct: 122 LAVTPFEAVKTALIDDRQAARPRYQHNGRGAARNYALLLRELGLRGLYGGLVPVALRQAS 181

Query: 206 GSSVQLPIYNTAKHFLLKHDLMKE----GTGLHLVASTVSGFGVGVVMNPWDVILTRVYN 261
             +V+   Y   K  + ++         G+G   +   +SG        P D + TR+  
Sbjct: 182 NQAVRFGCYTQLKQAVQRYAGTPADQPLGSGQTFLVGALSGIVTVYATMPVDTVKTRMQA 241

Query: 262 QKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRI 297
                Y   + CF   VR EG+ AL++G   ++ R+
Sbjct: 242 LDAARYGSTVGCFRAVVREEGVRALWRGATPRLGRL 277

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 48/116 (41%), Gaps = 8/116 (6%)

Query: 183 IYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSG 242
           +Y+  G     +G  A I R  A +S+Q   Y   K  L   +         ++    + 
Sbjct: 150 MYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQARN----DKASSVITGLATS 205

Query: 243 FGVGVVMNPWDVILTRVYNQKGNL-YKGPLDCFVKTVRIEGIGALYKGFEAQIFRI 297
           F +  +  P DV+ TR+ +Q     YK  L+C  +    EG+   +KG    IFR 
Sbjct: 206 FTLVAMTQPIDVVKTRMMSQNAKTEYKNTLNCMYRIFVQEGMATFWKG---SIFRF 258

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 41/79 (51%), Gaps = 6/79 (7%)

Query: 23  SKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGI 82
            K  S I G   +   V +T PI++VKTRM     MS +A+  YKN +  +  IF  EG+
Sbjct: 193 DKASSVITGLATSFTLVAMTQPIDVVKTRM-----MSQNAKTEYKNTLNCMYRIFVQEGM 247

Query: 83  RGLQKGLSCAYIYQIGLNG 101
               KG S     ++G++G
Sbjct: 248 ATFWKG-SIFRFMKVGISG 265

 Score = 34.3 bits (77), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 29/146 (19%), Positives = 57/146 (39%), Gaps = 16/146 (10%)

Query: 70  MQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQN 129
           + A+K +++  G     +G +     QI     +   Y   + +L              +
Sbjct: 144 LPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQAR----------ND 193

Query: 130 VAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGF 189
            A +V++G  +      M  P+ ++KTRM S  NA     +T Y +  N +  I+  EG 
Sbjct: 194 KASSVITGLATSFTLVAMTQPIDVVKTRMMS-QNA-----KTEYKNTLNCMYRIFVQEGM 247

Query: 190 KGLYRGVDAAILRTGAGSSVQLPIYN 215
              ++G     ++ G    +   +Y 
Sbjct: 248 ATFWKGSIFRFMKVGISGGLTFTVYE 273

>Kwal_55.21338
          Length = 323

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 73/163 (44%), Gaps = 12/163 (7%)

Query: 150 PLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSV 209
           PL ++ T++Q+         +    S+ + +  IYR +G  G + G+++A+  T   + V
Sbjct: 42  PLIVVTTKLQTQD------AKGEKLSLADTIKDIYRKDGAMGFFAGLESALFGTTLSNFV 95

Query: 210 QLPIYNTAKHFLLK-HDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQKGNLYK 268
               Y  +   +L+     +  T   ++  +++G       NP  V  TR+  QK +  +
Sbjct: 96  YYYCYEASSRCVLRARHTQRLTTAESMLVGSIAGSLNATAANPLWVANTRMTVQKSD--R 153

Query: 269 GPLDCFVKTVRIEGIGALYKGFE-AQIFRIAPHTILCLTFMEQ 310
           G L      V+ EGI  L+KG   A I  I P  I+  T  EQ
Sbjct: 154 GTLSTIFDIVKDEGISGLFKGLNPALILVINP--IIQYTVYEQ 194

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 76/182 (41%), Gaps = 39/182 (21%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           S + G +A  +  T  NP+ +  TRM +Q         I+         I K+EGI GL 
Sbjct: 121 SMLVGSIAGSLNATAANPLWVANTRMTVQKSDRGTLSTIFD--------IVKDEGISGLF 172

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146
           KGL+ A I  I           PI   +  T Y  +    + +     +S + + I+GA+
Sbjct: 173 KGLNPALILVI----------NPI---IQYTVYEQLKNWILSSRQTRTLSPSWAFILGAV 219

Query: 147 -----MGS--PLFLIKTRMQSYSNAIQIGQQTHYT-----SIWNGLSSIYRAEGFKGLYR 194
                 GS  P   +K RM        +G+    T     S+ + ++ I + +G  GLYR
Sbjct: 220 GKLAATGSTYPYVTMKARMH------LLGEHKSSTAAPPRSLLSLMAEIIKKDGILGLYR 273

Query: 195 GV 196
           G+
Sbjct: 274 GI 275

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 89/187 (47%), Gaps = 20/187 (10%)

Query: 36  CIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGLSCAYIY 95
            I++T+T P+ +V T++Q Q     DA+    +    +K I++ +G  G   GL  A   
Sbjct: 34  AISMTLTYPLIVVTTKLQTQ-----DAKGEKLSLADTIKDIYRKDGAMGFFAGLESAL-- 86

Query: 96  QIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIK 155
             G   S   +Y    +  ++    A    ++   A +++ G+ +G + A   +PL++  
Sbjct: 87  -FGTTLSNFVYYYCYEAS-SRCVLRARHTQRL-TTAESMLVGSIAGSLNATAANPLWVAN 143

Query: 156 TRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYN 215
           TRM      +Q   +   ++I++    I + EG  GL++G++ A++       +Q  +Y 
Sbjct: 144 TRM-----TVQKSDRGTLSTIFD----IVKDEGISGLFKGLNPALILV-INPIIQYTVYE 193

Query: 216 TAKHFLL 222
             K+++L
Sbjct: 194 QLKNWIL 200

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 71/171 (41%), Gaps = 11/171 (6%)

Query: 149 SPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSS 208
           +PL L+K R+Q             YTS   G   I   EG+K +Y G  A  +      +
Sbjct: 37  TPLDLVKCRLQV--------NPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGA 88

Query: 209 VQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQKGNLYK 268
            +   Y   KH  L    +  G  ++L+AS  + F   +++ P++ I  +          
Sbjct: 89  GKYGGYEYFKH--LYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCN 146

Query: 269 GPLDCFVKT-VRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYAV 318
             +D + K      G+ A YKG      R  P+T+   T  E+ ++ +Y+V
Sbjct: 147 NVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSV 197

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/239 (19%), Positives = 103/239 (43%), Gaps = 25/239 (10%)

Query: 31  GGMAACIAV-TVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGL 89
           GG+ AC    +   P++LVK R+Q+         ++Y + +Q  + I  NEG + +  G 
Sbjct: 24  GGIIACGPTHSSITPLDLVKCRLQVN-------PKLYTSNLQGFRKIIANEGWKKVYTGF 76

Query: 90  SCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGS 149
              ++        + G YE  + + +    P         V V +++ AT+  +  IM  
Sbjct: 77  GATFVGYSLQGAGKYGGYEYFKHLYSSWLSPG--------VTVYLMASATAEFLADIMLC 128

Query: 150 PLFLIKTRMQS----YSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLY-RGVDAAILRTG 204
           P   IK + Q+    + N +  G +  Y     G+ + Y+  G   L+ R +   + +  
Sbjct: 129 PFEAIKVKQQTTMPPFCNNVVDGWKKMYAES-GGMKAFYK--GIVPLWCRQIPYTMCKFT 185

Query: 205 AGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQK 263
           +   +   IY+       + + +++   +  V   ++G     V +P DV+++++ +++
Sbjct: 186 SFEKIVQKIYSVLPKKKEEMNALQQ-ISVSFVGGYLAGILCAAVSHPADVMVSKINSER 243

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 86/199 (43%), Gaps = 22/199 (11%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIF-KNEGIRGLQ 86
            +A   A  +A  +  P E +K + Q              N +   K ++ ++ G++   
Sbjct: 113 LMASATAEFLADIMLCPFEAIKVKQQ------TTMPPFCNNVVDGWKKMYAESGGMKAFY 166

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPI----RSVLNKTFYPAMDPHKVQNVAVNVVSGATSGI 142
           KG+   +  QI     +   +E I     SVL K      + + +Q ++V+ V G  +GI
Sbjct: 167 KGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKK---KEEMNALQQISVSFVGGYLAGI 223

Query: 143 IGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILR 202
           + A +  P  ++ +++ S   A +        S+      IY+  GF GL+ G+   I+ 
Sbjct: 224 LCAAVSHPADVMVSKINSERKANE--------SMSVASKRIYQKIGFTGLWNGLMVRIVM 275

Query: 203 TGAGSSVQLPIYNTAKHFL 221
            G  +S Q  IY++ K ++
Sbjct: 276 IGTLTSFQWLIYDSFKAYV 294

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 75/305 (24%), Positives = 132/305 (43%), Gaps = 40/305 (13%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADA-----QRIYKNPMQALKVIFKNEG 81
           S   G +A+ +A T   P++L KT +Q Q + +AD+     +  YKN +  +  IFK  G
Sbjct: 6   SAFTGAVASSLAATTVYPLDLAKTLIQTQHK-NADSGDSKEEEKYKNVIDCIIKIFKKRG 64

Query: 82  IRGLQKGLSCAYIYQIGLNGSRLGFYEPIRS---VLNKTFYPAMDPHKVQNVAV--NVVS 136
             GL +GL+         N     +Y  IRS   V         D  K   ++    +  
Sbjct: 65  FLGLYQGLATNVAANFVQNFIYFFWYSLIRSNYFVFKAGRLQLKDDSKFIELSTIEELAL 124

Query: 137 GATSGIIGAIMGSPLFLIKTRMQ--------SYSNAI-QIGQQTH--YTSIWNGLS---- 181
           G ++G +  ++ +P+ +I TR Q        S    I QI ++++   T+ W G      
Sbjct: 125 GMSAGAMTQVVTNPISVISTRQQLTKDGEDASLKAVIKQIYEESNGDLTAFWKGFKVALV 184

Query: 182 -SIYRAEGFKGLYRGVDAAILRTG--AGS---SVQLPIYNTAKHFLLK--HDLMKEGTGL 233
            S   A  + G Y+ + + IL     +GS   S QL   +  ++FLL     ++      
Sbjct: 185 LSTNPAITY-GSYQKLKSMILTAKGLSGSQKISTQL---SAGENFLLGMFSKMISTFVTQ 240

Query: 234 HLVASTVSGFGVGVVMNPWDVILTRVYNQKG--NLYKGPLDCFVKTVRIEGIGALYKGFE 291
            L+ + ++  G G     +  +L  +Y  +G  +L+KG +    K V ++G+   YK   
Sbjct: 241 PLIVAKITLQGKGSKFKTFQEVLQHIYQNEGFLSLWKGVIPQVSKGVIVQGLLFTYKDEI 300

Query: 292 AQIFR 296
            ++ R
Sbjct: 301 VRVIR 305

>Kwal_0.232
          Length = 274

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 80/196 (40%), Gaps = 30/196 (15%)

Query: 30  AGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNE---GIR-GL 85
           AG +AAC+   V  P E++K R Q     S+         +Q LK + +NE   GIR  L
Sbjct: 104 AGEIAACM---VRVPAEVIKQRTQTHKSDSS---------LQTLKKLLQNENGEGIRRNL 151

Query: 86  QKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGA 145
            +G S   + +I     +   YE     L K +  +    +V         G  +G I A
Sbjct: 152 YRGWSTTVMREIPFTCIQFPLYE----FLKKQWAISGGREQVAPWQ-GAFCGCVAGGIAA 206

Query: 146 IMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGA 205
              +PL ++KTR+     ++ +               IY  EG+K  + GV    +   A
Sbjct: 207 ATTTPLDVLKTRLMLSHTSVPVLHLAR---------QIYATEGWKVFFSGVGPRTVWISA 257

Query: 206 GSSVQLPIYNTAKHFL 221
           G ++ L +Y T    L
Sbjct: 258 GGAIFLGVYETVHSIL 273

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 43/197 (21%), Positives = 83/197 (42%), Gaps = 32/197 (16%)

Query: 133 NVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGL 192
           ++++GA +G    +   P+  +KTR+Q+       G                   G+ G+
Sbjct: 9   SLLAGAAAGTSTDLFFFPIDTLKTRLQAAGGFFANG-------------------GYLGV 49

Query: 193 YRGVDAAILRTGAGSSVQLPIYNTAKHF--------LLKHDLMKEGTGLHLVASTVSGFG 244
           YRG+ +A++ +   +S+    Y+  K +        +   D + E T  H+ +S+     
Sbjct: 50  YRGLGSAVVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAE-TATHMFSSSAGEIA 108

Query: 245 VGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGA-LYKGFEAQIFRIAPHTIL 303
             +V  P +VI  R    K +     L   ++    EGI   LY+G+   + R  P T  
Sbjct: 109 ACMVRVPAEVIKQRTQTHKSDSSLQTLKKLLQNENGEGIRRNLYRGWSTTVMREIPFT-- 166

Query: 304 CLTF-MEQTMKVVYAVE 319
           C+ F + + +K  +A+ 
Sbjct: 167 CIQFPLYEFLKKQWAIS 183

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 58/246 (23%), Positives = 90/246 (36%), Gaps = 44/246 (17%)

Query: 27  SFIAGGMAACIAVTVTN----PIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGI 82
           SFI   +A   A T T+    PI+ +KTR+Q  G                    F N G 
Sbjct: 5   SFITSLLAGAAAGTSTDLFFFPIDTLKTRLQAAGGF------------------FANGGY 46

Query: 83  RGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAM-DPHKVQNVAVNVVSGATSG 141
            G+ +GL  A +            Y+ ++S     F   +    +V   A ++ S +   
Sbjct: 47  LGVYRGLGSAVVASAPSASLFFVTYDGMKSYSRPIFNNLITSSDQVAETATHMFSSSAGE 106

Query: 142 IIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGF-KGLYRGVDAAI 200
           I   ++  P  +IK R Q++ +   +          NG       EG  + LYRG    +
Sbjct: 107 IAACMVRVPAEVIKQRTQTHKSDSSLQTLKKLLQNENG-------EGIRRNLYRGWSTTV 159

Query: 201 LRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVA-------STVSGFGVGVVMNPWD 253
           +R    + +Q P+Y       LK      G G   VA         V+G        P D
Sbjct: 160 MREIPFTCIQFPLYE-----FLKKQWAISG-GREQVAPWQGAFCGCVAGGIAAATTTPLD 213

Query: 254 VILTRV 259
           V+ TR+
Sbjct: 214 VLKTRL 219

>Scas_673.17
          Length = 314

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 89/235 (37%), Gaps = 40/235 (17%)

Query: 44  PIELVKTRMQLQGEMSADAQRIYKNPM-QALKVIFKNEGIRGLQKGLSCAYIYQIGLNGS 102
           P+++VKTR+QL+         +Y   M  + K I  +EG   L  G     +        
Sbjct: 40  PVDVVKTRIQLE-------PTVYNKGMVGSFKKIIADEGAGALLTGFGPTLLGYSVQGAF 92

Query: 103 RLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYS 162
           + G YE  + +   T       H   +V +   S A +  +  I   PL   + R+    
Sbjct: 93  KFGGYEVFKKLSIDTIGYENAVHYKNSVYMG--SAAVAEFLADIALCPLEATRIRL---- 146

Query: 163 NAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLL 222
               + Q T    +  G S I + EG    Y G    + +       Q+P YN AK  + 
Sbjct: 147 ----VSQPTFANGLVGGFSRILKEEGVGSFYSGFTPILFK-------QIP-YNIAKFLVF 194

Query: 223 KHDL--------MKE------GTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQK 263
           +            KE       TG++L++   +GF    V  P D +L++V   K
Sbjct: 195 ERASEVYYGIVGAKETLSDMTNTGINLLSGLTAGFAAAFVSQPADTLLSKVNKTK 249

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 41/205 (20%), Positives = 80/205 (39%), Gaps = 17/205 (8%)

Query: 123 DPHKVQNVAV-NVVSGATSGIIGAIMGS----PLFLIKTRMQSYSNAIQIGQQTHYTSIW 177
           D HK+ + A  +    A +G IG         P+ ++KTR       IQ+    +   + 
Sbjct: 8   DAHKIPDYAASDYFKFALAGAIGCGTTHSSLVPVDVVKTR-------IQLEPTVYNKGMV 60

Query: 178 NGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLK----HDLMKEGTGL 233
                I   EG   L  G    +L      + +   Y   K   +      + +     +
Sbjct: 61  GSFKKIIADEGAGALLTGFGPTLLGYSVQGAFKFGGYEVFKKLSIDTIGYENAVHYKNSV 120

Query: 234 HLVASTVSGFGVGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQ 293
           ++ ++ V+ F   + + P +    R+ +Q      G +  F + ++ EG+G+ Y GF   
Sbjct: 121 YMGSAAVAEFLADIALCPLEATRIRLVSQP-TFANGLVGGFSRILKEEGVGSFYSGFTPI 179

Query: 294 IFRIAPHTILCLTFMEQTMKVVYAV 318
           +F+  P+ I      E+  +V Y +
Sbjct: 180 LFKQIPYNIAKFLVFERASEVYYGI 204

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 86/199 (43%), Gaps = 38/199 (19%)

Query: 132 VNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKG 191
           V++ SGA +G    +   P+  +KTR+Q+       G                   G+KG
Sbjct: 8   VSLASGAAAGTSTDLAFFPIDTLKTRLQAKGGFFANG-------------------GYKG 48

Query: 192 LYRGVDAAILRTGAGSSVQLPIYNTAK--------HFLLKHDLMKEGTGLHLVASTVSGF 243
           +YRG+ +A++ +   +S+    Y++ K         ++  ++ M + T  H+ +S++   
Sbjct: 49  VYRGLGSAVIASAPSASLFFVSYDSMKVYSKPVISKYVTSNNQMAD-TLSHMFSSSIGEV 107

Query: 244 GVGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEG----IGALYKGFEAQIFRIAP 299
              +V  P +VI  R    K N        F K ++ E     +  LY+G+   I R  P
Sbjct: 108 SACLVRVPAEVIKQRTQTHKTN---SSWQTFTKILQNENGEGVLRNLYRGWNTTIMREIP 164

Query: 300 HTILCLTF-MEQTMKVVYA 317
            T  C+ F + + +K  +A
Sbjct: 165 FT--CIQFPLYEFLKKTWA 181

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 79/195 (40%), Gaps = 30/195 (15%)

Query: 31  GGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG----IRGLQ 86
           G ++AC+   V  P E++K R Q     S+          Q    I +NE     +R L 
Sbjct: 105 GEVSACL---VRVPAEVIKQRTQTHKTNSS---------WQTFTKILQNENGEGVLRNLY 152

Query: 87  KGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAI 146
           +G +   + +I     +   YE     L KT+        V     +V  G+ +G I A 
Sbjct: 153 RGWNTTIMREIPFTCIQFPLYE----FLKKTWAKRNGQDHVAPWQGSVC-GSVAGAIAAA 207

Query: 147 MGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAG 206
             +PL ++KTR+     +I + Q            +IY  EGFK  + GV    +   AG
Sbjct: 208 TTTPLDVLKTRLMLSHKSIPVAQLAK---------NIYAEEGFKVFFSGVGPRTMWISAG 258

Query: 207 SSVQLPIYNTAKHFL 221
            ++ L +Y T    L
Sbjct: 259 GAIFLGVYETVHSIL 273

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 63/255 (24%), Positives = 97/255 (38%), Gaps = 58/255 (22%)

Query: 25  TGSFIAGGMAACIAVTVTN----PIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNE 80
           + SF+    +   A T T+    PI+ +KTR+Q +G                    F N 
Sbjct: 3   SSSFLVSLASGAAAGTSTDLAFFPIDTLKTRLQAKGGF------------------FANG 44

Query: 81  GIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPH-KVQNVAVNVVSGAT 139
           G +G+ +GL  A I            Y+ ++ V +K   P +  +    N   + +S   
Sbjct: 45  GYKGVYRGLGSAVIASAPSASLFFVSYDSMK-VYSK---PVISKYVTSNNQMADTLSHMF 100

Query: 140 SGIIGAIMGS----PLFLIKTRMQSYSNAIQIGQQTHYT-SIWNGLSSIYRAEGFKG--- 191
           S  IG +       P  +IK R            QTH T S W   + I + E  +G   
Sbjct: 101 SSSIGEVSACLVRVPAEVIKQRT-----------QTHKTNSSWQTFTKILQNENGEGVLR 149

Query: 192 -LYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHL------VASTVSGFG 244
            LYRG +  I+R    + +Q P+Y       LK    K     H+      V  +V+G  
Sbjct: 150 NLYRGWNTTIMREIPFTCIQFPLYE-----FLKKTWAKRNGQDHVAPWQGSVCGSVAGAI 204

Query: 245 VGVVMNPWDVILTRV 259
                 P DV+ TR+
Sbjct: 205 AAATTTPLDVLKTRL 219

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 44.3 bits (103), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 85/185 (45%), Gaps = 22/185 (11%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPM--QALKVIFKN 79
           +S+  +++AGG+   +A     PI+ +K R+Q     +    R    P+  +  K +++ 
Sbjct: 293 LSRLSTYVAGGLGGIMAQFSVYPIDTLKFRIQ----CAPLDTRCRGLPLLIKTAKDMYRE 348

Query: 80  EGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVV---S 136
            G+R   +GL    +         LG +  ++         A+   + + V  N+V    
Sbjct: 349 GGLRLFYRGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPM 408

Query: 137 GATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTH-YTSIWNGLSSIYRA----EGFKG 191
           GA SG +GA +  P+ L++TR+Q+        Q T+ +   ++G   ++R     EG  G
Sbjct: 409 GAFSGTVGATVVYPINLLRTRLQA--------QGTYAHPHRYDGFQDVFRKTVQREGLPG 460

Query: 192 LYRGV 196
           LY+G+
Sbjct: 461 LYKGL 465

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 65/149 (43%), Gaps = 16/149 (10%)

Query: 182 SIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVAST-- 239
            +YR  G +  YRG+   IL     +++ L  ++  K + +       G   + V  +  
Sbjct: 344 DMYREGGLRLFYRGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNL 403

Query: 240 -------VSGFGVGVVMNPWDVILTRVYNQ----KGNLYKGPLDCFVKTVRIEGIGALYK 288
                   SG     V+ P +++ TR+  Q      + Y G  D F KTV+ EG+  LYK
Sbjct: 404 VVLPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYK 463

Query: 289 GFEAQIFRIAPH---TILCLTFMEQTMKV 314
           G    + ++ P    + LC   +++ M++
Sbjct: 464 GLVPTLAKVCPAVAISYLCYENLKRAMRL 492

>Kwal_33.15597
          Length = 305

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 60/253 (23%), Positives = 96/253 (37%), Gaps = 46/253 (18%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPM-QALKVIFKNEGIRGLQK 87
           +AG +      +   PI++VKTR+QL+         +Y   M  + K I  +EG   L  
Sbjct: 18  LAGAIGCGTTHSAMVPIDVVKTRIQLE-------PTVYNKGMISSFKQIISSEGAGALLT 70

Query: 88  GLSCAYIYQIGLNGS-RLGFYEPIRSVLNKTFYPAMDPHKVQNV--AVNVVSGATSGIIG 144
           G     +    L GS + G YE    V  K F   +   +  N   ++ + S A +    
Sbjct: 71  GFGPT-LLGYSLQGSFKFGGYE----VFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFA 125

Query: 145 AIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTG 204
            I   PL   + R+        + Q T    +  G S I + EG    Y G    + +  
Sbjct: 126 DIALCPLEATRIRL--------VSQPTFANGLVGGFSRILKEEGLSSFYNGFTPILFK-- 175

Query: 205 AGSSVQLPIYNTAKHFLLKH--------------DLMKEGTGLHLVASTVSGFGVGVVMN 250
                Q+P YN AK  + +                     TGL+L++   +G    +V  
Sbjct: 176 -----QIP-YNIAKFLVFERAAEVYFGMAGPKETLSTSTTTGLNLLSGLTAGLAAAIVSQ 229

Query: 251 PWDVILTRVYNQK 263
           P D +L++V   K
Sbjct: 230 PADTLLSKVNKAK 242

 Score = 35.4 bits (80), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 33/173 (19%), Positives = 70/173 (40%), Gaps = 12/173 (6%)

Query: 150 PLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSV 209
           P+ ++KTR       IQ+    +   + +    I  +EG   L  G    +L      S 
Sbjct: 33  PIDVVKTR-------IQLEPTVYNKGMISSFKQIISSEGAGALLTGFGPTLLGYSLQGSF 85

Query: 210 QLPIYNTAKHFL---LKHD-LMKEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQKGN 265
           +   Y   K      L +D  +     +++ ++ ++ F   + + P +    R+ +Q   
Sbjct: 86  KFGGYEVFKKLFIDTLGYDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLVSQP-T 144

Query: 266 LYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYAV 318
              G +  F + ++ EG+ + Y GF   +F+  P+ I      E+  +V + +
Sbjct: 145 FANGLVGGFSRILKEEGLSSFYNGFTPILFKQIPYNIAKFLVFERAAEVYFGM 197

 Score = 34.7 bits (78), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 59/146 (40%), Gaps = 7/146 (4%)

Query: 76  IFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVV 135
           I K EG+     G +     QI  N ++   +E    V      P           +N++
Sbjct: 156 ILKEEGLSSFYNGFTPILFKQIPYNIAKFLVFERAAEVYFGMAGPKETLSTSTTTGLNLL 215

Query: 136 SGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRG 195
           SG T+G+  AI+  P   + +++     A   GQ T        L  + +  GF G + G
Sbjct: 216 SGLTAGLAAAIVSQPADTLLSKVNKAKKA--PGQST-----IGLLGQLAKELGFVGSFAG 268

Query: 196 VDAAILRTGAGSSVQLPIYNTAKHFL 221
           +   ++  G  +S+Q  IY + K  L
Sbjct: 269 LPTRLVMVGTLTSLQFGIYGSLKKTL 294

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%)

Query: 249 MNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGF 290
           M P DV+ TR+  +     KG +  F + +  EG GAL  GF
Sbjct: 31  MVPIDVVKTRIQLEPTVYNKGMISSFKQIISSEGAGALLTGF 72

>Scas_613.24
          Length = 177

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 73/179 (40%), Gaps = 32/179 (17%)

Query: 126 KVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYR 185
           K    +V++VSG   G+  A+   PL L+KTR+Q +  A          ++W+ +  I  
Sbjct: 4   KSPKTSVHLVSGFIGGLSSAVTLQPLDLLKTRIQQHKGA----------TLWSAIKDIKD 53

Query: 186 AEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFL--------------LKHDLMKEGT 231
              F   +RG   + LRT  GS++ L   N  +  L              L    M E  
Sbjct: 54  PIQF---WRGTLPSALRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYE-- 108

Query: 232 GLHLVASTVSGFGVGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGF 290
             +L+   ++   VG +  P  ++  R Y      YK   +      ++EGI   +KGF
Sbjct: 109 --NLLTGAMARGLVGYITMPITILKVR-YESTYYSYKSMNEAIKDIYKMEGISGFFKGF 164

 Score = 32.0 bits (71), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 7/63 (11%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQ 86
           + + G MA  +   +T PI ++K R +            YK+  +A+K I+K EGI G  
Sbjct: 109 NLLTGAMARGLVGYITMPITILKVRYE-------STYYSYKSMNEAIKDIYKMEGISGFF 161

Query: 87  KGL 89
           KG 
Sbjct: 162 KGF 164

 Score = 30.8 bits (68), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 83/183 (45%), Gaps = 27/183 (14%)

Query: 24  KTGSFIAGGMAACIAVTVT-NPIELVKTRMQL-QGEMSADAQRIYKNPMQALKVIFKNEG 81
           KT   +  G    ++  VT  P++L+KTR+Q  +G     A +  K+P+Q     ++   
Sbjct: 7   KTSVHLVSGFIGGLSSAVTLQPLDLLKTRIQQHKGATLWSAIKDIKDPIQ----FWRGTL 62

Query: 82  IRGLQKGLSCA-YIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATS 140
              L+  +  A Y+  + +  ++L   +   +    +  P +  ++      N+++GA +
Sbjct: 63  PSALRTSIGSALYLSCLNIMRTQLVHGKKGSAASKSSSLPQLTMYE------NLLTGAMA 116

Query: 141 -GIIGAIMGSPLFLIKTRMQS--YSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVD 197
            G++G I   P+ ++K R +S  YS          Y S+   +  IY+ EG  G ++G  
Sbjct: 117 RGLVGYIT-MPITILKVRYESTYYS----------YKSMNEAIKDIYKMEGISGFFKGFG 165

Query: 198 AAI 200
             +
Sbjct: 166 PTV 168

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/231 (22%), Positives = 86/231 (37%), Gaps = 40/231 (17%)

Query: 44  PIELVKTRMQLQGEMSADAQRIYKNPM-QALKVIFKNEGIRGLQKGLSCAYIYQIGLNGS 102
           PI++VKTR+QL+         +Y   M  + + I   EG   L  G     +        
Sbjct: 33  PIDVVKTRIQLE-------PTVYNKGMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQGAF 85

Query: 103 RLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYS 162
           + G YE  +     T     D       +V + S A +  +  I   PL   + R+    
Sbjct: 86  KFGGYEVFKKFFIDTL--GYDTAARYKNSVYIGSAAAAEFLADIALCPLEATRIRL---- 139

Query: 163 NAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLL 222
               + Q T    +  G S I + EG    Y G    + +       Q+P YN AK  + 
Sbjct: 140 ----VSQPTFANGLVGGFSRILKEEGVGSFYSGFTPILFK-------QIP-YNIAKFLVF 187

Query: 223 KH------------DLMKEG--TGLHLVASTVSGFGVGVVMNPWDVILTRV 259
           +             D + +   T ++L++   +G    +V  P D +L++V
Sbjct: 188 ERASELYFSLAPPKDTLSQTSLTAINLLSGLTAGLAAAIVSQPADTLLSKV 238

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 61/146 (41%), Gaps = 7/146 (4%)

Query: 76  IFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVV 135
           I K EG+     G +     QI  N ++   +E    +      P     +    A+N++
Sbjct: 156 ILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFERASELYFSLAPPKDTLSQTSLTAINLL 215

Query: 136 SGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRG 195
           SG T+G+  AI+  P   + +++   S A   GQ T        L  + +  GF G + G
Sbjct: 216 SGLTAGLAAAIVSQPADTLLSKVNKTSKA--PGQST-----VGLLFQLAKQLGFVGSFAG 268

Query: 196 VDAAILRTGAGSSVQLPIYNTAKHFL 221
           +   ++  G  +S+Q  IY   K  L
Sbjct: 269 LPTRLVMVGTLTSLQFGIYGQLKKSL 294

 Score = 35.4 bits (80), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 33/173 (19%), Positives = 70/173 (40%), Gaps = 12/173 (6%)

Query: 150 PLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSV 209
           P+ ++KTR       IQ+    +   +      I   EG   L  G    +L      + 
Sbjct: 33  PIDVVKTR-------IQLEPTVYNKGMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQGAF 85

Query: 210 QLPIYNTAKHFL---LKHDLM-KEGTGLHLVASTVSGFGVGVVMNPWDVILTRVYNQKGN 265
           +   Y   K F    L +D   +    +++ ++  + F   + + P +    R+ +Q   
Sbjct: 86  KFGGYEVFKKFFIDTLGYDTAARYKNSVYIGSAAAAEFLADIALCPLEATRIRLVSQP-T 144

Query: 266 LYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYAV 318
              G +  F + ++ EG+G+ Y GF   +F+  P+ I      E+  ++ +++
Sbjct: 145 FANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFERASELYFSL 197

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 22/42 (52%)

Query: 249 MNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGF 290
           M P DV+ TR+  +     KG +  F K +  EG GAL  GF
Sbjct: 31  MVPIDVVKTRIQLEPTVYNKGMVGSFRKIIAEEGAGALLTGF 72

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 57/127 (44%), Gaps = 7/127 (5%)

Query: 174 TSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKE--GT 231
           T++    + +YR  G +  ++G    ++R    S V+   +   K F  K     E   T
Sbjct: 179 TNVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQFAPKEYQNNEYFAT 238

Query: 232 GLHLVASTVSGFGVGVVMNPWDVILTRVYNQKGN-LYKGPLDCFVKTVRIEGIGALYKGF 290
            L L++S      VG    P DVI TR+  +    LY+  ++C  +    EG   L+KG+
Sbjct: 239 LLGLISSCAV---VGAT-QPLDVIKTRMQAKDSVLLYRNSINCAYRIFVEEGFAMLWKGW 294

Query: 291 EAQIFRI 297
             ++ ++
Sbjct: 295 LPRLMKV 301

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 44/81 (54%), Gaps = 7/81 (8%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           + G +++C  V  T P++++KTRMQ     + D+  +Y+N +     IF  EG   L KG
Sbjct: 239 LLGLISSCAVVGATQPLDVIKTRMQ-----AKDSVLLYRNSINCAYRIFVEEGFAMLWKG 293

Query: 89  LSCAYIYQIGLNGS-RLGFYE 108
                + ++GL+GS   G Y+
Sbjct: 294 W-LPRLMKVGLSGSVSFGIYQ 313

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 69/163 (42%), Gaps = 22/163 (13%)

Query: 63  QRIYKNPMQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAM 122
           +++  N +     +++  G+R   KG     + Q+G +  R   +         T     
Sbjct: 175 EKLPTNVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTF---------TMLKQF 225

Query: 123 DPHKVQNVAVNVVSGATSGIIG--AIMGS--PLFLIKTRMQSYSNAIQIGQQTHYTSIWN 178
            P + QN   N       G+I   A++G+  PL +IKTRMQ+  + +       Y +  N
Sbjct: 226 APKEYQN---NEYFATLLGLISSCAVVGATQPLDVIKTRMQAKDSVLL------YRNSIN 276

Query: 179 GLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFL 221
               I+  EGF  L++G    +++ G   SV   IY   ++ +
Sbjct: 277 CAYRIFVEEGFAMLWKGWLPRLMKVGLSGSVSFGIYQYTENMI 319

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 59/130 (45%), Gaps = 7/130 (5%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           +AGG+A   A T+  P++ +K   Q      A         ++A K I  ++G RG  +G
Sbjct: 24  LAGGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPRGFFQG 83

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMG 148
            S   +        +   YE IRSV+  T+       + ++    ++SG+ +G+    + 
Sbjct: 84  HSATLLRIFPYAAIKFIAYEQIRSVVIPTW-------RHESHWRRLLSGSLAGLCSVFVT 136

Query: 149 SPLFLIKTRM 158
            PL L++ R+
Sbjct: 137 YPLDLVRVRL 146

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           +AGG+A   + T   P E+++ R+Q+   ++   +R +    +  K+I+   G RG   G
Sbjct: 249 VAGGLAGMASQTAAYPFEIIRRRLQVSA-ITDPTRRHFVGINEIAKIIYTEGGWRGFFVG 307

Query: 89  LSCAYI 94
           LS  YI
Sbjct: 308 LSIGYI 313

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 42/73 (57%), Gaps = 7/73 (9%)

Query: 26  GSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQAL----KVIFKNEG 81
              +AGG++  ++ T   P+E+++ R+Q+    +   +++Y +  Q++    ++I++ +G
Sbjct: 251 AELVAGGLSGILSQTAAYPLEIIRRRLQVS---TLSPRKMYDHKFQSISSIARIIYQEKG 307

Query: 82  IRGLQKGLSCAYI 94
            RG   GLS  YI
Sbjct: 308 WRGFFVGLSIGYI 320

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 57/130 (43%), Gaps = 7/130 (5%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           +AGG++   A T+  P++ +K   Q      +          +A K I+ N+GIRG  +G
Sbjct: 23  LAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFFQG 82

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMG 148
            S   +        +   YE IRS+L       +   + ++    + SG+ +G+    + 
Sbjct: 83  HSVTLLRIFPYAAVKFVAYEQIRSIL-------IPSREYESHWRRLASGSLAGLCSVFIT 135

Query: 149 SPLFLIKTRM 158
            PL L + R+
Sbjct: 136 YPLDLTRVRL 145

 Score = 32.0 bits (71), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 42/227 (18%), Positives = 83/227 (36%), Gaps = 44/227 (19%)

Query: 30  AGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGL 89
           +G +A   +V +T P++L + R+    E      R        +K I+      GL   L
Sbjct: 123 SGSLAGLCSVFITYPLDLTRVRLAYVTEHKRVKLR------DIVKTIYHEPASEGLTSHL 176

Query: 90  SCAYIYQIGLNGSR------LGF----------YEPIRSVLNKTFYPAMDPHKVQNVA-- 131
                +    N  R      LG           ++ I  ++  +    M P+ V+ ++  
Sbjct: 177 LVPKWFAHWCNFYRGYVPTVLGMIPYAGVSFFAHDLIHDIMKSSL---MAPYAVKQLSSQ 233

Query: 132 -----------------VNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYT 174
                              +V+G  SGI+      PL +I+ R+Q  + + +      + 
Sbjct: 234 EELERKKLRQKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQ 293

Query: 175 SIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFL 221
           SI +    IY+ +G++G + G+    ++     +    +Y   K  L
Sbjct: 294 SISSIARIIYQEKGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWHL 340

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 7/73 (9%)

Query: 26  GSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALK----VIFKNEG 81
              I+GG+A   + T   P E+++ R+Q+    +   + +Y +  Q++     +IFK  G
Sbjct: 266 AELISGGLAGMASQTAAYPFEIIRRRLQVS---ALSPKTMYDHKFQSISEIAHIIFKERG 322

Query: 82  IRGLQKGLSCAYI 94
           +RG   GLS  YI
Sbjct: 323 VRGFFVGLSIGYI 335

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 58/130 (44%), Gaps = 7/130 (5%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           +AGG++   A T+  P++ +K   Q                ++A K I+ N+G+RG  +G
Sbjct: 38  LAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQG 97

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMG 148
            S   +        +   YE IR+ L       +   + ++    +VSG+ +G+    + 
Sbjct: 98  HSATLLRIFPYAAVKFVAYEQIRNTL-------IPSKEFESHWRRLVSGSLAGLCSVFIT 150

Query: 149 SPLFLIKTRM 158
            PL L++ R+
Sbjct: 151 YPLDLVRVRL 160

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 87/204 (42%), Gaps = 19/204 (9%)

Query: 122 MDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLS 181
           ++P+ V  +A + ++G+  G     +  PL  I T +Q+  N  +   +T        + 
Sbjct: 4   INPNDVDELA-HAIAGSLGGAASIAVTYPLVTITTNLQTKENEARPKLET--------IK 54

Query: 182 SIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYN----TAKHFLLKHDLMKEGTGLHLVA 237
            IY   G  G + G+++A+      + V    Y     TA+    K  L    T   ++A
Sbjct: 55  EIYNKNGIIGYFLGLESAVYGMATTNFVYYYFYEWCAKTARTLTTKQYL---STWESILA 111

Query: 238 STVSGFGVGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRI 297
           ST++G    V  NP  V  TR+   K N     L   +  V+ +G   L  G +  +  +
Sbjct: 112 STIAGSMTAVASNPIWVANTRMTVAKSN--HSTLRTVIDIVKTDGPLTLLNGLKPALVLV 169

Query: 298 APHTILCLTFMEQTMKVVYAVEKQ 321
           + + I+  T  EQ   +V  ++++
Sbjct: 170 S-NPIIQYTVYEQLKNLVLRLQRK 192

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 74/182 (40%), Gaps = 19/182 (10%)

Query: 22  VSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEG 81
           +S   S +A  +A  +    +NPI +  TRM +     +  + +          I K +G
Sbjct: 103 LSTWESILASTIAGSMTAVASNPIWVANTRMTVAKSNHSTLRTVID--------IVKTDG 154

Query: 82  IRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSG 141
              L  GL  A +  +     +   YE +++++ +     +   KV + +   + GA   
Sbjct: 155 PLTLLNGLKPALVL-VSNPIIQYTVYEQLKNLVLR-----LQRKKVLSPSWAFLLGAIGK 208

Query: 142 IIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAIL 201
           +       P   +KTRM    N        H  S+W+ +  I + +G  GLY GV   ++
Sbjct: 209 LAATGTTYPYITLKTRMHLMQN-----DPKHQKSMWSLIVEIVKKDGVSGLYNGVAVKLV 263

Query: 202 RT 203
           ++
Sbjct: 264 QS 265

>Scas_671.1*
          Length = 123

 Score = 39.7 bits (91), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 37/77 (48%), Gaps = 7/77 (9%)

Query: 34  AACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGLSCAY 93
           +A +A  +T P + +KTRMQL+        +++ N    L +I KNE I  L  GLS   
Sbjct: 49  SASLATAITAPFDTIKTRMQLK-------PKVFTNFFTTLVLITKNESIFQLFSGLSMRL 101

Query: 94  IYQIGLNGSRLGFYEPI 110
             +    G   G YE +
Sbjct: 102 TRKALSAGIAWGIYEDL 118

 Score = 28.9 bits (63), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 46/118 (38%), Gaps = 17/118 (14%)

Query: 106 FYEPIRSVLNKTFYPAMDPHKVQNV--------AVNVVSGATSGIIGAIMGSPLFLIKTR 157
            YE  + +L K F P    H  +++         VN VS   S  +   + +P   IKTR
Sbjct: 8   LYEKSKQILPK-FLPKSLIHYKEDMKFSTSTSTVVNSVSAIASASLATAITAPFDTIKTR 66

Query: 158 MQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYN 215
           MQ         +   +T+ +  L  I + E    L+ G+   + R    + +   IY 
Sbjct: 67  MQ--------LKPKVFTNFFTTLVLITKNESIFQLFSGLSMRLTRKALSAGIAWGIYE 116

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 1/69 (1%)

Query: 26  GSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGL 85
              +AGG+A   + T   P E+++ R+Q+ G ++   +  + +  +  K+IF   G RG 
Sbjct: 292 AELLAGGLAGMASQTAAYPFEIIRRRLQV-GAVTNPLEHKFTSMSEMAKIIFHERGWRGF 350

Query: 86  QKGLSCAYI 94
             GLS  YI
Sbjct: 351 FVGLSIGYI 359

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 33/164 (20%), Positives = 65/164 (39%), Gaps = 14/164 (8%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           +AGG+A   A T+  P++ +K   Q            ++  + A   I+  + +RG+ +G
Sbjct: 58  LAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVFQG 117

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMG 148
            S   +        +   YE IR+V+       +   + +     + SG+ +G+      
Sbjct: 118 HSATLLRIFPYAAVKFIAYEQIRNVI-------IPSKEYETHFRRLCSGSLAGLCSVFCT 170

Query: 149 SPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGL 192
            PL LI+ R+   +       + H   +W  +  IY     + L
Sbjct: 171 YPLDLIRVRLAYVT-------EHHKVRVWPLVKQIYSEPASEAL 207

>Scas_717.20
          Length = 356

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 58/134 (43%), Gaps = 7/134 (5%)

Query: 25  TGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRG 84
           T S +AGG++   A T+  P++ +K   Q                 +A K I+ N+GIRG
Sbjct: 33  TRSGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRG 92

Query: 85  LQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIG 144
             +G S   +        +   YE IR+ L       +   + ++    ++SG+ +G+  
Sbjct: 93  FFQGHSVTLMRIFPYAAVKFVAYEQIRNTL-------IPSKEYESHWRRLMSGSLAGLCS 145

Query: 145 AIMGSPLFLIKTRM 158
                PL LI+ R+
Sbjct: 146 VFTTYPLDLIRVRL 159

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 7/73 (9%)

Query: 26  GSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQAL----KVIFKNEG 81
              ++GG+A   + T   P E+++ R+Q+    +    ++Y +  Q++    K+I+K  G
Sbjct: 265 AELLSGGLAGMASQTAAYPFEIIRRRLQVS---TLSVSQMYDHRFQSISEIAKIIYKERG 321

Query: 82  IRGLQKGLSCAYI 94
            RG   GLS  YI
Sbjct: 322 WRGFFVGLSIGYI 334

 Score = 29.3 bits (64), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 39/223 (17%), Positives = 81/223 (36%), Gaps = 32/223 (14%)

Query: 28  FIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADA-----QRIYKNPMQAL---KVIFKN 79
            ++G +A   +V  T P++L++ R+    E    +     + IYK P       K    N
Sbjct: 135 LMSGSLAGLCSVFTTYPLDLIRVRLAYVTEHKRISLLGLVKTIYKEPASTTLEAKGYIPN 194

Query: 80  EGIR--GLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVA------ 131
                    +G +   +  I   G     ++ +  VL    +P + P+ V  ++      
Sbjct: 195 WFAHWCNFYRGYTPTVLGMIPYAGVSFFAHDLLHDVLK---HPILAPYSVLALSESEQEE 251

Query: 132 -------------VNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWN 178
                          ++SG  +G+       P  +I+ R+Q  + ++       + SI  
Sbjct: 252 RHFKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISE 311

Query: 179 GLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFL 221
               IY+  G++G + G+    ++     +    +Y   K  L
Sbjct: 312 IAKIIYKERGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWHL 354

>Scas_696.9
          Length = 312

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 66/154 (42%), Gaps = 28/154 (18%)

Query: 156 TRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYN 215
           TR++S S    +       S WN   SIY  EG +G+Y+GV+A  +R       Q+  + 
Sbjct: 139 TRLKSASAGAPV------QSSWNVFRSIYAKEGLRGIYKGVNAVAIR-------QMTNWG 185

Query: 216 TAKHF-LLKHDLMKEGTG----------LHLVASTVSGFGVGVVMNPWDVILTRVYNQKG 264
           +   F  L  D +++ TG             + +T  G G+     P +VI   + ++K 
Sbjct: 186 SRFGFSRLVEDWVRKATGKTKPEDRLNAWEKIGATAVGGGLSAWNQPIEVIRVEMQSKKE 245

Query: 265 NLYKGPLDCFVKT----VRIEGIGALYKGFEAQI 294
           +  +       KT    ++  G+  LY+G   +I
Sbjct: 246 DPNRPKNLTVAKTFKYIMKTNGVKGLYRGVTPRI 279

>Kwal_26.7972
          Length = 358

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 37/69 (53%), Gaps = 1/69 (1%)

Query: 26  GSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGL 85
              +AGG+A   + T + P E+++ R+Q+   +S  +   ++     +++I+K  G RG 
Sbjct: 260 AELVAGGLAGMASQTASYPFEIIRRRLQV-SVVSPTSIHNFQTIPDMIRIIYKERGWRGF 318

Query: 86  QKGLSCAYI 94
             GLS  YI
Sbjct: 319 FVGLSIGYI 327

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 58/140 (41%), Gaps = 9/140 (6%)

Query: 29  IAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKG 88
           +AGG+A   A T+  P++ +K   Q                ++A   I  ++GIRG  +G
Sbjct: 32  LAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGAHINAHDGIRGFYQG 91

Query: 89  LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHK-VQNVAVNVVSGATSGIIGAIM 147
            S   I        +   YE IR          M P K  +  A  + SG+ +G+    M
Sbjct: 92  HSATLIRIFPYAAIKFIAYEQIRHF--------MIPSKEYETHARRLASGSMAGLCSVFM 143

Query: 148 GSPLFLIKTRMQSYSNAIQI 167
             PL LI+ R+   ++  +I
Sbjct: 144 TYPLDLIRVRLAYVTDRSRI 163

 Score = 32.3 bits (72), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 63/152 (41%), Gaps = 10/152 (6%)

Query: 116 KTFYPAMDPHKVQNVAVNVVSG-ATSGIIGAIMGS-------PLFLIKTRMQSYSNAIQI 167
           KT   +M P K Q+V          SG+ G I GS       PL  IK   Q+ SN   +
Sbjct: 5   KTDDDSMVPSKNQSVDKRSAHYILRSGLAGGIAGSCAKTLIAPLDRIKILFQT-SNPHYL 63

Query: 168 GQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLM 227
                   +    + I   +G +G Y+G  A ++R    ++++   Y   +HF++     
Sbjct: 64  KYSGSTMGLIRAGAHINAHDGIRGFYQGHSATLIRIFPYAAIKFIAYEQIRHFMIPSKEY 123

Query: 228 KEGTGLHLVASTVSGFGVGVVMNPWDVILTRV 259
            E     L + +++G     +  P D+I  R+
Sbjct: 124 -ETHARRLASGSMAGLCSVFMTYPLDLIRVRL 154

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 35/78 (44%), Gaps = 7/78 (8%)

Query: 33  MAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGLSCA 92
           ++A +A TVT P + +KTRMQL+          + N       I KNE +  L  GLS  
Sbjct: 232 LSASLATTVTAPFDTIKTRMQLEPSK-------FTNSFNTFTSIVKNENVLKLFSGLSMR 284

Query: 93  YIYQIGLNGSRLGFYEPI 110
              +    G   G YE +
Sbjct: 285 LARKAFSAGIAWGIYEEL 302

 Score = 35.4 bits (80), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 41/92 (44%), Gaps = 13/92 (14%)

Query: 133 NVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGL 192
           +++ G   G+  A+   PL L+KTR+          QQ    ++W  L  I   +    L
Sbjct: 13  HLIGGFFGGLTSAVALQPLDLLKTRI----------QQDKKATLWKNLKEI---DSPLQL 59

Query: 193 YRGVDAAILRTGAGSSVQLPIYNTAKHFLLKH 224
           +RG   + LRT  GS++ L   N  +  L K 
Sbjct: 60  WRGTLPSALRTSIGSALYLSCLNLMRSSLAKR 91

 Score = 31.2 bits (69), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 67/293 (22%), Positives = 124/293 (42%), Gaps = 48/293 (16%)

Query: 31  GGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKN------PMQALKVIFKNEGIR- 83
           GG+ + +A+    P++L+KTR+Q   + +     ++KN      P+Q  +    +  +R 
Sbjct: 20  GGLTSAVAL---QPLDLLKTRIQQDKKAT-----LWKNLKEIDSPLQLWRGTLPS-ALRT 70

Query: 84  --GLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKT--FYPAMDPHKVQNVAVNVVSGA- 138
             G    LSC  + +  L   R      + S+ N +   Y          +  N+++GA 
Sbjct: 71  SIGSALYLSCLNLMRSSLAKRR----NAVPSLTNDSNIVYNKSSSLPRLTMYENLLTGAF 126

Query: 139 TSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDA 198
             G++G I   P+ +IK R +S           +Y+S+   ++ IY  EG  G +RG  A
Sbjct: 127 ARGLVGYIT-MPITVIKVRYES--------TLYNYSSLKEAITHIYTKEGLFGFFRGFGA 177

Query: 199 AILRTGAGSSVQLPIYNTAKHFL---LKHDLM---KEG-------TGLHLVASTVSGFGV 245
             LR    + + + +Y  +K  L   L    +    EG       T ++  ++ +S    
Sbjct: 178 TCLRDAPYAGLYVLLYEKSKQLLPMVLPSRFIHYNPEGGFTTYTSTTVNTTSAVLSASLA 237

Query: 246 GVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIA 298
             V  P+D I TR+  +    +    + F   V+ E +  L+ G   ++ R A
Sbjct: 238 TTVTAPFDTIKTRMQLEPSK-FTNSFNTFTSIVKNENVLKLFSGLSMRLARKA 289

 Score = 28.9 bits (63), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 34/79 (43%), Gaps = 8/79 (10%)

Query: 136 SGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRG 195
           S   S  +   + +P   IKTRMQ         + + +T+ +N  +SI + E    L+ G
Sbjct: 229 SAVLSASLATTVTAPFDTIKTRMQL--------EPSKFTNSFNTFTSIVKNENVLKLFSG 280

Query: 196 VDAAILRTGAGSSVQLPIY 214
           +   + R    + +   IY
Sbjct: 281 LSMRLARKAFSAGIAWGIY 299

>Kwal_23.2913
          Length = 320

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 65/309 (21%), Positives = 123/309 (39%), Gaps = 45/309 (14%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQL-QGEMSADA-QRIYKNPMQALKVIFKNEGIRG 84
           S  AGG+    AV   +P +L+K R Q  Q   + DA  R+          +  N+ I+G
Sbjct: 31  SLAAGGVGGVCAVLTGHPFDLLKVRCQSNQASGTLDAISRVLHEAKSKSGPLPLNQ-IKG 89

Query: 85  LQKG-----LSCAYIYQIGLNGSRLGFY------EPIRSVLNKTFYPAMDPHKVQNVAVN 133
             +G     L    I+ +   G  +G         P+  +   +    + P     +A+ 
Sbjct: 90  FYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSS--SKLTPLTTSQLAL- 146

Query: 134 VVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLY 193
             +G  S I   ++ +P   +K  +Q+  +           S      ++ R  G + L+
Sbjct: 147 --AGFFSAIPTTLITAPTERVKVVLQTSESG----------SFLGAARTLIREGGVRSLF 194

Query: 194 RGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVASTVSGFGVGVVM---- 249
           +G  A + R G GS++    Y  +K FL ++   ++   L +V+  V+G   G+ M    
Sbjct: 195 QGTLATLARDGPGSALYFASYEVSKRFLSRN---QDTDALSVVSICVAGGVAGMSMWIGV 251

Query: 250 NPWDVILTRV--YNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAP---HTILC 304
            P D I T++   ++  ++ +   + + +     G+   + G    + R  P    T L 
Sbjct: 252 FPIDTIKTKLQSSSRSQSMVQAAREIYTRA----GLRGFFPGLGPALMRSFPANAATFLG 307

Query: 305 LTFMEQTMK 313
           + F  Q  K
Sbjct: 308 VEFTHQLFK 316

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 35/88 (39%)

Query: 114 LNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHY 173
           LN     A + H +++   ++ +G   G+   + G P  L+K R QS   +  +   +  
Sbjct: 12  LNAKIEQASNSHTLRDSFESLAAGGVGGVCAVLTGHPFDLLKVRCQSNQASGTLDAISRV 71

Query: 174 TSIWNGLSSIYRAEGFKGLYRGVDAAIL 201
                  S        KG YRGV   +L
Sbjct: 72  LHEAKSKSGPLPLNQIKGFYRGVIPPLL 99

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 86/237 (36%), Gaps = 44/237 (18%)

Query: 44  PIELVKTRMQLQGEMSADAQRIYKNPM-QALKVIFKNEGIRGLQKGLSCAYIYQIGLNGS 102
           PI++VKTR+QL+         +Y   M  + K I   EG   L  G     +        
Sbjct: 37  PIDVVKTRIQLE-------PTVYNKGMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGAF 89

Query: 103 RLGFYEPIRSVLNKTFYPAM--DPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQS 160
           + G YE    V  K F   +  D       +V + S A +  +  I   PL   + R+  
Sbjct: 90  KFGGYE----VFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIALCPLEATRIRL-- 143

Query: 161 YSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHF 220
                 + Q      +  G S I + EG    Y G    + +       Q+P YN AK  
Sbjct: 144 ------VSQPQFANGLVGGFSRILKEEGIGSFYSGFTPILFK-------QIP-YNIAKFL 189

Query: 221 LL-------------KHDLMKEGTG-LHLVASTVSGFGVGVVMNPWDVILTRVYNQK 263
           +              K  L    T  L+L++   +G    +V  P D +L++V   K
Sbjct: 190 VFERASEFYYGFAGPKEKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLSKVNKTK 246

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 78/202 (38%), Gaps = 14/202 (6%)

Query: 33  MAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGLSCA 92
           MA  +A     P+E  + R+  Q + +          +     I K EGI     G +  
Sbjct: 124 MAEFLADIALCPLEATRIRLVSQPQFA-------NGLVGGFSRILKEEGIGSFYSGFTPI 176

Query: 93  YIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLF 152
              QI  N ++   +E           P           +N++SG T+G+  AI+  P  
Sbjct: 177 LFKQIPYNIAKFLVFERASEFYYGFAGPKEKLSSTSTTLLNLLSGLTAGLAAAIVSQPAD 236

Query: 153 LIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLP 212
            + +++     A   GQ T        L+ + +  GF G + G+   ++  G  +S+Q  
Sbjct: 237 TLLSKVNKTKKA--PGQST-----VGLLAQLAKQLGFFGSFAGLPTRLVMVGTLTSLQFG 289

Query: 213 IYNTAKHFLLKHDLMKEGTGLH 234
           IY + K  L     ++ G G H
Sbjct: 290 IYGSLKSTLGCPPTIEIGGGGH 311

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 43/203 (21%), Positives = 81/203 (39%), Gaps = 16/203 (7%)

Query: 120 PAMDPHKVQNVAVNVVSGATSGIIGAIMGS--PLFLIKTRMQSYSNAIQIGQQTHYTSIW 177
           PA+  + V +     ++GA     G+   S  P+ ++KTR+Q        G    +  I 
Sbjct: 7   PAIPQYSVSDYMKFALAGAIG--CGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSFKQII 64

Query: 178 NGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFL---LKHDLM-KEGTGL 233
            G       EG   L  G    +L      + +   Y   K F    L +D   +    +
Sbjct: 65  AG-------EGAGALLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDNLGYDTASRYKNSV 117

Query: 234 HLVASTVSGFGVGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQ 293
           ++ ++ ++ F   + + P +    R+ +Q      G +  F + ++ EGIG+ Y GF   
Sbjct: 118 YMGSAAMAEFLADIALCPLEATRIRLVSQP-QFANGLVGGFSRILKEEGIGSFYSGFTPI 176

Query: 294 IFRIAPHTILCLTFMEQTMKVVY 316
           +F+  P+ I      E+  +  Y
Sbjct: 177 LFKQIPYNIAKFLVFERASEFYY 199

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 61/302 (20%), Positives = 114/302 (37%), Gaps = 38/302 (12%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRM---QLQGEMSADAQRIYKNPMQALKVIFKNEGIR 83
           SF+AGG+    AV   +P +L+K R    Q    + A    I +   Q    +F N  ++
Sbjct: 38  SFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEAKTQVKGTLFTNS-VK 96

Query: 84  GLQKG-----LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGA 138
           G  KG     L    I+ +   G  +G     + ++  TF           +     +G 
Sbjct: 97  GFYKGVIPPLLGVTPIFAVSFWGYDVG-----KKLV--TFNNKQGGSNELTMGQMAAAGF 149

Query: 139 TSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDA 198
            S I   ++ +P   +K  +Q+ S            S      +I +  G   L++G  A
Sbjct: 150 ISAIPTTLVTAPTERVKVVLQTSSKG----------SFIQAAKTIVKEGGIASLFKGSLA 199

Query: 199 AILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLV-------ASTVSGFGVGVVMNP 251
            + R G GS++    Y  +K++L      ++      V       A  ++G  + + + P
Sbjct: 200 TLARDGPGSALYFASYEISKNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFP 259

Query: 252 WDVILTRVY--NQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFME 309
            D I T++   + + N+     + +++     GI   + G    + R  P        +E
Sbjct: 260 IDTIKTKLQASSTRQNMLSATKEIYLQR---GGIKGFFPGLGPALLRSFPANAATFLGVE 316

Query: 310 QT 311
            T
Sbjct: 317 MT 318

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 71/196 (36%), Gaps = 10/196 (5%)

Query: 120 PAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTH-YTSIWN 178
           P +  + V+    + V+G   G+     G P  LIK R Q+     Q     H  T+I  
Sbjct: 25  PPIKSNPVRENIKSFVAGGVGGVCAVFTGHPFDLIKVRCQNG----QANSTVHAITNIIK 80

Query: 179 GLSSIYRAEGF----KGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLH 234
              +  +   F    KG Y+GV   +L      +V    Y+  K  +  ++       L 
Sbjct: 81  EAKTQVKGTLFTNSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELT 140

Query: 235 LVASTVSGFGVGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIE-GIGALYKGFEAQ 293
           +     +GF   +          RV        KG      KT+  E GI +L+KG  A 
Sbjct: 141 MGQMAAAGFISAIPTTLVTAPTERVKVVLQTSSKGSFIQAAKTIVKEGGIASLFKGSLAT 200

Query: 294 IFRIAPHTILCLTFME 309
           + R  P + L     E
Sbjct: 201 LARDGPGSALYFASYE 216

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 64/281 (22%), Positives = 104/281 (37%), Gaps = 30/281 (10%)

Query: 27  SFIAGGMAACIAVTVTNPIELVKTRMQL-QGEMSADAQRIYKNPMQALKVIFKNEGIRGL 85
           S  AG +    AV   +P +L+K R Q  Q   + DA R      +A   +     +RG 
Sbjct: 50  SLAAGAVGGVCAVLTGHPFDLLKVRCQSNQASGTVDAVRKILVEARAQSGLSAVNMMRGF 109

Query: 86  QKG-----LSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATS 140
            KG     L    I+ +   G  +G          K      D       A    +G  S
Sbjct: 110 YKGVIPPLLGVTPIFAVSFWGYDVG----------KKLVTWNDNSGKLTTAQLATAGFIS 159

Query: 141 GIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAI 200
            I   ++ +P   +K  +Q+ SN           S+ +    I    G + L+RG  A +
Sbjct: 160 AIPTTLVMAPTERVKVVLQTQSN----------HSLGSAAKHILATGGVRSLFRGSLATL 209

Query: 201 LRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHL-VASTVSGFGVGVVMNPWDVILTRV 259
            R G GS++    Y   K +L       E +  ++ +A  ++G  + V + P D I T +
Sbjct: 210 ARDGPGSALYFASYEATKAYLNARSGTNELSIKNVCLAGGMAGVSMWVGVFPIDTIKTEL 269

Query: 260 YNQKGNLYKGPLDCFVKTVRIE-GIGALYKGFEAQIFRIAP 299
             Q  N  +  ++   K      GI   + G    + R  P
Sbjct: 270 --QSSNTRQTMMEATRKIYNTRGGIKGFFPGIGPALLRSFP 308

 Score = 32.7 bits (73), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 69/182 (37%), Gaps = 4/182 (2%)

Query: 131 AVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFK 190
           A ++ +GA  G+   + G P  L+K R QS   +  +             S +      +
Sbjct: 48  AKSLAAGAVGGVCAVLTGHPFDLLKVRCQSNQASGTVDAVRKILVEARAQSGLSAVNMMR 107

Query: 191 GLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHL-VASTVSGFGVGVVM 249
           G Y+GV   +L      +V    Y+  K  +  +D   + T   L  A  +S     +VM
Sbjct: 108 GFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTWNDNSGKLTTAQLATAGFISAIPTTLVM 167

Query: 250 NPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFME 309
            P + +   +  Q  +         + T    G+ +L++G  A + R  P + L     E
Sbjct: 168 APTERVKVVLQTQSNHSLGSAAKHILAT---GGVRSLFRGSLATLARDGPGSALYFASYE 224

Query: 310 QT 311
            T
Sbjct: 225 AT 226

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
           Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 34.7 bits (78), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 52/105 (49%), Gaps = 5/105 (4%)

Query: 120 PAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYS-NAIQIGQQTHYTSIWN 178
           P  DP+ + N+   +  GA SG +   +  P  L++ R Q  +    ++G    Y S+ +
Sbjct: 2   PVTDPN-LANL-YKLAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELG--FRYKSVSD 57

Query: 179 GLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLK 223
            L +I + EG KG Y+G+ A + +    ++V   +Y   +  +++
Sbjct: 58  ALITIGKTEGPKGYYKGLTANLFKVIPSTAVSWLVYEVIREAMVE 102

 Score = 33.9 bits (76), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 37/84 (44%)

Query: 31  GGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNEGIRGLQKGLS 90
           G ++  +A T+  P +L++ R Q+      +    YK+   AL  I K EG +G  KGL+
Sbjct: 17  GAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEGPKGYYKGLT 76

Query: 91  CAYIYQIGLNGSRLGFYEPIRSVL 114
                 I         YE IR  +
Sbjct: 77  ANLFKVIPSTAVSWLVYEVIREAM 100

 Score = 32.3 bits (72), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 34/82 (41%), Gaps = 6/82 (7%)

Query: 234 HLVASTVSGFGVGVVMNPWDVILTRVY------NQKGNLYKGPLDCFVKTVRIEGIGALY 287
            L    +SG     ++ P+D++  R        N+ G  YK   D  +   + EG    Y
Sbjct: 13  KLAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITIGKTEGPKGYY 72

Query: 288 KGFEAQIFRIAPHTILCLTFME 309
           KG  A +F++ P T +     E
Sbjct: 73  KGLTANLFKVIPSTAVSWLVYE 94

>Scas_198.1
          Length = 72

 Score = 33.9 bits (76), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 20/32 (62%)

Query: 27 SFIAGGMAACIAVTVTNPIELVKTRMQLQGEM 58
           F+ GG++A IA T   PIE VK  MQ Q EM
Sbjct: 18 DFLMGGVSAAIAKTGAAPIERVKILMQNQDEM 49

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 35.8 bits (81), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 59/259 (22%), Positives = 94/259 (36%), Gaps = 43/259 (16%)

Query: 22  VSKTGSFIAGGMAACIAV-TVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFKNE 80
           +S    F   G   C A  +   PI++VKTR+QL      +  +     + + + I   E
Sbjct: 12  LSDYAKFALAGAIGCGATHSAMVPIDVVKTRIQL------EPLKYSSGMVGSFRKIVGEE 65

Query: 81  GIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKV--QNVAVNVVSGA 138
           G   L  G     +        + G YE    V  K F  A+           + + S A
Sbjct: 66  GAAALLTGFGPTLLGYSMQGAFKFGGYE----VFKKAFVDALGYETACQYRTPIYIGSAA 121

Query: 139 TSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDA 198
            +     I   PL   + R+        + Q T    +  G + I + EG    Y G   
Sbjct: 122 IAEFFADIALCPLEATRIRL--------VSQPTFANGLVGGFARILKEEGIGSFYNGFTP 173

Query: 199 AILRTGAGSSVQLPIYNTAKHFLLKHDL--------MKE------GTGLHLVASTVSGFG 244
            + +       Q+P YN AK  + +H           KE       TG++L+A   +G  
Sbjct: 174 ILFK-------QIP-YNIAKFVVFEHAANAYFGLAGSKENLSTTAATGINLLAGLTAGLA 225

Query: 245 VGVVMNPWDVILTRVYNQK 263
             V+  P D +L++V   K
Sbjct: 226 AAVISQPADTLLSKVNKTK 244

 Score = 35.4 bits (80), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 18/88 (20%), Positives = 40/88 (45%), Gaps = 1/88 (1%)

Query: 231 TGLHLVASTVSGFGVGVVMNPWDVILTRVYNQKGNLYKGPLDCFVKTVRIEGIGALYKGF 290
           T +++ ++ ++ F   + + P +    R+ +Q      G +  F + ++ EGIG+ Y GF
Sbjct: 113 TPIYIGSAAIAEFFADIALCPLEATRIRLVSQP-TFANGLVGGFARILKEEGIGSFYNGF 171

Query: 291 EAQIFRIAPHTILCLTFMEQTMKVVYAV 318
              +F+  P+ I      E      + +
Sbjct: 172 TPILFKQIPYNIAKFVVFEHAANAYFGL 199

>CAGL0K06545g complement(641129..642667) similar to tr|Q03327
           Saccharomyces cerevisiae YDR470c, hypothetical start
          Length = 512

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 43/95 (45%), Gaps = 6/95 (6%)

Query: 67  KNPMQALKVIFKNEGIRGLQKGLSCAYIYQI---GLNGSRLGFYEPIRSVLNKTFYPAMD 123
           K+ +  +  I   EGI+GL K  +  +IYQI    L     G   P+  + +  F   + 
Sbjct: 234 KHTLDIMNSILDEEGIKGLWKANNTNFIYQILSSTLEAWYTGLISPLLHIPDPYFIDLIH 293

Query: 124 PHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRM 158
               Q+  +  +S    G++ A+   P+ LI+TR 
Sbjct: 294 FPDTQSAVLLTLS---VGVLTALTLIPIDLIRTRF 325

>Sklu_2436.18 YDR470C, Contig c2436 37947-39431 reverse complement
          Length = 494

 Score = 32.3 bits (72), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 44/95 (46%), Gaps = 12/95 (12%)

Query: 70  MQALKVIFKNEGIRGLQKGLSCAYIYQI---GLNGSRLGFYEPIRSVLNKTFYPAM---D 123
           M  +  +   EG RGL +  +  +IY      L+    G   P   + +  F   +   D
Sbjct: 234 MDIMNSVMDEEGTRGLWRANNTTFIYNFLSATLDAWFTGMLSPFLQIPDPYFIDIIHSPD 293

Query: 124 PHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRM 158
           P K  ++A+ + +   +GI  A++  PL LIKTR+
Sbjct: 294 PQK--SIALTLAASVFTGI--ALL--PLDLIKTRL 322

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 32.0 bits (71), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 65/309 (21%), Positives = 114/309 (36%), Gaps = 58/309 (18%)

Query: 29  IAGGMAACIAVTVTNPIELVKT--RMQLQGEM--------------------------SA 60
           + G  A+ +A     P++L KT  + QL+ E                           S 
Sbjct: 7   VIGATASSLANIAVYPLDLAKTLVQTQLKDEFVEAGEEAGEERAGSRRQNRIKPIALRSP 66

Query: 61  DAQRIYKNPMQALKVIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRS---VLNKT 117
            A   YK  + AL+ I+  EG+ GL +GL  + +     + S   +Y  +R     L + 
Sbjct: 67  QAAEQYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHYFRLKQA 126

Query: 118 FYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIW 177
                     + + + +V+ ATS     +  +P+ ++ TR Q+       GQ      + 
Sbjct: 127 RGGDARFSTPEELVLGIVAAATS----QLFVNPINVVATRQQTR------GQAAGAADMR 176

Query: 178 NGLSSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMKEGTGLHLVA 237
                ++   G++G + G+  +++ T    S+    Y   +  L            HLV 
Sbjct: 177 TVAREVHAENGWRGFWAGLKVSLVLT-VNPSITYATYERLREALFP----TPAAASHLVD 231

Query: 238 S-TVSGFGVGVVMNPWDVILTRVYNQKGNLYKGPL----DCFVKTVRI-------EGIGA 285
           S  +   G   VM     I++ V  Q   + K  L     CF    ++       EG  +
Sbjct: 232 SAALLSPGQNFVMGVLSKIVSTVLTQPLIIAKASLQRSGSCFQDFHQVLHHLYSTEGPLS 291

Query: 286 LYKGFEAQI 294
           L+KG   QI
Sbjct: 292 LWKGLGPQI 300

>YDR470C (UGO1) [1287] chr4 complement(1399694..1401202) Protein of
           the mitochondrial outer membrane required for
           mitochondrial fusion, member of the mitochondrial
           carrier family (MCF) of membrane transporters [1509 bp,
           502 aa]
          Length = 502

 Score = 32.0 bits (71), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 44/100 (44%), Gaps = 22/100 (22%)

Query: 70  MQALKVIFKNEGIRGLQKGLSCAYIYQI----------GLNGSRLGFYEP-IRSVLNKTF 118
           +  +  +F  EGIRGL K  +  +IY            GL  S LG  +P    V+N   
Sbjct: 230 IDVINALFDQEGIRGLWKANNTTFIYNFLSLSIDTWFTGLLSSFLGVPDPYFMEVINSP- 288

Query: 119 YPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFLIKTRM 158
                     +++ + +    +G+  +I+  P+ LI+TR+
Sbjct: 289 ----------DISKSFILALGAGVFTSIILLPVDLIRTRL 318

>AFR373W [3565] [Homologous to ScYDR470C (UGO1) - SH]
           complement(1112020..1113423) [1404 bp, 467 aa]
          Length = 467

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 8/93 (8%)

Query: 70  MQALKVIFKNEGIRGLQKGLSCAYIYQI---GLNGSRLGFYEPIRSVLNKTFYPAMDPHK 126
           M  L  +   EG RG+ +  +  +IY      L+    G   P   + +  F   ++   
Sbjct: 209 MDVLNAVMDKEGTRGVWRANNTIFIYNFLSESLDAWFTGLLSPFLQIPDPYFIDIINSPD 268

Query: 127 VQ-NVAVNVVSGATSGIIGAIMGSPLFLIKTRM 158
           VQ +VA+   +   +G++      PL +IKTR+
Sbjct: 269 VQKSVALTFAAAIFTGLVLL----PLDVIKTRL 297

>CAGL0B02860g complement(278007..278657) some similarities with
           tr|Q06485 Saccharomyces cerevisiae YLR356w, start by
           similarity
          Length = 216

 Score = 28.9 bits (63), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 215 NTAKHFLLKHDLMKEGTGLHLVASTVSGF 243
           N +KH L++  L K GTGL++VA+ V G 
Sbjct: 39  NDSKHDLVRTLLCKVGTGLNVVATVVFGL 67

>Kwal_47.19303
          Length = 265

 Score = 28.5 bits (62), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 13/52 (25%), Positives = 26/52 (50%)

Query: 27 SFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFK 78
          +F++G  A+C  +  T  +EL+KT + +     A +   Y N +   K + +
Sbjct: 14 AFLSGNTASCQKLLSTIKLELIKTHLLIPNFTKAQSSETYVNDLDIAKKVLE 65

>YDL135C (RDI1) [733] chr4 complement(218680..219288) Rho GDP
           dissociation inhibitor (rho GDI) with activity towards
           Rho1p [609 bp, 202 aa]
          Length = 202

 Score = 28.5 bits (62), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 55/144 (38%), Gaps = 31/144 (21%)

Query: 40  TVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIFK--NEGIRGLQKGLSCAYIYQI 97
           T  NPI    T  +   E+++   +I +N +  LK++FK  +E I GL+      YI + 
Sbjct: 77  TEPNPITFDLTNEKTIKELASKRYKIKENSIYKLKIVFKVQHEIITGLR---YVQYIKKA 133

Query: 98  GLN----GSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSGATSGIIGAIMGSPLFL 153
           G+        LG Y P  +   K FY    P           S A SG          FL
Sbjct: 134 GIAVDKIDDHLGSYAP--NTKTKPFYEVELPE----------SEAPSG----------FL 171

Query: 154 IKTRMQSYSNAIQIGQQTHYTSIW 177
            +    + S  I   +  H T  W
Sbjct: 172 ARGNYSAVSKFIDDDKTNHLTLNW 195

>YIR002C (MPH1) [2667] chr9 complement(357412..360393) Protein with
           a possible role in DNA mismatch repair, has similarity
           to ATP-dependent RNA helicases [2982 bp, 993 aa]
          Length = 993

 Score = 28.9 bits (63), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 22/35 (62%)

Query: 181 SSIYRAEGFKGLYRGVDAAILRTGAGSSVQLPIYN 215
           ++++ AEG  G  + ++ AI+RTG   +   P++N
Sbjct: 794 NNVFIAEGQNGCQKDLETAIIRTGESLTTLKPLHN 828

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.137    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,841,607
Number of extensions: 352595
Number of successful extensions: 2346
Number of sequences better than 10.0: 218
Number of HSP's gapped: 1311
Number of HSP's successfully gapped: 574
Length of query: 321
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 219
Effective length of database: 13,065,073
Effective search space: 2861250987
Effective search space used: 2861250987
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)