Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.764936235819200.0
Sklu_2430.113893159981e-134
Scas_717.673433148431e-111
ABL022W4333108361e-109
YMR101C (SRT1)3433128281e-109
CAGL0K03355g3423297831e-102
KLLA0B12848g3612957302e-94
Scas_716.563302614533e-53
AER003C2742494432e-52
CAGL0C04279g2742624328e-51
KLLA0E17259g2752474232e-49
Kwal_27.109862852324111e-47
YBR002C (RER2)2862604006e-46
YNL272C (SEC2)75971820.037
AFL176C60472720.59
Scas_40.120382652.5
KLLA0F17435g127186663.6
CAGL0C04851g220150643.9
Kwal_34.1595934679644.9
YFR037C (RSC8)55785645.8
KLLA0E00660g184736646.0
CAGL0J06842g50433646.1
Scas_699.1661661629.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.7649
         (358 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.7649                                                          744   0.0  
Sklu_2430.11 YMR101C, Contig c2430 20248-21417                        389   e-134
Scas_717.67                                                           329   e-111
ABL022W [570] [Homologous to ScYMR101C (SRT1) - SH] complement(3...   326   e-109
YMR101C (SRT1) [4059] chr13 complement(468444..469475) cis-Preny...   323   e-109
CAGL0K03355g complement(304962..305990) similar to sp|Q03175 Sac...   306   e-102
KLLA0B12848g 1122397..1123482 similar to sp|Q03175 Saccharomyces...   285   2e-94
Scas_716.56                                                           179   3e-53
AER003C [2508] [Homologous to ScYBR002C (RER2) - SH] (638834..63...   175   2e-52
CAGL0C04279g 416100..416924 similar to sp|P35196 Saccharomyces c...   171   8e-51
KLLA0E17259g 1530035..1530862 similar to sp|P35196 Saccharomyces...   167   2e-49
Kwal_27.10986                                                         162   1e-47
YBR002C (RER2) [195] chr2 complement(241672..242532) Cis-prenylt...   158   6e-46
YNL272C (SEC2) [4337] chr14 complement(126803..129082) Guanine n...    36   0.037
AFL176C [3019] [Homologous to ScYNR006W (VPS27) - SH] (106401..1...    32   0.59 
Scas_40.1                                                              30   2.5  
KLLA0F17435g complement(1596081..1599896) similar to sp|Q04217 S...    30   3.6  
CAGL0C04851g complement(452035..452697) similar to sp|P47149 Sac...    29   3.9  
Kwal_34.15959                                                          29   4.9  
YFR037C (RSC8) [1719] chr6 complement(227500..229173) Component ...    29   5.8  
KLLA0E00660g 69141..74684 gi|5531274|emb|CAB50899.1 Kluyveromyce...    29   6.0  
CAGL0J06842g complement(655102..656616) highly similar to tr|Q02...    29   6.1  
Scas_699.16                                                            28   9.6  

>Kwal_26.7649
          Length = 362

 Score =  744 bits (1920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/358 (100%), Positives = 358/358 (100%)

Query: 1   MIKTMGSKSRVEMVEKELEQSKERLKPKKPAFPNLLNRSSVKEYVHAQKLRIWSFVLNMA 60
           MIKTMGSKSRVEMVEKELEQSKERLKPKKPAFPNLLNRSSVKEYVHAQKLRIWSFVLNMA
Sbjct: 1   MIKTMGSKSRVEMVEKELEQSKERLKPKKPAFPNLLNRSSVKEYVHAQKLRIWSFVLNMA 60

Query: 61  IVRWILIQIQMILTNILRVGPLPPHVSFIMDGNRRYAKSLSVPIKAGHEAGALTLLNLLV 120
           IVRWILIQIQMILTNILRVGPLPPHVSFIMDGNRRYAKSLSVPIKAGHEAGALTLLNLLV
Sbjct: 61  IVRWILIQIQMILTNILRVGPLPPHVSFIMDGNRRYAKSLSVPIKAGHEAGALTLLNLLV 120

Query: 121 TCRNLGIKTVSAYAFSIENFNRPQEEVDTLTGLLAEKLDEVARRACDRESELYGLRLRVV 180
           TCRNLGIKTVSAYAFSIENFNRPQEEVDTLTGLLAEKLDEVARRACDRESELYGLRLRVV
Sbjct: 121 TCRNLGIKTVSAYAFSIENFNRPQEEVDTLTGLLAEKLDEVARRACDRESELYGLRLRVV 180

Query: 181 GERSRISKSLNDRISRVERLTDEGDIMTLYICFPYTSRNDIYHAIYNCAESCKYLNSPVS 240
           GERSRISKSLNDRISRVERLTDEGDIMTLYICFPYTSRNDIYHAIYNCAESCKYLNSPVS
Sbjct: 181 GERSRISKSLNDRISRVERLTDEGDIMTLYICFPYTSRNDIYHAIYNCAESCKYLNSPVS 240

Query: 241 DIDETYLTNNMFMKEQSNKCDLLIRTSGHTRLSDYMLWQAHENGVIEFSNTLWPDFDFFE 300
           DIDETYLTNNMFMKEQSNKCDLLIRTSGHTRLSDYMLWQAHENGVIEFSNTLWPDFDFFE
Sbjct: 241 DIDETYLTNNMFMKEQSNKCDLLIRTSGHTRLSDYMLWQAHENGVIEFSNTLWPDFDFFE 300

Query: 301 FFKMLLKWSFFTSVRRKQLNNVSLRSQTLSFFKRTLFPFKRKQVSYEDLPEPPQAVSV 358
           FFKMLLKWSFFTSVRRKQLNNVSLRSQTLSFFKRTLFPFKRKQVSYEDLPEPPQAVSV
Sbjct: 301 FFKMLLKWSFFTSVRRKQLNNVSLRSQTLSFFKRTLFPFKRKQVSYEDLPEPPQAVSV 358

>Sklu_2430.11 YMR101C, Contig c2430 20248-21417
          Length = 389

 Score =  389 bits (998), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 185/315 (58%), Positives = 229/315 (72%), Gaps = 5/315 (1%)

Query: 28  KKPAFPNLLNRSSVKEYVHAQKLRIWSFVLNMAIVRWILIQIQMILTNILRVGPLPPHVS 87
           K P  PN+  R  VK Y+  QK + + ++L++ ++ W++  +Q  L +ILR GPLP H+S
Sbjct: 49  KGPQLPNIWKREDVKCYLDHQKKQTYQYLLSLPLISWLITLLQDFLLDILRAGPLPNHIS 108

Query: 88  FIMDGNRRYAKSLSVPIKAGHEAGALTLLNLLVTCRNLGIKTVSAYAFSIENFNRPQEEV 147
           FIMDGNRRYAKSL +PI  GHEAGA+TLL +L  C+ LGIKT SAYAFSIENFNRP+EEV
Sbjct: 109 FIMDGNRRYAKSLGMPIIKGHEAGAITLLRMLYNCKKLGIKTTSAYAFSIENFNRPKEEV 168

Query: 148 DTLTGLLAEKLDEVARRACDRESELYGLRLRVVGERSRISKSLNDRISRVERLT-----D 202
           DTLT LLAEKLDE+A +A D + ELYG   +VVG+RS IS+ LND+I+ VER+T     D
Sbjct: 169 DTLTRLLAEKLDEIAVKAQDVKDELYGSSFKVVGDRSLISRELNDKITNVERMTAVNDVD 228

Query: 203 EGDIMTLYICFPYTSRNDIYHAIYNCAESCKYLNSPVSDIDETYLTNNMFMKEQSNKCDL 262
           E     LYICFPYTSRNDIYHA+YN  E  KY       I    LT+ M+  E SNKCDL
Sbjct: 229 EEKTSLLYICFPYTSRNDIYHAMYNTVERVKYHGMSTESISVESLTDAMYFDEFSNKCDL 288

Query: 263 LIRTSGHTRLSDYMLWQAHENGVIEFSNTLWPDFDFFEFFKMLLKWSFFTSVRRKQLNNV 322
           LIRTSGHTRLSDYMLWQ+HENG+IEFS TLWP + F EF+ +L++WSFFTS++R Q +  
Sbjct: 289 LIRTSGHTRLSDYMLWQSHENGMIEFSTTLWPSYTFLEFYLVLVRWSFFTSLQRFQTSGF 348

Query: 323 SLRSQTLSFFKRTLF 337
           S R Q  +F +  LF
Sbjct: 349 SARGQMFNFVREALF 363

>Scas_717.67
          Length = 343

 Score =  329 bits (843), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 158/314 (50%), Positives = 210/314 (66%), Gaps = 3/314 (0%)

Query: 45  VHAQKLRIWSFVLNMAIVRWILIQIQMILTNILRVGPLPPHVSFIMDGNRRYAKSLSVPI 104
           +H  K  + +F+ ++ I  W   + Q++L  IL V  +P HVSFIMDGNRRYAKS ++P+
Sbjct: 28  IHNVKQHLTNFLFSLPIFVWFHKKTQLLLIKILSVAQVPEHVSFIMDGNRRYAKSRNLPL 87

Query: 105 KAGHEAGALTLLNLLVTCRNLGIKTVSAYAFSIENFNRPQEEVDTLTGLLAEKLDEVARR 164
             GHEAG +TLL L   C+ +G+K VSAYAFSIENFNR +EEVDTL  L + KLDE A+R
Sbjct: 88  NKGHEAGGVTLLTLAYICKKIGVKCVSAYAFSIENFNRSKEEVDTLMELFSAKLDEFAKR 147

Query: 165 ACDRESELYGLRLRVVGERSRISKSLNDRISRVERLTDEGDIMTLYICFPYTSRNDIYHA 224
           A D    LYG RL+VVG+ S ISK L D+I +VE+LT +G   T Y+CFPYT+RNDIYH 
Sbjct: 148 AIDYRDPLYGSRLKVVGDHSLISKELRDKIYKVEQLTTDGSDFTFYVCFPYTARNDIYHT 207

Query: 225 IYNCAESCKYLNSPVSDIDETYLTNNMFMKEQSNKCDLLIRTSGHTRLSDYMLWQAHENG 284
           +YN   + +       ++     T+ M+++E SNKCDLLIRTSGH R SDYMLWQ HENG
Sbjct: 208 MYNFIANPEPEKEKSEELTIEKFTSQMYLREFSNKCDLLIRTSGHNRFSDYMLWQTHENG 267

Query: 285 VIEFSNTLWPDFDFFEFFKMLLKWSFFTSVRRKQLNNVSLRSQTLSFFKRTLFPFKRKQV 344
            IEF NT WPDF F   + ++LKWSFF ++++    N SL++    +++      + +  
Sbjct: 268 TIEFCNTFWPDFGFMGMYMIILKWSFFKTIQKFNEMNFSLKT---IWYEGPNSKIQNRYT 324

Query: 345 SYEDLPEPPQAVSV 358
             E+LPEPP  VSV
Sbjct: 325 KLEELPEPPVHVSV 338

>ABL022W [570] [Homologous to ScYMR101C (SRT1) - SH]
           complement(356930..358231) [1302 bp, 433 aa]
          Length = 433

 Score =  326 bits (836), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 157/310 (50%), Positives = 213/310 (68%), Gaps = 6/310 (1%)

Query: 51  RIWSFVLNMAIVRWILIQIQMILTNILRVGPLPPHVSFIMDGNRRYAKSLSVPIKAGHEA 110
           +I   +    ++R ++  +Q +L  IL++GPLP HVSFIMDGNRRYAKS+++P+K GHEA
Sbjct: 125 KISHILFQFGLLRMVVNFVQNLLLKILQMGPLPQHVSFIMDGNRRYAKSMNLPLKLGHEA 184

Query: 111 GALTLLNLLVTCRNLGIKTVSAYAFSIENFNRPQEEVDTLTGLLAEKLDEVARRACDRES 170
           G++ L+  L TC+  GI+ VSAYAFSIENFNRP+EE+DTLT +L+ +L + A RA + + 
Sbjct: 185 GSVALMRTLHTCKRAGIEAVSAYAFSIENFNRPKEEIDTLTEMLSRRLQDFANRATNLKD 244

Query: 171 ELYGLRLRVVGERSRISKSLNDRISRVERLTDEGDIMTLYICFPYTSRNDIYHAIYNCAE 230
            +YG RL VVG+R+ +S  LND+I+ +E +T      T+YIC PYT+RNDIYHA+++   
Sbjct: 245 RMYGARLLVVGDRALLSPELNDKITYIEDMTKHNTAFTVYICLPYTTRNDIYHAMFDLVR 304

Query: 231 SCKYLNSPVSDIDETYLTNNMFMKEQSNKCDLLIRTSGHTRLSDYMLWQAHENGVIEFSN 290
            C+       DI    LTN M++   SN+ D+L+RTSGHTRLSDYMLWQ HE   IEFSN
Sbjct: 305 LCQAGALDSKDISTEMLTNAMYLGANSNRADILVRTSGHTRLSDYMLWQVHEQSYIEFSN 364

Query: 291 TLWPDFDFFEFFKMLLKWSFFTSVR--RKQLNNVSLRSQTLSFFKRTLFPFKRKQVSYED 348
            +WPDF F  FF +LLKWSF T++   RKQ     LR + L  + R+L   + + V  E 
Sbjct: 365 CMWPDFTFRTFFTILLKWSFVTALHEARKQ---ERLRRK-LGTYARSLLARRARPVRLEA 420

Query: 349 LPEPPQAVSV 358
           LP PPQA+SV
Sbjct: 421 LPPPPQAISV 430

>YMR101C (SRT1) [4059] chr13 complement(468444..469475)
           cis-Prenyltransferase (dehydrodolichyl diphosphate
           synthetase), synthesizes long-chain polyprenol compounds
           [1032 bp, 343 aa]
          Length = 343

 Score =  323 bits (828), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 165/312 (52%), Positives = 216/312 (69%), Gaps = 11/312 (3%)

Query: 51  RIWSFVLNMAIVRWILIQIQMILTNILRVGPLPPHVSFIMDGNRRYAKSLSVPIKAGHEA 110
           R++++V+++++  W  + +Q IL   LRVGP+P HVSFIMDGNRRYAKS  +P+K GHEA
Sbjct: 35  RVFAWVMSLSLFSWFYVNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEA 94

Query: 111 GALTLLNLLVTCRNLGIKTVSAYAFSIENFNRPQEEVDTLTGLLAEKLDEVARRACDRES 170
           G LTLL LL  C+ LG+K VSAYAFSIENFNRP+EEVDTL  L   KLDE A+RA D + 
Sbjct: 95  GGLTLLTLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAKDYKD 154

Query: 171 ELYGLRLRVVGERSRISKSLNDRISRVERLTDEGDIMTLYICFPYTSRNDIYHAIYNCAE 230
            LYG ++R+VG++S +S  +  +I +VE +T +GD  TL+ICFPYTSRND+ H I +  E
Sbjct: 155 PLYGSKIRIVGDQSLLSPEMRKKIKKVEEITQDGDDFTLFICFPYTSRNDMLHTIRDSVE 214

Query: 231 SCKYLNSPVSDIDETYLTNNMFMKEQSNKCDLLIRTSGHTRLSDYMLWQAHENGVIEFSN 290
                 SP  +I +   TN M+M   SNKC+LLIRTSGH RLSDYMLWQ HEN  IEFS+
Sbjct: 215 DHLENKSPRINIRK--FTNKMYMGFHSNKCELLIRTSGHRRLSDYMLWQVHENATIEFSD 272

Query: 291 TLWPDFDFFEFFKMLLKWSFFTSVRRKQLNNVSL----RSQTLSFFKRTLFPFKRKQVSY 346
           TLWP+F FF  + M+LKWSFF+++++    N SL         S FK+     K+  +S 
Sbjct: 273 TLWPNFSFFAMYLMILKWSFFSTIQKYNEKNHSLFEKIHESVPSIFKK-----KKTAMSL 327

Query: 347 EDLPEPPQAVSV 358
            + P PP +VSV
Sbjct: 328 YNFPNPPISVSV 339

>CAGL0K03355g complement(304962..305990) similar to sp|Q03175
           Saccharomyces cerevisiae YMR101c, hypothetical start
          Length = 342

 Score =  306 bits (783), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 155/329 (47%), Positives = 214/329 (65%), Gaps = 13/329 (3%)

Query: 36  LNRSSVKEYVHAQKLRIWSFVLNMAIVRWILIQIQMILTNILRVGPLPPHVSFIMDGNRR 95
           +  SSV +++      ++ +  +   +  I   IQ +L   LR GP+P HV+FIMDGNRR
Sbjct: 18  IGSSSVTKFISDYATVLFYYCKSFYYINVITTSIQKMLIFALRTGPVPAHVAFIMDGNRR 77

Query: 96  YAKSLSVPIKAGHEAGALTLLNLLVTCRNLGIKTVSAYAFSIENFNRPQEEVDTLTGLLA 155
           +AKS  +P++ GHEAG  TLL L+  C+ LG+K +SAYAFSIENFNRP+EEV+TL  L  
Sbjct: 78  FAKSKDIPLRKGHEAGGETLLTLVYICKTLGVKCISAYAFSIENFNRPREEVETLMNLFG 137

Query: 156 EKLDEVARRACDRESELYGLRLRVVGERSRISKSLNDRISRVERLTDEGDIMTLYICFPY 215
           +KLDE A++A D +  LYG  LR+VG+RS IS  L +RI  VE+LT+  +   LYICFPY
Sbjct: 138 DKLDEFAQKANDYKDPLYGSSLRIVGDRSLISPELRERIENVEKLTENSEKFILYICFPY 197

Query: 216 TSRNDIYHAIYNCAESCKYLNSPVSD----IDETYLTNNMFMKEQSNKCDLLIRTSGHTR 271
           TSRNDI+  +    +  KY+ S + D    I+E   T +M  KE S+ CD+LIRTSGH R
Sbjct: 198 TSRNDIFQTVTKVTD--KYVQSNIIDSNLSINE--FTKSMHFKEYSDNCDILIRTSGHKR 253

Query: 272 LSDYMLWQAHENGVIEFSNTLWPDFDFFEFFKMLLKWSFFTSVRRKQLNNVSLRSQTLSF 331
           LSD+MLWQ +E+  +EFS +LWP F+FF+ + ++L+WS F   +   +NNVS  S+   F
Sbjct: 254 LSDFMLWQVNEHATMEFSTSLWPQFNFFQMYLIILRWSMFKMFQIYNMNNVSKHSK---F 310

Query: 332 FKRTLFPFKR--KQVSYEDLPEPPQAVSV 358
             +   P+K   K +  E LP+PP AV V
Sbjct: 311 GSKLYKPYKTILKYIFSERLPDPPMAVPV 339

>KLLA0B12848g 1122397..1123482 similar to sp|Q03175 Saccharomyces
           cerevisiae YMR101c SRT1 cis-prenyltransferase homologue,
           start by similarity
          Length = 361

 Score =  285 bits (730), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 148/295 (50%), Positives = 197/295 (66%), Gaps = 8/295 (2%)

Query: 69  IQMILTNILRVGPLPPHVSFIMDGNRRYAKSLSVPIKAGHEAGALTLLNLLVTCRNLGIK 128
           +QM +  ILR+GP+P H+SFIMDGNRRYAK L  P+K GH AG  TL+++L  CR L + 
Sbjct: 67  LQMFMVRILRMGPVPRHLSFIMDGNRRYAKKLDQPVKEGHRAGGATLIDILHICRRLNVS 126

Query: 129 TVSAYAFSIENFNRPQEEVDTLTGLLAEKLDEVARRACDRESELYGLRLRVVGERSRISK 188
           +VSAYAFSIENFNR  +EV TL  LL   +D+   RA + + ELYG+RLRVVG+ S +S+
Sbjct: 127 SVSAYAFSIENFNRSPQEVATLMELLGYYIDQFTERATNAKDELYGIRLRVVGDLSLLSE 186

Query: 189 SLNDRISRVERLTDEGDIMTLYICFPYTSRNDIYHAIYNCAESCKYLNSPVSDIDETYLT 248
            L  +I   E+LT +G    LY+  PYTSRNDI H++    + C  +NS   DI E  LT
Sbjct: 187 ELLKKIRNAEKLTRDGQEFVLYLALPYTSRNDIAHSMQVTTDKC--INSN-EDITEQALT 243

Query: 249 NNMFMKEQSNKCDLLIRTSGHTRLSDYMLWQAHENGVIEFSNTLWPDFDFFEFFKMLLKW 308
           +NM+ ++ SNKCDLLIRTSGHTRLSDYMLWQ HE  +IEF + LWPDF+F+  + ++LKW
Sbjct: 244 DNMYFEQYSNKCDLLIRTSGHTRLSDYMLWQVHEGSIIEFVDCLWPDFNFWRLYWIMLKW 303

Query: 309 SFFTSVRRKQLNNVSLRSQTLSFFK-RTLFPF----KRKQVSYEDLPEPPQAVSV 358
           SF+ + +        +R++T  F K     P     + K+V+ + LP  P AVSV
Sbjct: 304 SFYQTWQNASQLPDPVRTRTRVFPKISGALPIETLKRTKRVALDSLPAAPLAVSV 358

>Scas_716.56
          Length = 330

 Score =  179 bits (453), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 102/261 (39%), Positives = 147/261 (56%), Gaps = 8/261 (3%)

Query: 69  IQMILTNILRVG-PLPPHVSFIMDGNRRYAKSLSVPIKAGHEAGALTLLNLLVTCRNLGI 127
           I+ I +  +RV   +P HV FIMDGNRRYA+   + +K GHEAG  T+  +L  C   G+
Sbjct: 53  IKNIFSRTIRVSRNVPRHVGFIMDGNRRYARRNHLQVKEGHEAGFFTMSKILELCYESGV 112

Query: 128 KTVSAYAFSIENFNRPQEEVDTLTGLLAEKLDEVARRACDRESELYGLRLRVVGERSRIS 187
           +  + YAFSIENF R   EVD L  L  +++ ++   A    +E YG+++R++G+ S + 
Sbjct: 113 ECATVYAFSIENFKRSPHEVDALMKLAKDRIRQIV--ASGEMAEKYGIKVRIIGDLSLLD 170

Query: 188 KSLNDRISRVERLTDEGDIMTLYICFPYTSRNDIYHAIYNCAESCKY-LNSPVSDIDETY 246
           K L D ++    +T       L ICFPYT R +I H++ N  E  +   + P   IDE  
Sbjct: 171 KELRDDMNNAMEITKNNKRAVLNICFPYTGREEIVHSMQNVVELAQANSDDPKFIIDEQL 230

Query: 247 LTNNMFMKEQSNKCDLLIRTSGHTRLSDYMLWQAHENGV-IEFSNTLWPDFDFFEFFKML 305
           +  N++  +Q    DLLIRTSG  RLSD+M+WQ    GV IE  + LWPDF       +L
Sbjct: 231 INANLYTGDQP-PLDLLIRTSGMVRLSDFMVWQVSNKGVAIELIDCLWPDFGPLRMAWIL 289

Query: 306 LKWSFFTSV--RRKQLNNVSL 324
           LK+ F  S   R K++ +  L
Sbjct: 290 LKFVFQKSFSNRNKKMEDEDL 310

>AER003C [2508] [Homologous to ScYBR002C (RER2) - SH]
           (638834..639658) [825 bp, 274 aa]
          Length = 274

 Score =  175 bits (443), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 149/249 (59%), Gaps = 8/249 (3%)

Query: 64  WILIQIQMILTNILRV-GPLPPHVSFIMDGNRRYAKSLSVPIKAGHEAGALTLLNLLVTC 122
           W++ +++ +  ++LR  G +P HV FIMDGNRRYAK  ++ ++ GH AG +++  +L  C
Sbjct: 12  WLISRLKDVFVSVLRSSGRVPKHVGFIMDGNRRYAKKHNIEVREGHSAGFMSMNKVLELC 71

Query: 123 RNLGIKTVSAYAFSIENFNRPQEEVDTLTGLLAEKLDEVARRACDRESELYGLRLRVVGE 182
              G+ T + +AFS++NF R   EVD+L  L  E++ ++ +      +E YG+ +R++G+
Sbjct: 72  YESGVTTATVFAFSVDNFRRSAFEVDSLMELAKERVMQITQHG--ELAEQYGIHVRIIGD 129

Query: 183 RSRISKSLNDRISRVERLTDEGDIMTLYICFPYTSRNDIYHAIYNCAESCKYLNSPVSDI 242
           RS +   + + ++R E+ T+      L +C PYT+R +I HA+       +   +P+++ 
Sbjct: 130 RSLLPADVQEEMARAEKATEANTRAVLNVCIPYTARGEILHAMKGTIADAQSDGAPITEA 189

Query: 243 DETYLTNNMFMKEQSNKCDLLIRTSGHTRLSDYMLWQAHENG-VIEFSNTLWPDFDFFEF 301
           D   L  +M+        DLLIRTSG +RLSD++LWQ  + G VIE  + LWPDF     
Sbjct: 190 D---LDAHMYTGGLP-PLDLLIRTSGVSRLSDFLLWQVCQKGVVIELLSCLWPDFGPLTM 245

Query: 302 FKMLLKWSF 310
             +LL+++F
Sbjct: 246 AWILLRYAF 254

>CAGL0C04279g 416100..416924 similar to sp|P35196 Saccharomyces
           cerevisiae YBR002c RER2, hypothetical start
          Length = 274

 Score =  171 bits (432), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 103/262 (39%), Positives = 147/262 (56%), Gaps = 15/262 (5%)

Query: 59  MAIVRWILIQIQMILTNILRVGPLPPHVSFIMDGNRRYAKSLSVPIKAGHEAGALTLLNL 118
           MA++   LI   + ++N +     P H+ FIMDGNRRYAK   +  K GHEAG  ++  +
Sbjct: 9   MAVLAKNLISRTLSVSNCV-----PRHIGFIMDGNRRYAKKKQMESKEGHEAGFRSMSKI 63

Query: 119 LVTCRNLGIKTVSAYAFSIENFNRPQEEVDTLTGLLAEKLDEVARRACDRESELYGLRLR 178
           L  C   G+ T + +AFSIENF R   EVD +  L  E++ ++  R     ++ YG+R+R
Sbjct: 64  LELCYEAGVDTATVFAFSIENFKRSAYEVDAIMSLARERIRQI--REHGELAQKYGVRIR 121

Query: 179 VVGERSRISKSLNDRISRVERLTDEGDIMTLYICFPYTSRNDIYHAIYNCAESCKYLNSP 238
           V+G+ S + K L   I     LT      TL IC PYT R +IYH++    +   Y +  
Sbjct: 122 VIGDISLLDKDLLKEIKNTMELTRNNTRATLNICMPYTGREEIYHSMKTVLDDDSYSSKN 181

Query: 239 VSDIDETYLTNNMFMKEQSNKCDLLIRTSGHTRLSDYMLWQAHENGV-IEFSNTLWPDFD 297
           +S   E  +  +++   Q    DLLIRTSG TRLSD+MLWQ   N V IEF + LWP+F 
Sbjct: 182 IS---EEIIDEHLYTAGQP-PLDLLIRTSGVTRLSDFMLWQTCSNDVMIEFIDCLWPEFG 237

Query: 298 FFEFFKMLLKWSF---FTSVRR 316
            F    +LLK++F   F+S R+
Sbjct: 238 PFRMAWILLKFAFHKNFSSGRK 259

>KLLA0E17259g 1530035..1530862 similar to sp|P35196 Saccharomyces
           cerevisiae YBR002c RER2 cis-prenyltransferase, a key
           enzyme in dolichol synthesis, start by similarity
          Length = 275

 Score =  167 bits (423), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 88/247 (35%), Positives = 142/247 (57%), Gaps = 8/247 (3%)

Query: 69  IQMILTNILRV----GPLPPHVSFIMDGNRRYAKSLSVPIKAGHEAGALTLLNLLVTCRN 124
           ++M+ T + +V      +P HV+FIMDGNRR+AK  ++ +  GH AG  ++  +L  C  
Sbjct: 14  LEMVKTTLAKVIRSSDKVPQHVAFIMDGNRRFAKKNNMEVNEGHNAGFESMCRILELCYE 73

Query: 125 LGIKTVSAYAFSIENFNRPQEEVDTLTGLLAEKLDEVARRACDRESELYGLRLRVVGERS 184
            G+K  + +AFSIENF R   EV+ L  L  +K+ ++++      +E YG++++++G+RS
Sbjct: 74  SGMKVATVFAFSIENFKRSTFEVNWLMELAKDKIKQISQHG--ELAEQYGIKVQIIGDRS 131

Query: 185 RISKSLNDRISRVERLTDEGDIMTLYICFPYTSRNDIYHAIYNCAESCKYLNSPVSDIDE 244
            +   +   +   E +T       L ICFPYT R +I H+I    +          DIDE
Sbjct: 132 LLPADVLKEVELAEEITMNNSRAVLNICFPYTGREEIVHSIQGIMKETAMGEIDYRDIDE 191

Query: 245 TYLTNNMFMKEQSNKCDLLIRTSGHTRLSDYMLWQAHENG-VIEFSNTLWPDFDFFEFFK 303
             + ++++ + Q    +LLIRTSG TRLSD++LWQ    G  IE  + LWP+F  F   K
Sbjct: 192 QTIEDHLYTQGQP-PVELLIRTSGVTRLSDFLLWQLSNRGCTIELVDCLWPEFTPFSMLK 250

Query: 304 MLLKWSF 310
           +L+K++F
Sbjct: 251 ILIKFAF 257

>Kwal_27.10986
          Length = 285

 Score =  162 bits (411), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 132/232 (56%), Gaps = 4/232 (1%)

Query: 80  GPLPPHVSFIMDGNRRYAKSLSVPIKAGHEAGALTLLNLLVTCRNLGIKTVSAYAFSIEN 139
           G +P HV  IMDGNRR+AK   V IK GH AG  ++   L  C   G+ T + +AFSIEN
Sbjct: 29  GNVPRHVGLIMDGNRRWAKLKHVEIKEGHNAGFHSMSRALELCYEAGVSTATVFAFSIEN 88

Query: 140 FNRPQEEVDTLTGLLAEKLDEVARRACDRESELYGLRLRVVGERSRISKSLNDRISRVER 199
           F R   EV++L  L    + +V +      +E +G+++ V+G+RS +   +   +   E 
Sbjct: 89  FKRSSAEVESLMNLARSGIRQVVQNG--EMAEKFGIKINVIGDRSLLPADVLREVETAEE 146

Query: 200 LTDEGDIMTLYICFPYTSRNDIYHAIYNCAESCKYLNSPVSDIDETYLTNNMFMKEQSNK 259
           +T       L ICFPYT R+++ H+I       +  N   SDI+E  +   ++    S  
Sbjct: 147 ITKANTRAVLNICFPYTGRDELLHSIRGVVNEAQCGNLNTSDINEATIDKFLYTG-GSPP 205

Query: 260 CDLLIRTSGHTRLSDYMLWQ-AHENGVIEFSNTLWPDFDFFEFFKMLLKWSF 310
            DLLIRTSG TRLSD+++WQ + ++ VIEF + LWPDF   +   +LL+++F
Sbjct: 206 VDLLIRTSGVTRLSDFLIWQVSRKDVVIEFLDCLWPDFGSRQMAWLLLRFAF 257

>YBR002C (RER2) [195] chr2 complement(241672..242532)
           Cis-prenyltransferase (dehydrodolichyl diphosphate
           synthetase), involved in dolichol synthesis [861 bp, 286
           aa]
          Length = 286

 Score =  158 bits (400), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 98/260 (37%), Positives = 146/260 (56%), Gaps = 15/260 (5%)

Query: 64  WILIQIQMILTNILRVGP-LPPHVSFIMDGNRRYAKSLSVPIKAGHEAGALTLLNLLVTC 122
           ++L   + I +  LR    +P HV FIMDGNRR+A+   + +K GHEAG +++  +L  C
Sbjct: 12  FVLKWTKNIFSRTLRASNCVPRHVGFIMDGNRRFARKKEMDVKEGHEAGFVSMSRILELC 71

Query: 123 RNLGIKTVSAYAFSIENFNRPQEEVDTLTGLLAEKLDEVARR---ACDRESELYGLRLRV 179
              G+ T + +AFSIENF R   EV++L  L  E++ ++  R   AC      YG+R+++
Sbjct: 72  YEAGVDTATVFAFSIENFKRSSREVESLMTLARERIRQITERGELACK-----YGVRIKI 126

Query: 180 VGERSRISKSLNDRISRVERLTDEGDIMTLYICFPYTSRNDIYHAIYNCAESCKYLNSPV 239
           +G+ S + KSL + +      T      TL ICFPYT R +I HA+       K      
Sbjct: 127 IGDLSLLDKSLLEDVRVAVETTKNNKRATLNICFPYTGREEILHAMKETIVQHK----KG 182

Query: 240 SDIDETYLTNNMFMKEQSNKCDLLIRTSGHTRLSDYMLWQAHENGV-IEFSNTLWPDFDF 298
           + IDE+ L ++++        DLLIRTSG +RLSD+++WQA   GV IE  + LWP+F  
Sbjct: 183 AAIDESTLESHLYTA-GVPPLDLLIRTSGVSRLSDFLIWQASSKGVRIELLDCLWPEFGP 241

Query: 299 FEFFKMLLKWSFFTSVRRKQ 318
                +LLK+SF  S   K+
Sbjct: 242 IRMAWILLKFSFHKSFLNKE 261

>YNL272C (SEC2) [4337] chr14 complement(126803..129082) Guanine
           nucleotide exchange factor with coiled-coil domain
           essential for vesicular transport to the plasma membrane
           [2280 bp, 759 aa]
          Length = 759

 Score = 36.2 bits (82), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 43/71 (60%), Gaps = 5/71 (7%)

Query: 124 NLGIKTVSAYAFSIENFNRPQEEVDTLTGLLAEKLDEVARRACD--RESELYGLRLRVVG 181
           N  +KT+++   +IEN+N+ +E+ +TL   L+++ DEV R   D  +E+E   LR +   
Sbjct: 36  NKSLKTIASQKAAIENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENE---LRTKAEE 92

Query: 182 ERSRISKSLND 192
           E  +++K + D
Sbjct: 93  EADKLNKEVED 103

>AFL176C [3019] [Homologous to ScYNR006W (VPS27) - SH]
           (106401..108215) [1815 bp, 604 aa]
          Length = 604

 Score = 32.3 bits (72), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 36/72 (50%), Gaps = 5/72 (6%)

Query: 144 QEEVDT-LTGLLAEKLDEVARRACDRESELYGLRLRVVGERSRISKSLNDRISRVERLTD 202
           QEE D  L   L EK+      A   +++L  L  +V+G R R++ SLND   +   L D
Sbjct: 363 QEEDDIYLFANLVEKMKGQPMNAVLEDTQLQMLYQKVLGTRPRLNHSLNDTFHKYNTLVD 422

Query: 203 E----GDIMTLY 210
                 DIM++Y
Sbjct: 423 MNAKISDIMSIY 434

>Scas_40.1
          Length = 203

 Score = 29.6 bits (65), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 4/82 (4%)

Query: 102 VPIKAGHEAGALTLLNLLVTCRNLGIKTVSAYAFSIENFNRPQEEVDTLTGLLAEKLDEV 161
           + I  G  +G  TLLN+L +  + G+K   +Y F  +  +R Q   D  T  LA++ D  
Sbjct: 50  MAIVGGSGSGKTTLLNVLASKISRGLKMEGSYEFVADGGSRQQ---DITTAYLAQQ-DVS 105

Query: 162 ARRACDRESELYGLRLRVVGER 183
           + +   RE+  Y   L++   R
Sbjct: 106 SPKLTVRETLSYAADLKLKAPR 127

>KLLA0F17435g complement(1596081..1599896) similar to sp|Q04217
           Saccharomyces cerevisiae YMR128w ECM16 putative DEAH-box
           RNA helicase, start by similarity
          Length = 1271

 Score = 30.0 bits (66), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 8/86 (9%)

Query: 198 ERLTDEGDIMTLYICFPYTSRNDIYHAIYNCAESCKYLNSPVSDIDETYLTNNMFMKEQS 257
           ER+TD+G  M+L   FP + R      + N ++  KY+ + VS +         F+ EQ 
Sbjct: 904 ERITDDGKAMSL---FPLSPRFSKMLLVGNESDCLKYVVTIVSALS----VGEPFLSEQE 956

Query: 258 -NKCDLLIRTSGHTRLSDYMLWQAHE 282
               D + +T    +L DY   +A E
Sbjct: 957 LGIMDTVPKTQDEGQLDDYPDHEAEE 982

>CAGL0C04851g complement(452035..452697) similar to sp|P47149
           Saccharomyces cerevisiae YJR112w NNF1, start by
           similarity
          Length = 220

 Score = 29.3 bits (64), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 60/150 (40%), Gaps = 15/150 (10%)

Query: 145 EEVDTLTGLLAEKLDEVARRACDRESELYGLRLRVVGERSRISKSLNDRISRVERLTDEG 204
           +E+D L  L   +L+E  R+A      L   + R  G    I++ L   +S V++L+ + 
Sbjct: 83  DELDDLISLAQSRLEERKRQA------LVTAK-RKEGNARPINRDLEQGLSAVDQLSSK- 134

Query: 205 DIMTLYICFPYTSRNDIYHAIYNCAESCKYLNSPVSDIDETYLTNNMFMKEQSNKCDLLI 264
               L     YT R D    I N  +    LN+ + D            K +SN   LL 
Sbjct: 135 ---KLLAAHLYTLRKDTVAKIDNRLQKVNALNNKIKDE--ITELEEEIEKSKSNINSLLD 189

Query: 265 RTSGHTRL--SDYMLWQAHENGVIEFSNTL 292
            T G T L   D  L Q   + V+E    L
Sbjct: 190 DTMGSTALRDQDETLVQGLHDMVLELKENL 219

>Kwal_34.15959
          Length = 346

 Score = 29.3 bits (64), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 32/79 (40%), Gaps = 11/79 (13%)

Query: 118 LLVTCRNLGIKTVSAYAFSIENFNRPQEEVDTLTGLLAEKLDEVARRACDRESELYGLRL 177
           LL   RN G   V  + FS       QEEVDTL GL      E      D E   Y +  
Sbjct: 21  LLDAARNQGFLFVDGHDFS-------QEEVDTLFGLSKRFFTETP----DEEKRKYSINK 69

Query: 178 RVVGERSRISKSLNDRISR 196
             +G     ++ L+ R +R
Sbjct: 70  NNIGYTHFTNEQLDPRKAR 88

>YFR037C (RSC8) [1719] chr6 complement(227500..229173) Component of
           abundant chromatin remodeling complex (RSC) [1674 bp,
           557 aa]
          Length = 557

 Score = 29.3 bits (64), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 40/85 (47%), Gaps = 3/85 (3%)

Query: 118 LLVTCRNLGIKTVSAYAFSIENFNRPQEEVDTLTGLLAEKLDEVARRACDRESELYGLRL 177
           LL     LG  +  +   S +     Q  +  L  L  EKL+    + CD E++L   +L
Sbjct: 400 LLQGDDKLGKVSDKSREISEKYIEESQAIIQELVKLTMEKLESKFTKLCDLETQLEMEKL 459

Query: 178 RVVGERSRISKSLNDRISRVERLTD 202
           + V E  ++   LNDR+S  +++ D
Sbjct: 460 KYVKESEKM---LNDRLSLSKQILD 481

>KLLA0E00660g 69141..74684 gi|5531274|emb|CAB50899.1 Kluyveromyces
            lactis ECM29 homologue, start by similarity
          Length = 1847

 Score = 29.3 bits (64), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%)

Query: 17   ELEQSKERLKPKKPAFPNLLNRSSVKEYVHAQKLRI 52
            E  +S + +K KKP   N LNR+S K+ +  +  RI
Sbjct: 1666 ETHESNDNMKSKKPRLLNDLNRASSKKNIEMENYRI 1701

>CAGL0J06842g complement(655102..656616) highly similar to tr|Q02939
           Saccharomyces cerevisiae YPL122c TFB2, start by
           similarity
          Length = 504

 Score = 29.3 bits (64), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 277 LWQAHENGVIEFSNTLWPDFDFFEFFKMLLKWS 309
           LWQ   + V+ +  +L+ DFD  + F ML K++
Sbjct: 433 LWQLELDRVLTYEGSLYIDFDTAQDFNMLCKYA 465

>Scas_699.16
          Length = 616

 Score = 28.5 bits (62), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 32/61 (52%), Gaps = 4/61 (6%)

Query: 154 LAEKLDEVARRACDRESELYGLRLRVVGERSRISKSLNDRISRVERLTDE----GDIMTL 209
           L E++   A      +++L  L  +++  + +++++LNDRI +   L D      DIM +
Sbjct: 351 LVERMKNQAPNEILEDNQLQSLYRKILSTKPKLNEALNDRIQKYNALIDMNAKISDIMNI 410

Query: 210 Y 210
           Y
Sbjct: 411 Y 411

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.136    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,496,066
Number of extensions: 478497
Number of successful extensions: 1566
Number of sequences better than 10.0: 32
Number of HSP's gapped: 1562
Number of HSP's successfully gapped: 32
Length of query: 358
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 255
Effective length of database: 13,030,455
Effective search space: 3322766025
Effective search space used: 3322766025
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)