Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.76482022009421e-131
Sklu_2430.122572004742e-59
YKL119C (VPH2)2151964093e-50
Scas_721.1302121934007e-49
CAGL0K11594g2091603083e-35
KLLA0B12870g2051932937e-33
ABL021C2392061867e-17
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.7648
         (200 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.7648                                                          367   e-131
Sklu_2430.12 YKL119C, Contig c2430 21414-22187 reverse complement     187   2e-59
YKL119C (VPH2) [3146] chr11 complement(218216..218863) Vacuolar ...   162   3e-50
Scas_721.130                                                          158   7e-49
CAGL0K11594g 1121044..1121673 similar to sp|P32341 Saccharomyces...   123   3e-35
KLLA0B12870g complement(1123581..1124198) weakly similar to sp|P...   117   7e-33
ABL021C [571] [Homologous to ScYKL119C (VPH2) - SH] (358274..358...    76   7e-17

>Kwal_26.7648
          Length = 202

 Score =  367 bits (942), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 181/200 (90%), Positives = 181/200 (90%)

Query: 1   MFEIKLNSKLTSQLALLADDGEAKAILDKGSISMKSLLSFCEKHWQDVAISELVTPLDFV 60
           MFEIKLNSKLTSQLALLADDGEAKAILDKGSISMKSLLSFCEKHWQDVAISELVTPLDFV
Sbjct: 1   MFEIKLNSKLTSQLALLADDGEAKAILDKGSISMKSLLSFCEKHWQDVAISELVTPLDFV 60

Query: 61  YKTKRERGAHYSEEFKXXXXXXXXXXXXSEYQNMVRRDGLAVGLQDSDNQTPAQITKQVK 120
           YKTKRERGAHYSEEFK            SEYQNMVRRDGLAVGLQDSDNQTPAQITKQVK
Sbjct: 61  YKTKRERGAHYSEEFKLQLERLRLEQEESEYQNMVRRDGLAVGLQDSDNQTPAQITKQVK 120

Query: 121 EQITTVFNILXXXXXXXFAVWYWTGSSAGMRPQSRVLFCLFGGILVLVAEVVVYSSYLRK 180
           EQITTVFNIL       FAVWYWTGSSAGMRPQSRVLFCLFGGILVLVAEVVVYSSYLRK
Sbjct: 121 EQITTVFNILVSVVSVVFAVWYWTGSSAGMRPQSRVLFCLFGGILVLVAEVVVYSSYLRK 180

Query: 181 VEEARMKERSKKERKTVIKT 200
           VEEARMKERSKKERKTVIKT
Sbjct: 181 VEEARMKERSKKERKTVIKT 200

>Sklu_2430.12 YKL119C, Contig c2430 21414-22187 reverse complement
          Length = 257

 Score =  187 bits (474), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 134/200 (67%), Gaps = 1/200 (0%)

Query: 1   MFEIKLNSKLTSQL-ALLADDGEAKAILDKGSISMKSLLSFCEKHWQDVAISELVTPLDF 59
           MFEI+LN +L   L  +   +   + +L   SI +K LL +  ++W +  IS+L++PL F
Sbjct: 54  MFEIQLNDELKELLNGIQPKECRVEELLQNDSIPIKLLLEYHLEYWSERPISKLLSPLKF 113

Query: 60  VYKTKRERGAHYSEEFKXXXXXXXXXXXXSEYQNMVRRDGLAVGLQDSDNQTPAQITKQV 119
            +K K ERG +YSEEFK            +EYQ M++RDGL    ++++  TP+Q++KQ+
Sbjct: 114 KFKEKYERGVNYSEEFKRQLEHLKLQQEENEYQEMIKRDGLGYLKENAEELTPSQMSKQI 173

Query: 120 KEQITTVFNILXXXXXXXFAVWYWTGSSAGMRPQSRVLFCLFGGILVLVAEVVVYSSYLR 179
           +EQITT+FNIL       +A+WYW+ SS  +   +R+  CLF G+LVLVAE+VVY+SYL+
Sbjct: 174 REQITTIFNILLSVVSVVWAIWYWSSSSTRIATHNRIFLCLFFGVLVLVAEIVVYNSYLK 233

Query: 180 KVEEARMKERSKKERKTVIK 199
           K+EEA++ ER K+E+KTV++
Sbjct: 234 KIEEAKITERKKREKKTVVQ 253

>YKL119C (VPH2) [3146] chr11 complement(218216..218863) Vacuolar
           H(+)-ATPase (V-ATPase) assembly protein acting in the
           endoplasmic reticulum [648 bp, 215 aa]
          Length = 215

 Score =  162 bits (409), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 88/196 (44%), Positives = 118/196 (60%), Gaps = 12/196 (6%)

Query: 1   MFEIKLNSKLTSQLALLAD--------DGEAKAILDKGSISMKSLLSFCEKHWQD----V 48
           MFEIKLN ++T  L    +        D +    L + +I M+SLL + +++ +D     
Sbjct: 1   MFEIKLNDRITEFLRKFKNSAKSNEGIDEDIDLFLKRHAIPMQSLLFYVKEYRKDSDLQC 60

Query: 49  AISELVTPLDFVYKTKRERGAHYSEEFKXXXXXXXXXXXXSEYQNMVRRDGLAVGLQDSD 108
           +I EL+ PL+F +K K  RG HYSE+FK             EYQ+MV+R      LQ+ D
Sbjct: 61  SIKELLKPLEFEFKPKAVRGLHYSEDFKKKLEFLKYQEQELEYQSMVKRSKSVFSLQEDD 120

Query: 109 NQTPAQITKQVKEQITTVFNILXXXXXXXFAVWYWTGSSAGMRPQSRVLFCLFGGILVLV 168
             TP+QI KQ+KEQ+TTVFN+L        A+WYWTGSS       R+L CLF GILVLV
Sbjct: 121 ELTPSQINKQIKEQVTTVFNVLVSVISVVVAIWYWTGSSTNFPVHVRLLLCLFFGILVLV 180

Query: 169 AEVVVYSSYLRKVEEA 184
           A+VVVY+SYL+K+EEA
Sbjct: 181 ADVVVYNSYLKKLEEA 196

>Scas_721.130
          Length = 212

 Score =  158 bits (400), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 117/193 (60%), Gaps = 9/193 (4%)

Query: 1   MFEIKLNSKLTSQLALLADDG------EAKAILDKGSISMKSLLSFCEKHWQD-VAISEL 53
           MF+IKLN  L   L  L +        E   +L+ G I MK+LL +  ++W++ + + +L
Sbjct: 1   MFDIKLNVPLKEALGELKEKAKDPLRKEIDTLLNNGYIPMKTLLKYHSEYWKNQIPMRQL 60

Query: 54  VTPLDFVYKTKRERGAHYSEEFKXXXXXXXXXXXXSEYQNMVR--RDGLAVGLQDSDNQT 111
           + P++F +K K + G+ YS EFK             +YQNM++  R  L +  ++ +  T
Sbjct: 61  LNPIEFQFKEKYQPGSTYSPEFKKQLETLKLKQEELDYQNMIKNERKTLQIIKEEGETLT 120

Query: 112 PAQITKQVKEQITTVFNILXXXXXXXFAVWYWTGSSAGMRPQSRVLFCLFGGILVLVAEV 171
           PAQ+ KQ+KEQ+TT+FNI        FA+WYWTG+SA M    R+L C+F GILVLVAEV
Sbjct: 121 PAQMNKQIKEQVTTIFNIFVSVISVVFAIWYWTGTSAHMPVHYRLLLCIFTGILVLVAEV 180

Query: 172 VVYSSYLRKVEEA 184
           VVY+SYL K++ A
Sbjct: 181 VVYNSYLTKIDLA 193

>CAGL0K11594g 1121044..1121673 similar to sp|P32341 Saccharomyces
           cerevisiae YKL119c VPH2 H+-ATPase assembly protein,
           start by similarity
          Length = 209

 Score =  123 bits (308), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 95/160 (59%), Gaps = 4/160 (2%)

Query: 26  ILDKGSISMKSLLSFCEKHWQDVAISELVTPLDFVYKTKRERGAHYSEEFKXXXXXXXXX 85
           ++++GS+    L   C     +V++SE ++ L+F +K +  R    S EF+         
Sbjct: 36  LIERGSVPCGELAELCRAWGSEVSVSEALSGLEFKFKDRETRKP--SPEFQAQLARLRAL 93

Query: 86  XXXSEYQNMVRRDGLAVGLQDSDNQTPAQITKQVKEQITTVFNILXXXXXXXFAVWYWTG 145
               EYQ +V+   LA+  +     TPAQI +++KEQ+TTVFNI+        A+WYW+ 
Sbjct: 94  QQEQEYQQIVKNRDLAITTES--EATPAQINREIKEQVTTVFNIIISVISVVVAIWYWSR 151

Query: 146 SSAGMRPQSRVLFCLFGGILVLVAEVVVYSSYLRKVEEAR 185
           +SAG+    R+  C+F GILVLVAEVVVYSSYL K+EEA+
Sbjct: 152 TSAGLAIHHRIFLCMFFGILVLVAEVVVYSSYLSKIEEAK 191

>KLLA0B12870g complement(1123581..1124198) weakly similar to
           sp|P32341 Saccharomyces cerevisiae YKL119c VPH2
           H+-ATPase assembly protein singleton, start by
           similarity
          Length = 205

 Score =  117 bits (293), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 73/193 (37%), Positives = 104/193 (53%), Gaps = 7/193 (3%)

Query: 1   MFEIKLNSKLTSQ-LALLADDGEAKAILDKGSISMKSLLSFCEKHWQD---VAISELVTP 56
           MF+I ++  L  Q L  L +D  A   L + SIS + L    ++ W+D   V++ +L+  
Sbjct: 1   MFDITIDEGLLRQRLEKLKEDHRASLSLQQNSISFELLSELYQQFWRDDATVSMKQLLKS 60

Query: 57  LDFVYKTKRERGAHYSEEFKXXXXXXXXXXXXSEYQNMVRRDGLAVGLQDSDNQ-TPAQI 115
               YK KR  G  YSE FK             EYQ M++RD L +    +D + + AQI
Sbjct: 61  GKLRYKEKRVPGEGYSESFKAELENLKALQQEKEYQEMLKRDSLHLAGSTADKEPSIAQI 120

Query: 116 TKQVKEQITTVFNILXXXXXXXFAVWYWTGSSAGMRPQSRVLFCLFGGILVLVAEVVVYS 175
            K++KEQ++ V N+L       +AVWY T +  G     RVL CLF G+LVL A+V +Y+
Sbjct: 121 NKEIKEQVSAVVNVLLTVFGTIYAVWYVTRT--GWDIHVRVLLCLFSGLLVLTADVAMYN 178

Query: 176 SYLRKVEEARMKE 188
            Y RK+EEAR  E
Sbjct: 179 VYNRKIEEARTTE 191

>ABL021C [571] [Homologous to ScYKL119C (VPH2) - SH]
           (358274..358993) [720 bp, 239 aa]
          Length = 239

 Score = 76.3 bits (186), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 97/206 (47%), Gaps = 16/206 (7%)

Query: 1   MFEIKLNSKLTSQL---ALLADDGEAKAILDKGSISMKSLLSFCEKHWQDVAISELVTPL 57
           MF+++L+  L  +L      A   E K    +G ++  SL+  CE+     A +     L
Sbjct: 44  MFQLELSGPLRDKLLQAGGGAAAAEVKVAAARGWVTFGSLVVLCER---GAATARETQAL 100

Query: 58  --DFVYKTKRERGAHYSEEFKXXXXXXXXXXXXSEYQNMVRRDGLAVGLQDSDNQTP-AQ 114
               + + +  R ++YS+EF+             EY+       L  G+Q    +     
Sbjct: 101 LGSLLLRPRAARSSNYSDEFRAQQQRLRAAAAEDEYR------ALTGGMQQEQQRHGFGS 154

Query: 115 ITKQVKEQITTVFNILXXXXXXXFAVWYWTGSSAGMRPQSRVLFCLFGGILVLVAEVVVY 174
             ++V+EQ+  V N++       + VW W   +AG+  ++RVL  L  G+  LVA+V +Y
Sbjct: 155 AAREVREQLAAVANVVLTVVGVAYGVW-WVARAAGVGAEARVLLALGCGLTALVADVAMY 213

Query: 175 SSYLRKVEEARMKERSKKERKTVIKT 200
           + Y RKV EAR +ER   E++ V+ +
Sbjct: 214 NVYHRKVGEARRRERRLHEQRRVVTS 239

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.132    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,078,781
Number of extensions: 165332
Number of successful extensions: 520
Number of sequences better than 10.0: 8
Number of HSP's gapped: 512
Number of HSP's successfully gapped: 8
Length of query: 200
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 104
Effective length of database: 13,272,781
Effective search space: 1380369224
Effective search space used: 1380369224
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)