Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.764756555728780.0
ABL020W61057511871e-157
CAGL0K03333g60256811791e-156
YMR100W (MUB1)62060811021e-144
Scas_717.6661256410351e-134
KLLA0B12892g62554110311e-133
Sklu_2430.132061685862e-72
YOR109W (INP53)110750666.6
YHL030W (ECM29)186860667.2
Kwal_26.7665551105657.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.7647
         (557 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.7647                                                         1113   0.0  
ABL020W [572] [Homologous to ScYMR100W (MUB1) - SH] complement(3...   461   e-157
CAGL0K03333g 302891..304699 similar to sp|Q03162 Saccharomyces c...   458   e-156
YMR100W (MUB1) [4058] chr13 (466299..468161) Zinc finger protein...   429   e-144
Scas_717.66                                                           403   e-134
KLLA0B12892g 1124666..1126543 weakly similar to sp|Q03162 Saccha...   401   e-133
Sklu_2430.13 YMR100W, Contig c2430 23178-23793                        230   2e-72
YOR109W (INP53) [4912] chr15 (525278..528601) Dual functional in...    30   6.6  
YHL030W (ECM29) [2256] chr8 (40082..45688) Protein that acts to ...    30   7.2  
Kwal_26.7665                                                           30   7.8  

>Kwal_26.7647
          Length = 565

 Score = 1113 bits (2878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/557 (96%), Positives = 535/557 (96%)

Query: 1   MRDCNHRCVLLNRPSITITSAVYDRRGLDCNSEIPLINSLNHLTYLTSNSAKVRETVAND 60
           MRDCNHRCVLLNRPSITITSAVYDRRGLDCNSEIPLINSLNHLTYLTSNSAKVRETVAND
Sbjct: 1   MRDCNHRCVLLNRPSITITSAVYDRRGLDCNSEIPLINSLNHLTYLTSNSAKVRETVAND 60

Query: 61  GALIRLVSILHDCCISASELPRMQVTGALTLVEKIERERKLAMIAWKWTLAFQCLVLTGT 120
           GALIRLVSILHDCCISASELPRMQVTGALTLVEKIERERKLAMIAWKWTLAFQCLVLTGT
Sbjct: 61  GALIRLVSILHDCCISASELPRMQVTGALTLVEKIERERKLAMIAWKWTLAFQCLVLTGT 120

Query: 121 RGTEQIRKQVVSSGVIPILATVLDNYLLLEKNYDYLRNTPLEFDFKKLLHEKDMACEELV 180
           RGTEQIRKQVVSSGVIPILATVLDNYLLLEKNYDYLRNTPLEFDFKKLLHEKDMACEELV
Sbjct: 121 RGTEQIRKQVVSSGVIPILATVLDNYLLLEKNYDYLRNTPLEFDFKKLLHEKDMACEELV 180

Query: 181 KSRFQGGLLDKCREFSEPSIMHLKTDFCTLWNEKLVPDAGDENQVKDDFDNIVVSVPRTF 240
           KSRFQGGLLDKCREFSEPSIMHLKTDFCTLWNEKLVPDAGDENQVKDDFDNIVVSVPRTF
Sbjct: 181 KSRFQGGLLDKCREFSEPSIMHLKTDFCTLWNEKLVPDAGDENQVKDDFDNIVVSVPRTF 240

Query: 241 AQGKIVPKADDVIWSLQLLAFISKYTHMKPHLQRVHLVEXXXXXXXXXXXXKHQERGLDI 300
           AQGKIVPKADDVIWSLQLLAFISKYTHMKPHLQRVHLVE            KHQERGLDI
Sbjct: 241 AQGKIVPKADDVIWSLQLLAFISKYTHMKPHLQRVHLVESLSLRSALSAASKHQERGLDI 300

Query: 301 TPLKISATDVQEADLDEPVEPKENELDHTDPYLLDIESFCKELGEPRLSFLSKRVNKLSE 360
           TPLKISATDVQEADLDEPVEPKENELDHTDPYLLDIESFCKELGEPRLSFLSKRVNKLSE
Sbjct: 301 TPLKISATDVQEADLDEPVEPKENELDHTDPYLLDIESFCKELGEPRLSFLSKRVNKLSE 360

Query: 361 RRMKSVSERIRQMESFRDEYHRRWNYHAVPKTLDDHTWEHITNIRYLNLFPLVERFTVKK 420
           RRMKSVSERIRQMESFRDEYHRRWNYHAVPKTLDDHTWEHITNIRYLNLFPLVERFTVKK
Sbjct: 361 RRMKSVSERIRQMESFRDEYHRRWNYHAVPKTLDDHTWEHITNIRYLNLFPLVERFTVKK 420

Query: 421 ENERDMTYWSSVVMRNSCRKNETTGVRQCANFACGKWEDYPKRFAKCRRCKRTKYCSREC 480
           ENERDMTYWSSVVMRNSCRKNETTGVRQCANFACGKWEDYPKRFAKCRRCKRTKYCSREC
Sbjct: 421 ENERDMTYWSSVVMRNSCRKNETTGVRQCANFACGKWEDYPKRFAKCRRCKRTKYCSREC 480

Query: 481 QLQSWNFHRYWCQEVXXXXXXXXXXTNDSERNTPNGGNSVTGSLVEPSATDNPNAENSRS 540
           QLQSWNFHRYWCQEV          TNDSERNTPNGGNSVTGSLVEPSATDNPNAENSRS
Sbjct: 481 QLQSWNFHRYWCQEVGSSSAGAGSATNDSERNTPNGGNSVTGSLVEPSATDNPNAENSRS 540

Query: 541 MFPASGEDTDLARGIGT 557
           MFPASGEDTDLARGIGT
Sbjct: 541 MFPASGEDTDLARGIGT 557

>ABL020W [572] [Homologous to ScYMR100W (MUB1) - SH]
           complement(359098..360930) [1833 bp, 610 aa]
          Length = 610

 Score =  461 bits (1187), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 260/575 (45%), Positives = 340/575 (59%), Gaps = 68/575 (11%)

Query: 1   MRDCNHRCVLLNRPSITITSAVYDRRGLDCNSEIPLINSLNHLTYLTSNSAKVRETVAND 60
           MR+ NHR VL NR S  I+  VYDRR LD  +++PLINSLNHLT+LTS+SAKVRET++ D
Sbjct: 1   MRELNHRSVLSNRASFIISQTVYDRRALDNVADLPLINSLNHLTFLTSSSAKVRETMSED 60

Query: 61  GALIRLVSILHDCCISASEL-PRMQVTGALTLVEKIERERKLAMIAWKWTLAFQCLVLTG 119
           GAL RLVSILHDC ++  +L   + V   +  V+ I R+RK+AM+AWKWTLAFQCLVLTG
Sbjct: 61  GALERLVSILHDCYLTLHDLCIGLHVGFRMGTVDSIVRQRKMAMVAWKWTLAFQCLVLTG 120

Query: 120 TRGTEQIRKQVVSSGVIPILATVLDNYLLLEKNYDYLRNTPLEFDFKKLLHEKDMACE-E 178
           TRGT++IRKQV  SGVIPI+ATVLDNY++  KN+D+ R+ P+EFDFK +        + E
Sbjct: 121 TRGTQEIRKQVAHSGVIPIIATVLDNYMIYHKNFDFFRDEPIEFDFKSIASGNIFQLQPE 180

Query: 179 LVKSRFQG--------------------------GLLDKCREFSE----PSIMHLKTDFC 208
            ++S FQ                            LLD   + +     P I  L TDF 
Sbjct: 181 EMESFFQKMDKSHPNLRLCINMERFKILVGEDIPSLLDDPAKVNMHNCVPPITRLDTDFQ 240

Query: 209 TLWNEKLVPDAGDENQVKDDFDNIVVSVPRTFAQGKIVPKADDVIWSLQLLAFISKYTHM 268
           +LW E  +    DE+ + D    +V+S+PR F  G+++PK DD+ WS+QLLAF++K T  
Sbjct: 241 SLW-EGTLGLKSDEHPLSD----VVLSIPREFFLGRVIPKLDDITWSVQLLAFLTKCTAT 295

Query: 269 KPHLQRVHLVEXXXXXXXXXXXXKHQER---------GLDITPLKISATDVQEADLDEPV 319
           KP+LQ+V LVE            + +ER          L+ T L +   D Q     +P 
Sbjct: 296 KPYLQKVSLVESISFRPILE---RAKERYTLLSNSLPPLNFTDLSLVDDDDQRTSSSKPK 352

Query: 320 EPKENELDHTDPYLLDIESFCKELGEPRLSFLSKRVN----------KLSERRMKSVSER 369
            P        DP+L++I + C+E    + +   K VN          KL +     V   
Sbjct: 353 VPIV-----IDPFLMEINAICEESNNKKQA--KKSVNFSMLGLTDFTKLKKADTTDVWRA 405

Query: 370 IRQME--SFRDEYHRRWNYHAVPKTLDDHTWEHITNIRYLNLFPLVERFTVKKENERDMT 427
            R  +    +  +  +W+Y  V + LD+ TW  I N   LNLF LVER+TVK EN+ ++T
Sbjct: 406 FRMYDEVQMKKRFSYKWDYDKVSRELDEETWNKIINRETLNLFALVERYTVKIENDANIT 465

Query: 428 YWSSVVMRNSCRKNETTGVRQCANFACGKWEDYPKRFAKCRRCKRTKYCSRECQLQSWNF 487
           YWSSVVMRNSCRK+E TGVRQCANF CGKWED+PK+F KCRRCKRTKYCS ECQLQSW +
Sbjct: 466 YWSSVVMRNSCRKHEATGVRQCANFFCGKWEDHPKQFPKCRRCKRTKYCSCECQLQSWAY 525

Query: 488 HRYWCQEVXXXXXXXXXXTNDSERNTPNGGNSVTG 522
           HRYWC +V           N +  +TPN      G
Sbjct: 526 HRYWCHDVGSVFTGTSSTANTTGTHTPNAVGQSAG 560

>CAGL0K03333g 302891..304699 similar to sp|Q03162 Saccharomyces
           cerevisiae YMR100w involved in budding, start by
           similarity
          Length = 602

 Score =  458 bits (1179), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 264/568 (46%), Positives = 340/568 (59%), Gaps = 55/568 (9%)

Query: 1   MRDCNHRCVLLNRPSITITSAVYDRRGLDCNSEIPLINSLNHLTYLTSNSAKVRETVAND 60
           MRD NHR +  N+P ITITS VYDRR LD  S +PLINSLNHLTYLTSNSAK+RET+AND
Sbjct: 1   MRDSNHRSISNNKPVITITSTVYDRRALDIESTVPLINSLNHLTYLTSNSAKIRETIAND 60

Query: 61  GALIRLVSILHDCCISASEL--PRMQVTGALTLVEKIERERKLAMIAWKWTLAFQCLVLT 118
           GAL RLVSILH+C +S  E+    ++        + I + ++LA+ AWKWTLAFQCLVLT
Sbjct: 61  GALDRLVSILHNCHLSLHEILDKDLEFFKTHERAKSIYKRKRLALCAWKWTLAFQCLVLT 120

Query: 119 GTRGTEQIRKQVVSSGVIPILATVLDNYLLLEKNYDYLRNTPLEF--------DFKKLLH 170
           GTRGTEQIRK+VV +GVIP+LATVLDNY+L  K+YD++R+  L+F        D  KLL 
Sbjct: 121 GTRGTEQIRKKVVLAGVIPVLATVLDNYMLFHKHYDFIRDETLDFEIDEILTFDSYKLLR 180

Query: 171 EKDMACEELVKSRFQGGLLDKCREFSEPS-------IMHLKTDFCTLW---NEKLVPDAG 220
           +      E   S   G    K  +F   S       IM   TDF  +W   N+  +P   
Sbjct: 181 KNSEETYEEYISYLIGRDKLKPTDFKRFSVEELTTPIMTCATDFRDVWQRYNDSPLPTPS 240

Query: 221 DENQVK--------DDFDNIVVSVPRTFAQGKIVPKADDVIWSLQLLAFISKYTHMKPHL 272
           D++  K        +D +  +VS PR+F  GKI+PK DDVIWSLQLLAFISKYT+MK  L
Sbjct: 241 DKSNAKLEENCFYENDEEKFLVSTPRSFFIGKIIPKQDDVIWSLQLLAFISKYTYMKQKL 300

Query: 273 QRVHLVEXXXXXXXXXXXXKHQERGL--DITPLKISATDVQEADLDEPVEPKENELDHTD 330
           Q V L++            K +      +++PL IS  ++ E D +  V   ++E D T+
Sbjct: 301 QNVELIDSLSFRSMIERYKKRKMTTFSNNLSPLSISK-NLSEKD-ENIVGDIKDESDITN 358

Query: 331 PYLLDIESFCKELGEPRLSFLSKRVNKLSERR-------------MKSVSERIRQMESFR 377
             +       KE+ E       KR  K+ ++R             MKS    I+ ++   
Sbjct: 359 LQMKINNPIIKEIME-----CGKRCLKIEKKRKECKPKCRTCILNMKS-PPYIKNLQ-LN 411

Query: 378 DEYHRRWNYHAVPKTLDDHTWEHITNIRYLNLFPLVERFTVKKENERDMTYWSSVVMRNS 437
             + R WNY  V K L D TW    + + +N FPLVE++T+  +N  D+ YWSSV+MRNS
Sbjct: 412 KYFDRLWNYQKVSKRLTDETWNSFISKQLINAFPLVEKYTITDKNTHDIIYWSSVIMRNS 471

Query: 438 CRKNETTGVRQCANFACGKWEDYPKRFAKCRRCKRTKYCSRECQLQSWNFHRYWCQEVXX 497
           CRKNE TGVRQCANF+CGKWE YP+ FAKCRRCKRTKYCSRECQL++W  HRYWC EV  
Sbjct: 472 CRKNEVTGVRQCANFSCGKWERYPREFAKCRRCKRTKYCSRECQLEAWKHHRYWCHEVTS 531

Query: 498 XXXXXXXXTNDSERNTPNGGNSVTGSLV 525
                   T   E NTP G  + + +++
Sbjct: 532 SNKSSSMNT---ETNTPGGTGNDSSTMM 556

>YMR100W (MUB1) [4058] chr13 (466299..468161) Zinc finger protein,
           involved in the regulation of bud site selection [1863
           bp, 620 aa]
          Length = 620

 Score =  429 bits (1102), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 259/608 (42%), Positives = 345/608 (56%), Gaps = 76/608 (12%)

Query: 1   MRDCNHRCVLLNRPSITITSAVYDRRGLDCNSEIPLINSLNHLTYLTSNSAKVRETVAND 60
           MRD NHR +  N+P +TITS VYDRR LD NS IPLINSLN+LTYLTSNS+KVRETVAND
Sbjct: 1   MRDSNHRSLTSNKPIVTITSTVYDRRALDINSSIPLINSLNYLTYLTSNSSKVRETVAND 60

Query: 61  GALIRLVSILHDCCISASELPRMQVTG--ALTLVEKIERERKLAMIAWKWTLAFQCLVLT 118
           GAL RLVSIL  C +S  EL  + +        ++ + +E++LA+ AWKWTL FQCLVLT
Sbjct: 61  GALERLVSILRSCHLSLFELLDLDLENFNEHENIKDLWKEKRLALCAWKWTLTFQCLVLT 120

Query: 119 GTRGTEQIRKQVVSSGVIPILATVLDNYLLLEKNYDYLRNTPLEFDFKKLLHE------- 171
           GTRGTEQIRK+VV SGV+ +L TVLDNYLL  KNYD++++  + FDFK +  E       
Sbjct: 121 GTRGTEQIRKKVVMSGVLSVLVTVLDNYLLYHKNYDFIKDQTMTFDFKGITTETMYKFMR 180

Query: 172 KD-----------MACEELVKSRFQGGLLDKCREFSEPSIMHLKTDFCTLWN-------- 212
           KD           +  ++ +K       L++      PS M + TDF  +W         
Sbjct: 181 KDENETYQQYIEFITGQDKLKLSTDKNFLNE--RLVAPS-MTIPTDFSDIWGRFADLASN 237

Query: 213 -----EKLVPDAGDENQVKD-------------DFDNIVVSVPRTFAQGKIVPKADDVIW 254
                E+   D   +++V+              D +   +S PR F  G+IVPK DDVIW
Sbjct: 238 FEPDQERHDDDIDIDSEVESENFDAHKNFFSQPDINRPTISTPREFFLGRIVPKQDDVIW 297

Query: 255 SLQLLAFISKYTHMKPHLQRVHLVEXXXXXXXXXXXXKH-------QERGLDITPLKISA 307
           SLQLLAF+SKYT+MK  LQ V LVE            +        +E+  D+T    S 
Sbjct: 298 SLQLLAFVSKYTYMKSTLQNVELVESLSFRSMAYKIKQRISEENDLEEQERDVTVKLSSL 357

Query: 308 TDVQEADLDEPVEPKENELDHTDPYLLDIESF---CKELGE--------PRLSFLSK-RV 355
                 + +   + K  +    DP+  ++E     C++  +        P L+   + RV
Sbjct: 358 YPYLSKNPENNSKVKALDTSKMDPFFKELEELSNRCQQEEQNEICNNHCPVLNLFERYRV 417

Query: 356 NKLSERRMKSV-SERIRQMESFRDEYHRRWNYHAVPKTLDDHTWEHITNIRYLNLFPLVE 414
            K S+        ERI   +   D + RRW+Y  + K L +  +++      +N+FPLVE
Sbjct: 418 PKPSDDNAYGKDKERINLRKKISDNFERRWSYDKMKKELTNIVYKNKVLTNVVNIFPLVE 477

Query: 415 RFTVKKENERDMTYWSSVVMRNSCRKNETTGVRQCANFACGKWEDYPKRFAKCRRCKRTK 474
           ++TV  EN  D+ YWSSV+MRNSCRKNE  GVRQCANF+CGKWED+P++FAKCRRCKRTK
Sbjct: 478 KYTVSAENTHDVIYWSSVIMRNSCRKNEILGVRQCANFSCGKWEDFPRQFAKCRRCKRTK 537

Query: 475 YCSRECQLQSWNFHRYWCQEVXXXXXXXXXXTNDSERNTPNGGNSVTGSLVEPSATDNPN 534
           YCSR+CQL++W +HRYWC EV          T  +  NTPN  +S+       +AT   +
Sbjct: 538 YCSRKCQLKAWGYHRYWCHEVGSSHMRSTNTT--TGVNTPNEPSSLNA-----TATTAAD 590

Query: 535 AENSRSMF 542
             NS S F
Sbjct: 591 VSNSTSTF 598

>Scas_717.66
          Length = 612

 Score =  403 bits (1035), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 241/564 (42%), Positives = 306/564 (54%), Gaps = 61/564 (10%)

Query: 1   MRDCNHRCVLLNRPSITITSAVYDRRGLDCNSEIPLINSLNHLTYLTSNSAKVRETVAND 60
           MRD NHR V  N+P I ITS  YDRR LD NS+ PL++SLNHLTY   NS K+RET+AND
Sbjct: 1   MRDSNHRSVTSNKPVIVITSTSYDRRALDVNSDRPLVSSLNHLTYQVCNSVKIRETIAND 60

Query: 61  GALIRLVSILHDCCISASEL---PRMQVTGALTLVEKIERERKLAMIAWKWTLAFQCLVL 117
           GA+ R+VSIL  C  S  EL   P   V+    + + I +++K A++ WKW L  QCLVL
Sbjct: 61  GAMDRIVSILRSCHFSLYELLDLPLRHVSNH-KMAQDIWKKKKQALMGWKWLLGLQCLVL 119

Query: 118 TGTRGTEQIRKQVVSSGVIPILATVLDNYLLLEKNYDYLRNTPLEFDFKKL-----LH-- 170
           TGTRG E IR++V  +G+IPILAT+LDNYLL  KNYDY++  PL FDFK L      H  
Sbjct: 120 TGTRGPEDIRRKVFHAGIIPILATILDNYLLYHKNYDYMKGEPLSFDFKALDTEQMFHFL 179

Query: 171 --EKDMACE---ELVKSRFQGGLLDKCREFSEPSIMHLK---TDFCTLWNEKLVPDAGDE 222
             +K+   E   E V  +    L D     +E  +   K   +DF  +W+  +      E
Sbjct: 180 RVDKNETYEDYLEFVVGKDLFRLSDDDDFINEELLRDEKINPSDFGDVWS--IFTSKDGE 237

Query: 223 NQVKDDFDNIVVS---VPRTFAQGKIVPKADDVIWSLQLLAFISKYTHMKPHLQRVHLVE 279
           N   D+ +    S   +PR F  G+IVPK DD++WSLQLLAF+SKY++ +  LQ    VE
Sbjct: 238 NPFMDEDNAYYKSNFPIPREFYLGRIVPKLDDILWSLQLLAFLSKYSYTRRELQSSEFVE 297

Query: 280 XXX-------XXXXXXXXXKHQERGLDITPLKI------------------SATDVQEAD 314
                              K    G   TP  +                     D+ E+ 
Sbjct: 298 RLSFRGMINRARSRLSGIYKGNIVGAHYTPSLLKEKSPSPELGFPDMYNFEGKNDIHES- 356

Query: 315 LDEPVEPKENELDHTDPYLLDIESFCKEL-----GEPRLSFLSKRVNKLSERRMKSVSER 369
           L +P   K  E       LLD++  C E+     GE  L   +       +    + S+R
Sbjct: 357 LSQPTTDKFLE------ELLDVKRKCAEISAKTDGENELLNRNPYEQLNIQISTNNSSDR 410

Query: 370 IRQMESFRDEYHRRWNYHAVPKTLDDHTWEHITNIRYLNLFPLVERFTVKKENERDMTYW 429
             Q     D ++  WNY  + K LD+ TW HI     +NLFPLVE FT    N +D+ YW
Sbjct: 411 HVQESQLIDNFNANWNYRDLCKDLDEDTWNHIQKKEPINLFPLVENFTPGNSNPKDVVYW 470

Query: 430 SSVVMRNSCRKNETTGVRQCANFACGKWEDYPKRFAKCRRCKRTKYCSRECQLQSWNFHR 489
           SSV+MRNSCRK+E  GVRQCANFACGKWE+YPK+FAKCRRCK TKYCSR CQL+SW FHR
Sbjct: 471 SSVIMRNSCRKDEEKGVRQCANFACGKWEEYPKQFAKCRRCKSTKYCSRACQLKSWKFHR 530

Query: 490 YWCQEVXXXXXXXXXXTNDSERNT 513
           YWC E           T     NT
Sbjct: 531 YWCNETKLPSQGNSTTTESPSTNT 554

>KLLA0B12892g 1124666..1126543 weakly similar to sp|Q03162
           Saccharomyces cerevisiae YMR100w MUB1 involved in
           budding singleton, start by similarity
          Length = 625

 Score =  401 bits (1031), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 234/541 (43%), Positives = 322/541 (59%), Gaps = 54/541 (9%)

Query: 1   MRDCNHRCVLLNRPSITITSAVYDRRGLDCNSEIPLINSLNHLTYLTSNSAKVRETVAND 60
           MR+ N+R V  NR +++I+  VYDRR LD  S++PLINSLNHL +L S S  +RE ++ D
Sbjct: 1   MRETNYRSVTGNRATVSISQTVYDRRALDNVSDLPLINSLNHLAFLCSTSTLIREAMSRD 60

Query: 61  GALIRLVSILHDCCISASELPRMQVTGALTL---VEKIERERKLAMIAWKWTLAFQCLVL 117
           GAL RLVSILH+C I  + LP++ V+ A      ++ ++R+R LA ++WKWTLA+QCLVL
Sbjct: 61  GALERLVSILHECYIPITNLPQVMVSSAQNQSNPLQTVKRDRHLAYLSWKWTLAYQCLVL 120

Query: 118 TGTRGTEQIRKQVVSSGVIPILATVLDNYLLLEKNYDYLRNTPLEFDFKKLL-------- 169
           TGTRGT  IR+QVV SG+IPI+ATVLDNY++  KN+D++ NT + F F +L         
Sbjct: 121 TGTRGTLGIREQVVKSGIIPIIATVLDNYMIYCKNFDFINNTAIPFTFSELADLDSDLFQ 180

Query: 170 ------------------HEKDMACEELVK-------SRFQGGLLDKCREFSEPS-IMHL 203
                             + KD    E +K       ++F+  L +      +P+ I  L
Sbjct: 181 FTDDELRKSNEKVDPKDSYYKDFISMERLKLLLGPTENQFEFDLENVAGLHLKPNFITEL 240

Query: 204 KTDFCTLWNEKL-VPDAGDENQVKDDFDNIVVSVPRTFAQGKIVPKADDVIWSLQLLAFI 262
            TD+ +L  E+L VP  G         +N+++  PR F  GK++P+ DDV W++QLLAF+
Sbjct: 241 DTDWQSLAQEELCVPLPGSA------LENVIILPPRRFFLGKVIPELDDVTWAVQLLAFL 294

Query: 263 SKYTHMKPHLQRVHLVEXXXXXXXXXXXXKHQERG--LDITPLKISATDVQEADLDEPVE 320
           +K T +KP LQ  +LV                 +   LD+TPL +     +EAD ++  E
Sbjct: 295 TKNTAVKPILQNTNLVGTLSFRPILENAKIRMSKNMELDMTPLTLHVAGEEEADDEDDDE 354

Query: 321 -------PKENELDHTDPYLLDIESFCKELGEPRLSFLSKRVNKLSERRMKSVSERIRQM 373
                  P E+++D + P L  IE + KE+    L   ++   + +   +     R+R+ 
Sbjct: 355 YDEETDEPPEDKMDLS-PDLTLIEKYFKEIEHLCLVKDTEEDEEYNNNNVDIFDFRLRKE 413

Query: 374 ESFRDEYHRRWNYHAVPKTLDDHTWEHITNIRYLNLFPLVERFTVKKENERDMTYWSSVV 433
           ES  D++      H   K L D  W+ I N   +NLF LVERFTVK      + YWSSVV
Sbjct: 414 ESLHDKFKEYCQQHEFSKELTDDDWDKIFNSDTMNLFALVERFTVKGSLNEIVHYWSSVV 473

Query: 434 MRNSCRKNETTGVRQCANFACGKWEDYPKRFAKCRRCKRTKYCSRECQLQSWNFHRYWCQ 493
           MRNSCRK+E TGVRQCANF+CGKWED+PK+F KCRRCKRTKYCSR CQL+SW FHRYWCQ
Sbjct: 474 MRNSCRKHEATGVRQCANFSCGKWEDHPKQFPKCRRCKRTKYCSRLCQLKSWEFHRYWCQ 533

Query: 494 E 494
           E
Sbjct: 534 E 534

>Sklu_2430.13 YMR100W, Contig c2430 23178-23793
          Length = 206

 Score =  230 bits (586), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 135/168 (80%)

Query: 1   MRDCNHRCVLLNRPSITITSAVYDRRGLDCNSEIPLINSLNHLTYLTSNSAKVRETVAND 60
           MR+CNHR VLLNR SITITS +YDRR LDC+S++PLINSLNHLTYL SNSAKVRET+A D
Sbjct: 1   MRECNHRSVLLNRASITITSTIYDRRALDCHSDVPLINSLNHLTYLASNSAKVRETIATD 60

Query: 61  GALIRLVSILHDCCISASELPRMQVTGALTLVEKIERERKLAMIAWKWTLAFQCLVLTGT 120
           GAL RLVSILH C +   +L  ++     + +  + ++++LA++AWKWTLAFQCLVLTGT
Sbjct: 61  GALERLVSILHGCYLPLHDLAFIEDRQHDSALLNVVKKKRLAVVAWKWTLAFQCLVLTGT 120

Query: 121 RGTEQIRKQVVSSGVIPILATVLDNYLLLEKNYDYLRNTPLEFDFKKL 168
           RGTE IRK+VV SG+IPILATVLDNYL+  +NYDY ++  L+ DF  +
Sbjct: 121 RGTESIRKEVVKSGIIPILATVLDNYLIYNRNYDYFKDKKLDSDFASV 168

>YOR109W (INP53) [4912] chr15 (525278..528601) Dual functional
           inositol polyphosphate phosphatase [3324 bp, 1107 aa]
          Length = 1107

 Score = 30.0 bits (66), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 205 TDFCTLWNEKLVPDAGDENQVKDDFDNIVVSVPRTFAQGKIVPKADDVIW 254
           T FC + N  L   A +  + + D+++IV  +  TF + K++P  D + W
Sbjct: 697 TSFCFV-NSHLAAGATNVEERRSDYESIVRGI--TFTRTKMIPHHDSIFW 743

>YHL030W (ECM29) [2256] chr8 (40082..45688) Protein that acts to
            associate proteasome 19S regulatory particles with 20S
            core particle forming the 26S proteasome, copurifies as a
            component of the 26S proteasome [5607 bp, 1868 aa]
          Length = 1868

 Score = 30.0 bits (66), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 3/60 (5%)

Query: 184  FQGGLLDKCREFSEPSIMHLKTDFCTLWNEKLVPDAGDE--NQVKDDFDNIV-VSVPRTF 240
            F+   LDKC ++SE  I        T  N+K+V  A D   N  K +FDN+  V +P  F
Sbjct: 1454 FKVSALDKCIKYSEKLITKYFEPTSTENNKKVVGTAIDSILNYAKSEFDNVASVFMPLIF 1513

>Kwal_26.7665
          Length = 551

 Score = 29.6 bits (65), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 52/105 (49%), Gaps = 15/105 (14%)

Query: 159 TPLEFDFKKLLHEKDMACEELVKSRFQGGLLDKCREFSE---PSIMHLKTDFCTLWNEKL 215
           TP +FD +  L E++ A E    SRF+  L  +CREF +   P++    T + +  +++ 
Sbjct: 137 TPGQFDDEHALLEQE-AVELPRMSRFEVELYQRCREFQKMCPPNVTEFGT-YTSASDKQF 194

Query: 216 VPDAGDEN-----QVKDDFDNIVVSVPRTFAQGKIVPKADDVIWS 255
           + D G ++      + D+ D+    +P    Q K+     DV+++
Sbjct: 195 IKDRGVQSYYFLPSINDNVDHYGNFLPSFIVQDKL-----DVLFT 234

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,303,917
Number of extensions: 785732
Number of successful extensions: 2240
Number of sequences better than 10.0: 20
Number of HSP's gapped: 2257
Number of HSP's successfully gapped: 23
Length of query: 557
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 450
Effective length of database: 12,891,983
Effective search space: 5801392350
Effective search space used: 5801392350
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)