Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.764356856027300.0
ABL027W62554719570.0
Scas_721.125*59654418260.0
CAGL0M05203g54731012801e-172
KLLA0B12738g65829812891e-171
YKL125W (RRN3)62731112711e-169
Kwal_27.1007759862711.3
Scas_697.31*10876633.9
CAGL0K12694g36095664.9
YFL039C (ACT1)37595665.1
Scas_713.6*36095665.5
KLLA0D05357g37595656.4
Sklu_2144.536095648.1
ABR222W37695648.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.7643
         (560 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.7643                                                         1056   0.0  
ABL027W [565] [Homologous to ScYKL125W (RRN3) - SH] complement(3...   758   0.0  
Scas_721.125*                                                         707   0.0  
CAGL0M05203g 560851..562494 highly similar to sp|P36070 Saccharo...   497   e-172
KLLA0B12738g 1112500..1114476 similar to sp|P36070 Saccharomyces...   501   e-171
YKL125W (RRN3) [3141] chr11 (207893..209776) RNA polymerase I tr...   494   e-169
Kwal_27.10077                                                          32   1.3  
Scas_697.31*                                                           29   3.9  
CAGL0K12694g 1258546..1259628 highly similar to sp|P02579 Saccha...    30   4.9  
YFL039C (ACT1) [1644] chr6 complement(53260..54377,54686..54695)...    30   5.1  
Scas_713.6*                                                            30   5.5  
KLLA0D05357g join(461726..461735,462516..463633) gi|113297|sp|P1...    30   6.4  
Sklu_2144.5 YFL039C, Contig c2144 6111-7193                            29   8.1  
ABR222W [816] [Homologous to ScYFL039C (ACT1) - SH] complement(8...    29   8.2  

>Kwal_26.7643
          Length = 568

 Score = 1056 bits (2730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/560 (92%), Positives = 518/560 (92%)

Query: 1   MLEPMGVFHLNLTEAGTNIISLQNDASQLNTLASQISLPYGSPDRISADNLSVLLQTLSH 60
           MLEPMGVFHLNLTEAGTNIISLQNDASQLNTLASQISLPYGSPDRISADNLSVLLQTLSH
Sbjct: 1   MLEPMGVFHLNLTEAGTNIISLQNDASQLNTLASQISLPYGSPDRISADNLSVLLQTLSH 60

Query: 61  NVSKLDHQLCTSLIQSIINFEKWWELPAATLGTYIFFIKILCSSLPKWWQDVSLPLISNF 120
           NVSKLDHQLCTSLIQSIINFEKWWELPAATLGTYIFFIKILCSSLPKWWQDVSLPLISNF
Sbjct: 61  NVSKLDHQLCTSLIQSIINFEKWWELPAATLGTYIFFIKILCSSLPKWWQDVSLPLISNF 120

Query: 121 TLPLEHTVQHHEMLKYFLRTIPTCTGYIDSYIARSFPNKNDSKKNLVNYISNVLALTDYC 180
           TLPLEHTVQHHEMLKYFLRTIPTCTGYIDSYIARSFPNKNDSKKNLVNYISNVLALTDYC
Sbjct: 121 TLPLEHTVQHHEMLKYFLRTIPTCTGYIDSYIARSFPNKNDSKKNLVNYISNVLALTDYC 180

Query: 181 NELRFQSWSLVIEKVISIDVELQXXXXXXXXXXXXXXXXXXXXXXXXXXAQLSDVDGDDY 240
           NELRFQSWSLVIEKVISIDVELQ                          AQLSDVDGDDY
Sbjct: 181 NELRFQSWSLVIEKVISIDVELQNELDELDDDMENNIDDLDDEDMNNDEAQLSDVDGDDY 240

Query: 241 XXXXXXXXXXXXXXXXYNVDISQNIKQLSSKLDAILSLITKKLSQSLTAESIENGDGVSI 300
                           YNVDISQNIKQLSSKLDAILSLITKKLSQSLTAESIENGDGVSI
Sbjct: 241 SSAESGEEGMMEGEEEYNVDISQNIKQLSSKLDAILSLITKKLSQSLTAESIENGDGVSI 300

Query: 301 FNTLISLFKSHILPTYYTRSIQYILFHISQQQLELMDAFLVTLIDIAFSPNETIEKRIKS 360
           FNTLISLFKSHILPTYYTRSIQYILFHISQQQLELMDAFLVTLIDIAFSPNETIEKRIKS
Sbjct: 301 FNTLISLFKSHILPTYYTRSIQYILFHISQQQLELMDAFLVTLIDIAFSPNETIEKRIKS 360

Query: 361 LQYIGSFIARAKMLSNTQIIFVASYLTSWLNRYVLEREEEVNQPGGVERFKHFYAAFQAL 420
           LQYIGSFIARAKMLSNTQIIFVASYLTSWLNRYVLEREEEVNQPGGVERFKHFYAAFQAL
Sbjct: 361 LQYIGSFIARAKMLSNTQIIFVASYLTSWLNRYVLEREEEVNQPGGVERFKHFYAAFQAL 420

Query: 421 CYVFCFRHATFRDGDTWECEIDKFFQRMILSKFNPLKYCNENVMLMFARIAQHEGVAYCF 480
           CYVFCFRHATFRDGDTWECEIDKFFQRMILSKFNPLKYCNENVMLMFARIAQHEGVAYCF
Sbjct: 421 CYVFCFRHATFRDGDTWECEIDKFFQRMILSKFNPLKYCNENVMLMFARIAQHEGVAYCF 480

Query: 481 SIIENNNNERMKGIMGKSDSKSPGSIVSSWSLAARQQFIDLQSYFPYDPLFLKNYKRMMK 540
           SIIENNNNERMKGIMGKSDSKSPGSIVSSWSLAARQQFIDLQSYFPYDPLFLKNYKRMMK
Sbjct: 481 SIIENNNNERMKGIMGKSDSKSPGSIVSSWSLAARQQFIDLQSYFPYDPLFLKNYKRMMK 540

Query: 541 GYYIEWSDVSREYESDESDE 560
           GYYIEWSDVSREYESDESDE
Sbjct: 541 GYYIEWSDVSREYESDESDE 560

>ABL027W [565] [Homologous to ScYKL125W (RRN3) - SH]
           complement(348503..350380) [1878 bp, 625 aa]
          Length = 625

 Score =  758 bits (1957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/547 (63%), Positives = 437/547 (79%), Gaps = 11/547 (2%)

Query: 25  DASQLNTLASQISLPYGSPDRISADNLSVLLQTLSHNVSKLDHQLCTSLIQSIINFEKWW 84
           D  +L+T+A+Q+SL   SPDRISA+N ++LL+ L +N++K+D++   +++++++NFEKWW
Sbjct: 74  DTGKLDTIANQLSLSASSPDRISAENFAILLEMLGNNITKIDNKRGVAIVRAVLNFEKWW 133

Query: 85  ELPAATLGTYIFFIKILCSSLPKWWQDVSLPLISNFTLPLEHTVQHHEMLKYFLRTIPTC 144
           +LP  TLG Y+FF++ILCSS+PKWWQDVS+ LISNF LP++ T +HHE+LKYFLR IP+ 
Sbjct: 134 DLPPLTLGNYVFFLQILCSSIPKWWQDVSMLLISNFRLPVDKTTKHHEILKYFLRAIPSS 193

Query: 145 TGYIDSYIARSFPNKNDSKKNLVNYISNVLALTDYCNELRFQSWSLVIEKVISIDVELQX 204
           + +IDSYIA+ FPNKNDSKKNLVNYISNVL LT+YC ELRFQ+WS++IEK+I++DVELQ 
Sbjct: 194 SNFIDSYIAKYFPNKNDSKKNLVNYISNVLTLTEYCEELRFQAWSMIIEKIIAVDVELQN 253

Query: 205 XXXXXXXXXXXXXXXXXXXXXXXXXAQLSDVDGDDYXXXXXXXXX------XXXXXXXYN 258
                                        D D  +                       YN
Sbjct: 254 ELDELDDDVDEEIDDKLADSDDGEDELPGDDDAAEASTHSADDTSFDSEDEQLEGNEEYN 313

Query: 259 VDISQNIKQLSSKLDAILSLITKKLSQSLTAESIENGDGVSIFNTLISLFKSHILPTYYT 318
           +++++NIK+LS KLD ILS++T +LS +LT E++E+G+GV+ FNTL+SLFKSHILPTYYT
Sbjct: 314 IEVTRNIKELSKKLDVILSMLTTRLSDALTPETLESGEGVNTFNTLVSLFKSHILPTYYT 373

Query: 319 RSIQYILFHISQQQLELMDAFLVTLIDIAFSPNETIEKRIKSLQYIGSFIARAKMLSNTQ 378
           RS+QY++FH+SQQQ +LMDAFLVTLIDIAFSPNET+EK+IKSLQY+GSFIARAK L++TQ
Sbjct: 374 RSVQYLMFHVSQQQPQLMDAFLVTLIDIAFSPNETMEKKIKSLQYLGSFIARAKKLTHTQ 433

Query: 379 IIFVASYLTSWLNRYVLEREEEVNQPGGVERFKHFYAAFQALCYVFCFRHATFRDGDTWE 438
           I FVASYLTSWLNRYVLEREEEV+ PGG++RFKHFYAAFQALCY+FCFRHA FRDG+ WE
Sbjct: 434 ITFVASYLTSWLNRYVLEREEEVDLPGGMDRFKHFYAAFQALCYIFCFRHALFRDGNAWE 493

Query: 439 CEIDKFFQRMILSKFNPLKYCNENVMLMFARIAQHEGVAYCFSIIENNNNERMKGIMGKS 498
           C+ID FFQR ++SKFNPLKYCNENVMLMFARIAQHEG+ YCFSIIENNNNER++GIMGKS
Sbjct: 494 CDIDAFFQRTVISKFNPLKYCNENVMLMFARIAQHEGIVYCFSIIENNNNERLRGIMGKS 553

Query: 499 DSKSPG-----SIVSSWSLAARQQFIDLQSYFPYDPLFLKNYKRMMKGYYIEWSDVSREY 553
             +S G        S+WSLAARQQFIDLQSYFPYDPLFLK YK +M+ YYIEWS++S +Y
Sbjct: 554 SERSDGLASATGAASTWSLAARQQFIDLQSYFPYDPLFLKQYKNLMRDYYIEWSEISADY 613

Query: 554 ESDESDE 560
           ESD+S+E
Sbjct: 614 ESDDSNE 620

>Scas_721.125*
          Length = 596

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/544 (63%), Positives = 416/544 (76%), Gaps = 40/544 (7%)

Query: 37  SLPYGSPDRISADNLSVLLQTLSHNVSKLDHQLCTSLIQSIINFEKWWELPAATLGTYIF 96
            +P  S  RI    L++LL  LS+N++++D     +LIQSIINFEKWWELP+ TL  Y+F
Sbjct: 73  GVPTASKLRI----LNILLDVLSNNINRIDSSRGITLIQSIINFEKWWELPSLTLSKYVF 128

Query: 97  FIKILCSSLPKWWQDVSLPLISNFTLPLEHTVQHHEMLKYFLRTIPTCTGYIDSYIARSF 156
           FIKILCSS+PKWWQDVS+ L+SNFTL    T  HH+MLKYFLR IP+  G+ID+Y+A+ F
Sbjct: 129 FIKILCSSIPKWWQDVSMILVSNFTLDTVKTKCHHDMLKYFLRMIPSSMGFIDAYLAKFF 188

Query: 157 PNKNDSKKNLVNYISNVLALTDYCNELRFQSWSLVIEKVISIDVELQXXXXXXXXXXXXX 216
           PNKND+ + LVNYISN+L LTDYC EL+FQ WSL++EK+ISIDVELQ             
Sbjct: 189 PNKNDTSEKLVNYISNILLLTDYCKELKFQVWSLLVEKIISIDVELQNELDELDDEIEED 248

Query: 217 XXXXXXXXXXXXXA---------------QLSDVDGDDYXXXXXXXXXXXXXXXXYNVDI 261
                                        Q  +++GD+                 YNVD+
Sbjct: 249 LEEENEEEEDDEDDDENENELEPKNTIEDQDGEIEGDE----------------EYNVDV 292

Query: 262 SQNIKQLSSKLDAILSLITKKLSQSLTAESIENGDGVSIFNTLISLFKSHILPTYYTRSI 321
           +Q IK+LS+KLD+IL+LIT++++   TAE++E+GDGV++FN L +LFK+HIL TYYTRSI
Sbjct: 293 TQGIKELSTKLDSILTLITERITSEFTAENLESGDGVTLFNILTTLFKTHILSTYYTRSI 352

Query: 322 QYILFHISQQQLELMDAFLVTLIDIAFSPNETIEKRIKSLQYIGSFIARAKMLSNTQIIF 381
           QYI+FH+SQQQLELMD+FLVTLIDIAFSP+E+ EK+IKSLQY+GS+IARAK LS TQIIF
Sbjct: 353 QYIMFHVSQQQLELMDSFLVTLIDIAFSPSESSEKKIKSLQYLGSYIARAKKLSRTQIIF 412

Query: 382 VASYLTSWLNRYVLEREEEVNQPGGVERFKHFYAAFQALCYVFCFRHATFRDGD-TWECE 440
           VASYLTSWLNRYV+EREEEV+QPGG+ERFKHFYA FQALCY+FCFRH+ FRD +  WECE
Sbjct: 413 VASYLTSWLNRYVIEREEEVDQPGGMERFKHFYATFQALCYIFCFRHSIFRDTEGAWECE 472

Query: 441 IDKFFQRMILSKFNPLKYCNENVMLMFARIAQHEGVAYCFSIIENNNNERMKGIMGKSDS 500
           +DKFFQRMI+SKFNPLKYCNENVMLMFARI QHE VAYCFSIIENNNNER++GI+GK D+
Sbjct: 473 LDKFFQRMIISKFNPLKYCNENVMLMFARITQHEDVAYCFSIIENNNNERLRGIIGKVDN 532

Query: 501 K----SPGSIVSSWSLAARQQFIDLQSYFPYDPLFLKNYKRMMKGYYIEWSDVSREYESD 556
                + G   S WSLA RQQFIDLQSYFPYDPLFLKNYK++MK YYIEWS+ S EYESD
Sbjct: 533 DKKEYNTGGSTSGWSLATRQQFIDLQSYFPYDPLFLKNYKKIMKAYYIEWSEASGEYESD 592

Query: 557 ESDE 560
           ESD+
Sbjct: 593 ESDD 596

>CAGL0M05203g 560851..562494 highly similar to sp|P36070
           Saccharomyces cerevisiae YKL125w RRN3 Cter fragment,
           hypothetical start
          Length = 547

 Score =  497 bits (1280), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 230/310 (74%), Positives = 271/310 (87%), Gaps = 6/310 (1%)

Query: 257 YNVDISQNIKQLSSKLDAILSLITKKLSQSLTAESIENGDGVSIFNTLISLFKSHILPTY 316
           YN+D++Q IK+LS+KLDAILSL++ ++ + +T E +E+G+G+  FNTL +LFK+HILPTY
Sbjct: 238 YNIDLTQGIKELSNKLDAILSLLSSEIIKDMTPEKLESGEGIGTFNTLTTLFKTHILPTY 297

Query: 317 YTRSIQYILFHISQQQLELMDAFLVTLIDIAFSPNETIEKRIKSLQYIGSFIARAKMLSN 376
           YTRS+QYI+FH+SQQQLELMD++LVTLIDI+F+ NET EKRIKSLQY+GS+IARAK LS 
Sbjct: 298 YTRSVQYIMFHLSQQQLELMDSYLVTLIDISFAANETSEKRIKSLQYLGSYIARAKKLSR 357

Query: 377 TQIIFVASYLTSWLNRYVLEREEEVNQPGGVERFKHFYAAFQALCYVFCFRHATFRDGD- 435
           TQI+FVASYLTSWLNRYV+EREEEVNQPGG++RFKHFYAAFQALCY+FCFRH   RD D 
Sbjct: 358 TQIVFVASYLTSWLNRYVIEREEEVNQPGGMDRFKHFYAAFQALCYIFCFRHKDLRDVDG 417

Query: 436 TWECEIDKFFQRMILSKFNPLKYCNENVMLMFARIAQHEGVAYCFSIIENNNNERMKGIM 495
           +WECE+DKFF RM++SKFNPLKYCNENVMLMFARIAQ E VAYCFSIIENNNNE ++GIM
Sbjct: 418 SWECELDKFFTRMVISKFNPLKYCNENVMLMFARIAQEEDVAYCFSIIENNNNELLRGIM 477

Query: 496 GKSDSK-----SPGSIVSSWSLAARQQFIDLQSYFPYDPLFLKNYKRMMKGYYIEWSDVS 550
           GK+DS      +P    +SWSLA RQQFIDLQSYFPYDPLFLKNYK MMK YYIEWS+  
Sbjct: 478 GKADSSRGGTPTPMGPATSWSLATRQQFIDLQSYFPYDPLFLKNYKNMMKEYYIEWSEAG 537

Query: 551 REYESDESDE 560
            EYESD SDE
Sbjct: 538 GEYESDGSDE 547

 Score =  252 bits (644), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 116/176 (65%), Positives = 141/176 (80%)

Query: 28  QLNTLASQISLPYGSPDRISADNLSVLLQTLSHNVSKLDHQLCTSLIQSIINFEKWWELP 87
           Q+N + SQISL   +PDRIS  N ++LL+ LS+N++K+D      LIQ IINFEKWWELP
Sbjct: 2   QINAITSQISLSAKNPDRISTKNFTILLEVLSNNINKVDSSKGLPLIQCIINFEKWWELP 61

Query: 88  AATLGTYIFFIKILCSSLPKWWQDVSLPLISNFTLPLEHTVQHHEMLKYFLRTIPTCTGY 147
              LG YIFFIK+LCSS+PKWWQDV++ +IS+F L  E T QHHE+LKYFLR IP+   Y
Sbjct: 62  DPALGKYIFFIKVLCSSIPKWWQDVAMIMISSFILSSEKTTQHHELLKYFLRMIPSSMSY 121

Query: 148 IDSYIARSFPNKNDSKKNLVNYISNVLALTDYCNELRFQSWSLVIEKVISIDVELQ 203
           IDSY+ R FPNKNDSKKN+VNYISNVL LT YC EL+FQ+WSL++E+VISIDVELQ
Sbjct: 122 IDSYLIRYFPNKNDSKKNIVNYISNVLMLTSYCQELKFQAWSLIMERVISIDVELQ 177

>KLLA0B12738g 1112500..1114476 similar to sp|P36070 Saccharomyces
           cerevisiae YKL125w RRN3 RNA polymerase I specific
           transcription factor singleton, start by similarity
          Length = 658

 Score =  501 bits (1289), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 229/298 (76%), Positives = 266/298 (89%), Gaps = 1/298 (0%)

Query: 257 YNVDISQNIKQLSSKLDAILSLITKKLSQSLTAESIENGDGVSIFNTLISLFKSHILPTY 316
           Y VD+S NIK+LSSKLD IL++IT KLS +LT ES+E+GDGV+IFNTL SLFK+HILPTY
Sbjct: 346 YYVDLSHNIKELSSKLDDILAVITSKLSCALTPESLEDGDGVTIFNTLTSLFKTHILPTY 405

Query: 317 YTRSIQYILFHISQQQLELMDAFLVTLIDIAFSPNETIEKRIKSLQYIGSFIARAKMLSN 376
           YTRS+QY++FH+SQQQ ELMDAFLVTLIDI+FSPNET+EK+IKSLQYIGSFIARAK L+ 
Sbjct: 406 YTRSVQYLMFHVSQQQPELMDAFLVTLIDISFSPNETMEKKIKSLQYIGSFIARAKKLTR 465

Query: 377 TQIIFVASYLTSWLNRYVLEREEEVNQPGGVERFKHFYAAFQALCYVFCFRHATFRDG-D 435
           TQI+FV SYLTSWLNRYVLEREEEV+Q GG+ERFKHFYA FQA+CY+FCFRH+  RDG D
Sbjct: 466 TQIVFVTSYLTSWLNRYVLEREEEVDQQGGMERFKHFYAVFQAICYIFCFRHSILRDGND 525

Query: 436 TWECEIDKFFQRMILSKFNPLKYCNENVMLMFARIAQHEGVAYCFSIIENNNNERMKGIM 495
            WEC++DKFFQRM++SKFNPLKYCN NVM+MFA+IAQ+EGV YCFSIIENNNNER++GI 
Sbjct: 526 AWECDLDKFFQRMVISKFNPLKYCNGNVMMMFAKIAQNEGVVYCFSIIENNNNERLRGIT 585

Query: 496 GKSDSKSPGSIVSSWSLAARQQFIDLQSYFPYDPLFLKNYKRMMKGYYIEWSDVSREY 553
           GKS      SI  +WSLA RQQFIDLQSYFPYDPLFL NYK MMK YYIEW++VS++Y
Sbjct: 586 GKSAESGGSSISGTWSLATRQQFIDLQSYFPYDPLFLTNYKSMMKDYYIEWTEVSKDY 643

 Score =  265 bits (678), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 160/203 (78%), Gaps = 8/203 (3%)

Query: 1   MLEPMGVFHLNLTEAGTNIISLQNDASQLNTLASQISLPYGSPDRISADNLSVLLQTLSH 60
           M E   +  L   +AG +        S + +L+ Q+SLP  S DRISADN S+LL+ L +
Sbjct: 65  MFESFVIRALKEIDAGED--------SGIESLSMQVSLPASSADRISADNFSLLLRMLGN 116

Query: 61  NVSKLDHQLCTSLIQSIINFEKWWELPAATLGTYIFFIKILCSSLPKWWQDVSLPLISNF 120
           N++K+D++   ++I+SIINFEKWWELPA TL +YI FI+ILCSSLPKWWQDVS+ LISNF
Sbjct: 117 NITKIDNKRGLTIIRSIINFEKWWELPATTLSSYISFIRILCSSLPKWWQDVSMALISNF 176

Query: 121 TLPLEHTVQHHEMLKYFLRTIPTCTGYIDSYIARSFPNKNDSKKNLVNYISNVLALTDYC 180
            L +  TVQHHEML+YFL+TIP+   +IDSYIA+ FPNKNDSKK L+N+ISNVLALT+YC
Sbjct: 177 QLSMSKTVQHHEMLRYFLKTIPSSVHFIDSYIAKFFPNKNDSKKVLLNFISNVLALTEYC 236

Query: 181 NELRFQSWSLVIEKVISIDVELQ 203
           +ELRFQ+WSLVIEKVISIDVELQ
Sbjct: 237 HELRFQAWSLVIEKVISIDVELQ 259

>YKL125W (RRN3) [3141] chr11 (207893..209776) RNA polymerase I
           transcription factor [1884 bp, 627 aa]
          Length = 627

 Score =  494 bits (1271), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 229/311 (73%), Positives = 272/311 (87%), Gaps = 7/311 (2%)

Query: 257 YNVDISQNIKQLSSKLDAILSLITKKLSQSLTAESIENGDGVSIFNTLISLFKSHILPTY 316
           YNV+++Q IK+LS+KLD+IL+L++  + + +T ES+E+G+GV +FNTL +LFK+H+LPTY
Sbjct: 317 YNVELTQGIKELSTKLDSILTLVSTHVEEQVTPESLESGEGVGVFNTLTTLFKTHVLPTY 376

Query: 317 YTRSIQYILFHISQQQLELMDAFLVTLIDIAFSPNETIEKRIKSLQYIGSFIARAKMLSN 376
           YTRSIQYI+FH+SQQQLELMD+FLVTLIDI+F+ NE  EK+IKSLQY+GS+IARAK LS 
Sbjct: 377 YTRSIQYIMFHVSQQQLELMDSFLVTLIDISFAVNEAAEKKIKSLQYLGSYIARAKKLSR 436

Query: 377 TQIIFVASYLTSWLNRYVLEREEEVNQPGGVERFKHFYAAFQALCYVFCFRHATFRDGD- 435
           TQIIFVASYLTSWLNRYV+EREEEV+Q GG+ERFKHFYAAFQALCY+FCFRH  FRD D 
Sbjct: 437 TQIIFVASYLTSWLNRYVIEREEEVDQRGGMERFKHFYAAFQALCYIFCFRHNIFRDTDG 496

Query: 436 TWECEIDKFFQRMILSKFNPLKYCNENVMLMFARIAQHEGVAYCFSIIENNNNERMKGIM 495
            WECE+DKFFQRM++SKFNPLK+CNENVMLMFARIAQ E VAYCFSIIENNNNER++GI+
Sbjct: 497 NWECELDKFFQRMVISKFNPLKFCNENVMLMFARIAQQESVAYCFSIIENNNNERLRGII 556

Query: 496 GKSDSKS------PGSIVSSWSLAARQQFIDLQSYFPYDPLFLKNYKRMMKGYYIEWSDV 549
           GK+DS          +  SSWSLA RQQFIDLQSYFPYDPLFLKNYK +MK YYIEWS+ 
Sbjct: 557 GKADSDKKENSAQANTTSSSWSLATRQQFIDLQSYFPYDPLFLKNYKILMKEYYIEWSEA 616

Query: 550 SREYESDESDE 560
           S EYESD SD+
Sbjct: 617 SGEYESDGSDD 627

 Score =  245 bits (626), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 110/181 (60%), Positives = 147/181 (81%)

Query: 23  QNDASQLNTLASQISLPYGSPDRISADNLSVLLQTLSHNVSKLDHQLCTSLIQSIINFEK 82
           +ND++Q+  +A+Q++LP  +P+RI+  NL++LL  LS N+++++    T LIQSIINFEK
Sbjct: 65  KNDSTQIGIIANQVALPSKNPERINDKNLNILLDILSSNINRIESSRGTFLIQSIINFEK 124

Query: 83  WWELPAATLGTYIFFIKILCSSLPKWWQDVSLPLISNFTLPLEHTVQHHEMLKYFLRTIP 142
           WWELP  TL  YI+FIKILCSS+PKWWQDVS+ L+S F LP++ TV HH+MLKYFLR IP
Sbjct: 125 WWELPPHTLSKYIYFIKILCSSIPKWWQDVSMILVSCFILPIKQTVCHHDMLKYFLRMIP 184

Query: 143 TCTGYIDSYIARSFPNKNDSKKNLVNYISNVLALTDYCNELRFQSWSLVIEKVISIDVEL 202
           +  G+ID+Y+A+ FPNKND+++ LVNY SN+L L  YC+EL FQ WSL+IEK+ISIDVEL
Sbjct: 185 SSMGFIDTYLAKFFPNKNDTRRKLVNYTSNLLKLRGYCSELGFQIWSLLIEKIISIDVEL 244

Query: 203 Q 203
           Q
Sbjct: 245 Q 245

>Kwal_27.10077
          Length = 598

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 34/62 (54%), Gaps = 10/62 (16%)

Query: 12  LTEAGTNIISLQNDASQLNT----LASQISLPYGSPDRISADNLSVLLQTLSHNVSKLDH 67
           +T+   NI  LQN   QLNT    L++QI    G    IS +N++ L +TLS N +  DH
Sbjct: 202 ITQISANIAKLQN---QLNTGNDDLSAQIRDTLGG---ISVENMNKLARTLSKNRALNDH 255

Query: 68  QL 69
            L
Sbjct: 256 TL 257

>Scas_697.31*
          Length = 108

 Score = 28.9 bits (63), Expect = 3.9,   Method: Composition-based stats.
 Identities = 25/76 (32%), Positives = 35/76 (46%), Gaps = 23/76 (30%)

Query: 484 ENNNNERMKGIMGKSDSKSPGSIVSSWSLAARQQFIDLQSYFPYDPL-FLKNYKRMMKG- 541
           + NN+ R + +    D K+PGS                  YFP DP+  L  YK +MKG 
Sbjct: 10  KGNNSNRKQDVNFTPDEKNPGSY----------------KYFPDDPVQGLNKYKFIMKGD 53

Query: 542 --YY---IEWSDVSRE 552
             YY    E S++SR+
Sbjct: 54  SEYYDPCQECSEMSRK 69

>CAGL0K12694g 1258546..1259628 highly similar to sp|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin, start by
           similarity
          Length = 360

 Score = 30.0 bits (66), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 42/95 (44%), Gaps = 14/95 (14%)

Query: 264 NIKQLSSKLDAILSLITKKLSQSLTAESIENGDGVSIFNTLISLFKSHILPTYYTRSIQY 323
           N+      + A+LSL +   S   T   +++GDGV+           H++P Y   S+ +
Sbjct: 113 NVPAFYVSIQAVLSLYS---SGRTTGIVLDSGDGVT-----------HVVPIYAGFSLPH 158

Query: 324 ILFHISQQQLELMDAFLVTLIDIAFSPNETIEKRI 358
            +  I     +L D  +  L +  +S + T E+ I
Sbjct: 159 AILRIDLAGRDLTDYLMKILSERGYSFSTTAEREI 193

>YFL039C (ACT1) [1644] chr6 complement(53260..54377,54686..54695)
           Actin, involved in cell polarization, endocytosis, and
           other cytoskeletal functions [1128 bp, 375 aa]
          Length = 375

 Score = 30.0 bits (66), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 42/95 (44%), Gaps = 14/95 (14%)

Query: 264 NIKQLSSKLDAILSLITKKLSQSLTAESIENGDGVSIFNTLISLFKSHILPTYYTRSIQY 323
           N+      + A+LSL +   S   T   +++GDGV+           H++P Y   S+ +
Sbjct: 128 NVPAFYVSIQAVLSLYS---SGRTTGIVLDSGDGVT-----------HVVPIYAGFSLPH 173

Query: 324 ILFHISQQQLELMDAFLVTLIDIAFSPNETIEKRI 358
            +  I     +L D  +  L +  +S + T E+ I
Sbjct: 174 AILRIDLAGRDLTDYLMKILSERGYSFSTTAEREI 208

>Scas_713.6*
          Length = 360

 Score = 30.0 bits (66), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 42/95 (44%), Gaps = 14/95 (14%)

Query: 264 NIKQLSSKLDAILSLITKKLSQSLTAESIENGDGVSIFNTLISLFKSHILPTYYTRSIQY 323
           N+      + A+LSL +   S   T   +++GDGV+           H++P Y   S+ +
Sbjct: 113 NVPAFYVSIQAVLSLYS---SGRTTGIVLDSGDGVT-----------HVVPIYAGFSLPH 158

Query: 324 ILFHISQQQLELMDAFLVTLIDIAFSPNETIEKRI 358
            +  I     +L D  +  L +  +S + T E+ I
Sbjct: 159 AILRIDLAGRDLTDYLMKILSERGYSFSTTAEREI 193

>KLLA0D05357g join(461726..461735,462516..463633)
           gi|113297|sp|P17128|ACT_KLULA Kluyveromyces lactis
           ACTIN, start by similarity
          Length = 375

 Score = 29.6 bits (65), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 42/95 (44%), Gaps = 14/95 (14%)

Query: 264 NIKQLSSKLDAILSLITKKLSQSLTAESIENGDGVSIFNTLISLFKSHILPTYYTRSIQY 323
           N+      + A+LSL +   S   T   +++GDGV+           H++P Y   S+ +
Sbjct: 128 NVPAFYVSIQAVLSLYS---SGRTTGIVLDSGDGVT-----------HVVPIYAGFSLPH 173

Query: 324 ILFHISQQQLELMDAFLVTLIDIAFSPNETIEKRI 358
            +  I     ++ D  +  L +  +S + T E+ I
Sbjct: 174 AILRIDLAGRDITDYLMKILAERGYSFSTTAEREI 208

>Sklu_2144.5 YFL039C, Contig c2144 6111-7193
          Length = 360

 Score = 29.3 bits (64), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 42/95 (44%), Gaps = 14/95 (14%)

Query: 264 NIKQLSSKLDAILSLITKKLSQSLTAESIENGDGVSIFNTLISLFKSHILPTYYTRSIQY 323
           N+      + A+LSL +   S   T   +++GDGV+           H++P Y   S+ +
Sbjct: 113 NVPAFYVSIQAVLSLYS---SGRTTGIVLDSGDGVT-----------HVVPIYAGFSLPH 158

Query: 324 ILFHISQQQLELMDAFLVTLIDIAFSPNETIEKRI 358
            +  I     ++ D  +  L +  +S + T E+ I
Sbjct: 159 AILRIDLAGRDMTDYLMKILSERGYSFSTTAEREI 193

>ABR222W [816] [Homologous to ScYFL039C (ACT1) - SH]
           complement(818717..818726,819030..820150) [1131 bp, 376
           aa]
          Length = 376

 Score = 29.3 bits (64), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 42/95 (44%), Gaps = 14/95 (14%)

Query: 264 NIKQLSSKLDAILSLITKKLSQSLTAESIENGDGVSIFNTLISLFKSHILPTYYTRSIQY 323
           N+      + A+LSL +   S   T   +++GDGV+           H++P Y   S+ +
Sbjct: 129 NVPAFYVSIQAVLSLYS---SGRTTGIVLDSGDGVT-----------HVVPIYAGFSLPH 174

Query: 324 ILFHISQQQLELMDAFLVTLIDIAFSPNETIEKRI 358
            +  I     ++ D  +  L +  +S + T E+ I
Sbjct: 175 AILRIDLAGRDMTDYLMKILSERGYSFSTTAEREI 209

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,264,242
Number of extensions: 723450
Number of successful extensions: 2117
Number of sequences better than 10.0: 24
Number of HSP's gapped: 2161
Number of HSP's successfully gapped: 29
Length of query: 560
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 453
Effective length of database: 12,891,983
Effective search space: 5840068299
Effective search space used: 5840068299
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)