Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.763569168134300.0
ABL028W72271224780.0
Scas_721.12468465323450.0
Scas_717.6967464923040.0
CAGL0K03399g70357622670.0
KLLA0B12716g71655322680.0
CAGL0K07458g70470719970.0
Kwal_47.167617443729131e-112
ADL389W7113509011e-111
Scas_703.57493538991e-110
KLLA0B03586g7343498881e-109
CAGL0F09075g7463528861e-108
KLLA0B07205g4553017062e-85
CAGL0M08404g4623046992e-84
Scas_651.183713066887e-84
Scas_689.25*4093006873e-83
Kwal_33.138463753146825e-83
CAGL0G09020g3612956772e-82
Kwal_56.240593533096735e-82
AFL090W3462956595e-80
KLLA0D03190g3722956512e-78
Scas_690.133542956483e-78
KLLA0E06413g11613286933e-78
CAGL0M09361g11443286906e-78
ACR191C11493356872e-77
Kwal_27.1058111543306844e-77
Scas_715.3411503306845e-77
AEL115C3862926409e-77
YBL105C (PKC1)11513356811e-76
YCR091W (KIN82)7202985721e-63
CAGL0C03509g8953215782e-63
Scas_629.169183015772e-63
Kwal_23.64588683215701e-62
CAGL0J06072g7733585626e-62
Kwal_56.227885153865433e-61
ADR167W8733135533e-60
KLLA0C18568g7743015485e-60
KLLA0F24618g5563525252e-58
Scas_720.1038043085363e-58
YBR028C5253605199e-58
CAGL0B04301g5423875163e-57
AEL083W5363465092e-56
Scas_593.14d4952784941e-54
CAGL0E05720g3582684482e-49
AFL101C3672634403e-48
Kwal_56.240913812694273e-46
KLLA0B02332g3612634253e-46
Kwal_23.39925713434286e-45
CAGL0B04147g5663734242e-44
Scas_705.235533754223e-44
CAGL0G03047g5393714135e-43
KLLA0E03487g6472844151e-42
KLLA0C12485g9252914172e-42
Scas_660.209572904164e-42
Scas_716.335733754057e-42
YDR490C (PKH1)7662974101e-41
KLLA0D14905g5673534012e-41
ADR033W5773433979e-41
Scas_627.73492633831e-40
Kwal_56.226939842734022e-40
CAGL0I07513g10762934005e-40
YDR466W (PKH3)8983093986e-40
AFR377C7262873941e-39
CAGL0G04609g9653103898e-39
KLLA0F13552g12672983835e-38
AFR335C10333453827e-38
Kwal_33.145547143703788e-38
ABL034W14252673792e-37
Kwal_47.183076212713733e-37
CAGL0K06479g9913123721e-36
KLLA0D07810g7181583691e-36
AFR035W7191473664e-36
Scas_618.84272523555e-36
Scas_502.211163623667e-36
Scas_654.127371483639e-36
KLLA0F11319g8432873631e-35
Scas_616.1014613223642e-35
Kwal_26.778812672703622e-35
CAGL0M08910g6123053546e-35
Kwal_47.182335983183511e-34
CAGL0J11638g7463063541e-34
CAGL0J03872g6612853476e-34
AAR009W4532513397e-34
Scas_660.286232813459e-34
KLLA0E01584g4152833379e-34
AEL230W6082903441e-33
Kwal_26.87098293073471e-33
Kwal_26.87967962713461e-33
YDL101C (DUN1)5132903402e-33
YDR477W (SNF1)6332503432e-33
Kwal_33.131125052683382e-33
ACL006W7082463432e-33
ACR133C8512613434e-33
Scas_693.1710493263426e-33
Kwal_0.964272593317e-33
Scas_700.348642903391e-32
KLLA0C06138g7082463371e-32
KLLA0A03806g6022733352e-32
CAGL0K08514g14892123382e-32
CAGL0L07326g5062913303e-32
Scas_644.157262773353e-32
CAGL0M02519g7563113344e-32
AFR696C11422823355e-32
CAGL0M02233g7673093336e-32
KLLA0F11143g8132683336e-32
CAGL0F04741g4422563246e-32
Scas_700.546983263291e-31
YDR507C (GIN4)11422833267e-31
Kwal_56.224766972693237e-31
AFR724C4402653159e-31
CAGL0K05709g11032773241e-30
ACR142W8372733221e-30
KLLA0F23155g4272523132e-30
Scas_564.712103353203e-30
YFR014C (CMK1)4462473104e-30
CAGL0L11550g10722463161e-29
KLLA0C01650g11122983151e-29
AGR058W10713603132e-29
Scas_493.211172823123e-29
Scas_201.1*2742182934e-29
ACR119W9312743105e-29
KLLA0D07348g9092623096e-29
Kwal_23.35904993343037e-29
Scas_700.288962613088e-29
Scas_640.14*7282723061e-28
CAGL0K10604g4462463001e-28
KLLA0F19536g11043373081e-28
CAGL0B01925g9443013052e-28
Scas_613.55172883002e-28
CAGL0M11396g11923103043e-28
CAGL0M02299g8932683033e-28
ACL104C9472453025e-28
Kwal_26.87518482953016e-28
YDR122W (KIN1)10642903016e-28
Scas_707.369153283007e-28
CAGL0K12562g16821522982e-27
AER223C9022162963e-27
AFL188C4722892893e-27
YCL024W (KCC4)10372812944e-27
Scas_580.610152602936e-27
Kwal_55.215458652452918e-27
YFL033C (RIM15)17701662921e-26
KLLA0E21780g10162562901e-26
Kwal_47.172528722992892e-26
ACR218W15691702892e-26
Scas_685.245152662832e-26
KLLA0F09020g9281642873e-26
YDR523C (SPS1)4902472814e-26
KLLA0C04191g7972592854e-26
Scas_713.79832692865e-26
Scas_673.20*7582552837e-26
Kwal_14.115915211652841e-25
CAGL0C05005g10762412831e-25
YGL158W (RCK1)5123052781e-25
Scas_582.16383092801e-25
KLLA0C00979g4832682743e-25
Kwal_0.1555873202763e-25
CAGL0L05632g6773092774e-25
CAGL0K02167g11623352784e-25
AFL217C6913082755e-25
KLLA0F09031g6331492747e-25
CAGL0I09504g5282842727e-25
KLLA0C08525g15512732751e-24
Kwal_27.97638682222741e-24
Scas_707.315981572751e-24
CAGL0L06006g9422902722e-24
YGL180W (ATG1)8973102722e-24
Kwal_56.237178582392703e-24
YAR019C (CDC15)9742542703e-24
CAGL0J00539g4883132629e-24
CAGL0F00649g5143242621e-23
ACL054W9723002661e-23
Kwal_23.632515422752652e-23
Scas_573.105693152602e-23
CAGL0H01639g5212492593e-23
KLLA0E15378g7243082623e-23
KLLA0C17160g8312982614e-23
Scas_711.2515152652615e-23
Scas_618.156203552585e-23
CAGL0M10153g8672702571e-22
ADR379C4923072513e-22
CAGL0K02673g9152652543e-22
Kwal_47.1726311273302543e-22
Kwal_33.140815803392513e-22
Kwal_27.97734062852473e-22
Kwal_26.78619552592534e-22
KLLA0F12188g5463082495e-22
CAGL0M11748g4473382476e-22
AER264C14832102526e-22
Kwal_56.238414323382441e-21
Scas_675.25272852471e-21
Scas_668.228932422491e-21
CAGL0B03509g5972962462e-21
CAGL0M03729g8612382472e-21
YGL179C (TOS3)5603132443e-21
CAGL0J03828g4672082423e-21
ABR014W9712002453e-21
KLLA0B13607g9892012453e-21
Kwal_26.87034442052404e-21
KLLA0F23507g4872252414e-21
KLLA0A07403g8792042445e-21
Kwal_26.735514462662455e-21
ACR117W5242072415e-21
Scas_619.5*5102972406e-21
KLLA0D07304g4652072396e-21
Scas_713.384323382386e-21
KLLA0B11902g4953172398e-21
Kwal_23.52908192032419e-21
Scas_598.67902752411e-20
KLLA0F20053g4443382371e-20
Kwal_55.220013633522331e-20
YCR073C (SSK22)13312622402e-20
AEL284C4792412343e-20
AEL205W7932032373e-20
Scas_713.216413052363e-20
CAGL0D02244g4872752343e-20
ACL053C11813692374e-20
CAGL0F00913g12062682374e-20
Scas_688.144793132326e-20
KLLA0F01276g5192792327e-20
AGR048C4533382308e-20
Scas_707.349053132331e-19
Scas_640.165052852301e-19
AER222C4233222271e-19
ADL315C4343282271e-19
KLLA0D09328g10463352322e-19
Kwal_55.203267502572302e-19
KLLA0E11979g6142032292e-19
KLLA0F14190g13382712312e-19
CAGL0L03520g14472652312e-19
Kwal_27.125594143102243e-19
Scas_720.9416832692303e-19
Scas_602.1111863912293e-19
Scas_680.204823032254e-19
AFR092W14232652285e-19
Scas_700.354392042235e-19
Kwal_23.55765043162245e-19
CAGL0J04290g3573082206e-19
Scas_683.63773082207e-19
Scas_643.2010822562268e-19
Kwal_33.132221481132069e-19
AAL029W5343112221e-18
YER129W (PAK1)11422842251e-18
Scas_623.113782082171e-18
AFR205C4572922192e-18
Kwal_26.715412132752232e-18
CAGL0I04422g4222762182e-18
AER232C5693042202e-18
CAGL0I03498g4513292183e-18
KLLA0E14828g3102022123e-18
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.7635
         (681 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.7635                                                         1325   0.0  
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...   959   0.0  
Scas_721.124                                                          907   0.0  
Scas_717.69                                                           892   0.0  
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...   877   0.0  
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...   878   0.0  
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...   773   0.0  
Kwal_47.16761                                                         356   e-112
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...   351   e-111
Scas_703.5                                                            350   e-110
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...   346   e-109
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...   345   e-108
KLLA0B07205g complement(624606..625973) some similarities with s...   276   2e-85
CAGL0M08404g complement(836791..838179) some similarities with s...   273   2e-84
Scas_651.18                                                           269   7e-84
Scas_689.25*                                                          269   3e-83
Kwal_33.13846                                                         267   5e-83
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...   265   2e-82
Kwal_56.24059                                                         263   5e-82
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...   258   5e-80
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...   255   2e-78
Scas_690.13                                                           254   3e-78
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....   271   3e-78
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...   270   6e-78
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...   269   2e-77
Kwal_27.10581                                                         268   4e-77
Scas_715.34                                                           268   5e-77
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...   251   9e-77
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...   266   1e-76
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...   224   1e-63
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...   227   2e-63
Scas_629.16                                                           226   2e-63
Kwal_23.6458                                                          224   1e-62
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...   221   6e-62
Kwal_56.22788                                                         213   3e-61
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...   217   3e-60
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...   215   5e-60
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...   206   2e-58
Scas_720.103                                                          211   3e-58
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...   204   9e-58
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...   203   3e-57
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....   200   2e-56
Scas_593.14d                                                          194   1e-54
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...   177   2e-49
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...   174   3e-48
Kwal_56.24091                                                         169   3e-46
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...   168   3e-46
Kwal_23.3992                                                          169   6e-45
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...   167   2e-44
Scas_705.23                                                           167   3e-44
CAGL0G03047g 282299..283918 highly similar to sp|P22204 Saccharo...   163   5e-43
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...   164   1e-42
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...   165   2e-42
Scas_660.20                                                           164   4e-42
Scas_716.33                                                           160   7e-42
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...   162   1e-41
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...   159   2e-41
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...   157   9e-41
Scas_627.7                                                            152   1e-40
Kwal_56.22693                                                         159   2e-40
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...   158   5e-40
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...   157   6e-40
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...   156   1e-39
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...   154   8e-39
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...   152   5e-38
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...   151   7e-38
Kwal_33.14554                                                         150   8e-38
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...   150   2e-37
Kwal_47.18307                                                         148   3e-37
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...   147   1e-36
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...   146   1e-36
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...   145   4e-36
Scas_618.8                                                            141   5e-36
Scas_502.2                                                            145   7e-36
Scas_654.12                                                           144   9e-36
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...   144   1e-35
Scas_616.10                                                           144   2e-35
Kwal_26.7788                                                          144   2e-35
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...   140   6e-35
Kwal_47.18233                                                         139   1e-34
CAGL0J11638g complement(1128620..1130860) highly similar to sp|P...   140   1e-34
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...   138   6e-34
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...   135   7e-34
Scas_660.28                                                           137   9e-34
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...   134   9e-34
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...   137   1e-33
Kwal_26.8709                                                          138   1e-33
Kwal_26.8796                                                          137   1e-33
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...   135   2e-33
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...   136   2e-33
Kwal_33.13112                                                         134   2e-33
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...   136   2e-33
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...   136   4e-33
Scas_693.17                                                           136   6e-33
Kwal_0.96                                                             132   7e-33
Scas_700.34                                                           135   1e-32
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...   134   1e-32
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....   133   2e-32
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...   134   2e-32
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...   131   3e-32
Scas_644.15                                                           133   3e-32
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...   133   4e-32
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...   133   5e-32
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...   132   6e-32
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...   132   6e-32
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...   129   6e-32
Scas_700.54                                                           131   1e-31
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...   130   7e-31
Kwal_56.22476                                                         129   7e-31
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...   125   9e-31
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...   129   1e-30
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...   128   1e-30
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...   125   2e-30
Scas_564.7                                                            127   3e-30
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...   124   4e-30
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...   126   1e-29
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...   125   1e-29
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...   125   2e-29
Scas_493.2                                                            124   3e-29
Scas_201.1*                                                           117   4e-29
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...   124   5e-29
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...   123   6e-29
Kwal_23.3590                                                          121   7e-29
Scas_700.28                                                           123   8e-29
Scas_640.14*                                                          122   1e-28
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...   120   1e-28
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...   123   1e-28
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...   122   2e-28
Scas_613.5                                                            120   2e-28
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...   121   3e-28
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...   121   3e-28
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...   120   5e-28
Kwal_26.8751                                                          120   6e-28
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...   120   6e-28
Scas_707.36                                                           120   7e-28
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...   119   2e-27
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....   118   3e-27
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...   115   3e-27
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...   117   4e-27
Scas_580.6                                                            117   6e-27
Kwal_55.21545                                                         116   8e-27
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...   117   1e-26
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...   116   1e-26
Kwal_47.17252                                                         115   2e-26
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...   115   2e-26
Scas_685.24                                                           113   2e-26
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...   115   3e-26
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...   112   4e-26
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...   114   4e-26
Scas_713.7                                                            114   5e-26
Scas_673.20*                                                          113   7e-26
Kwal_14.1159                                                          114   1e-25
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...   113   1e-25
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...   111   1e-25
Scas_582.1                                                            112   1e-25
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...   110   3e-25
Kwal_0.155                                                            110   3e-25
CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces c...   111   4e-25
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...   111   4e-25
AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..328...   110   5e-25
KLLA0F09031g 839103..841004 similar to sp|P43565 Saccharomyces c...   110   7e-25
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...   109   7e-25
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...   110   1e-24
Kwal_27.9763                                                          110   1e-24
Scas_707.3                                                            110   1e-24
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...   109   2e-24
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...   109   2e-24
Kwal_56.23717                                                         108   3e-24
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...   108   3e-24
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...   105   9e-24
CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces cer...   105   1e-23
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...   107   1e-23
Kwal_23.6325                                                          106   2e-23
Scas_573.10                                                           104   2e-23
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...   104   3e-23
KLLA0E15378g 1362851..1365025 some similarities with sp|P08018 S...   105   3e-23
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...   105   4e-23
Scas_711.25                                                           105   5e-23
Scas_618.15                                                           103   5e-23
CAGL0M10153g complement(1010688..1013291) some similarities with...   103   1e-22
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...   101   3e-22
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...   102   3e-22
Kwal_47.17263                                                         102   3e-22
Kwal_33.14081                                                         101   3e-22
Kwal_27.9773                                                          100   3e-22
Kwal_26.7861                                                          102   4e-22
KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces...   100   5e-22
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...   100   6e-22
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...   101   6e-22
Kwal_56.23841                                                          99   1e-21
Scas_675.2                                                            100   1e-21
Scas_668.22                                                           100   1e-21
CAGL0B03509g complement(349638..351431) similar to sp|P38623 Sac...    99   2e-21
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...   100   2e-21
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    99   3e-21
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    98   3e-21
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    99   3e-21
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    99   3e-21
Kwal_26.8703                                                           97   4e-21
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    97   4e-21
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    99   5e-21
Kwal_26.7355                                                           99   5e-21
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    97   5e-21
Scas_619.5*                                                            97   6e-21
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    97   6e-21
Scas_713.38                                                            96   6e-21
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    97   8e-21
Kwal_23.5290                                                           97   9e-21
Scas_598.6                                                             97   1e-20
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    96   1e-20
Kwal_55.22001                                                          94   1e-20
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    97   2e-20
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    95   3e-20
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    96   3e-20
Scas_713.21                                                            96   3e-20
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    95   3e-20
ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C (T...    96   4e-20
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    96   4e-20
Scas_688.14                                                            94   6e-20
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    94   7e-20
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    93   8e-20
Scas_707.34                                                            94   1e-19
Scas_640.16                                                            93   1e-19
AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH] (1043479..1...    92   1e-19
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    92   1e-19
KLLA0D09328g complement(788565..791705) some similarities with s...    94   2e-19
Kwal_55.20326                                                          93   2e-19
KLLA0E11979g complement(1060048..1061892) some similarities with...    93   2e-19
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    94   2e-19
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    94   2e-19
Kwal_27.12559                                                          91   3e-19
Scas_720.94                                                            93   3e-19
Scas_602.11                                                            93   3e-19
Scas_680.20                                                            91   4e-19
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    92   5e-19
Scas_700.35                                                            91   5e-19
Kwal_23.5576                                                           91   5e-19
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...    89   6e-19
Scas_683.6                                                             89   7e-19
Scas_643.20                                                            92   8e-19
Kwal_33.13222                                                          84   9e-19
AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W (R...    90   1e-18
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    91   1e-18
Scas_623.11                                                            88   1e-18
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    89   2e-18
Kwal_26.7154                                                           91   2e-18
CAGL0I04422g 394159..395427 some similarities with sp|P22209 Sac...    89   2e-18
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    89   2e-18
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    89   3e-18
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...    86   3e-18
Scas_548.6                                                             90   3e-18
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    89   3e-18
CAGL0L07810g complement(857656..859446) similar to sp|P25333 Sac...    89   5e-18
Scas_633.29                                                            89   5e-18
YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine prot...    88   6e-18
CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces c...    89   7e-18
Kwal_14.2497                                                           87   7e-18
KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces c...    86   7e-18
Kwal_23.4276                                                           87   8e-18
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...    86   1e-17
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...    84   1e-17
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    87   2e-17
Scas_568.9*                                                            84   2e-17
Scas_628.9                                                             86   2e-17
Kwal_0.307                                                             86   3e-17
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    86   3e-17
Scas_477.5                                                             86   4e-17
Scas_710.28                                                            84   4e-17
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    86   4e-17
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    86   4e-17
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    84   5e-17
Scas_651.3                                                             86   5e-17
Kwal_33.14167                                                          86   6e-17
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...    82   6e-17
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...    83   8e-17
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    83   8e-17
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    83   9e-17
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    84   1e-16
Scas_544.6                                                             84   1e-16
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...    82   1e-16
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    83   1e-16
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    84   2e-16
Kwal_33.13831                                                          83   2e-16
Kwal_14.1416                                                           82   2e-16
Kwal_33.13984                                                          83   3e-16
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    81   3e-16
Kwal_17.2687                                                           81   3e-16
CAGL0K01617g complement(142479..144803) similar to sp|P54199 Sac...    83   3e-16
YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine prote...    83   4e-16
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    83   4e-16
Kwal_26.7552                                                           82   5e-16
AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH] (1005431..1...    81   6e-16
Kwal_47.17868                                                          80   6e-16
Scas_721.110                                                           81   7e-16
YAR018C (KIN3) [73] chr1 complement(170393..171700) Serine/threo...    81   7e-16
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...    79   7e-16
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    81   9e-16
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    82   9e-16
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    81   9e-16
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...    81   1e-15
Kwal_27.11803                                                          77   1e-15
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...    79   1e-15
Scas_635.1                                                             79   2e-15
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...    78   2e-15
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    80   2e-15
KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces c...    80   2e-15
Scas_634.5                                                             80   4e-15
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...    78   4e-15
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    78   4e-15
Scas_721.46                                                            77   4e-15
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    79   5e-15
ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH] (797020..79...    79   5e-15
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...    76   6e-15
KLLA0B07579g 659591..661759 weakly similar to sp|P32944 Saccharo...    79   6e-15
Kwal_14.1273                                                           77   7e-15
Scas_613.13*                                                           76   8e-15
KLLA0A09713g 851952..853625 similar to sp|Q03533 Saccharomyces c...    78   8e-15
Kwal_23.5668                                                           79   8e-15
Scas_716.73                                                            77   9e-15
Kwal_26.8347                                                           78   9e-15
Kwal_56.24584                                                          77   1e-14
ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH] (1263082..1...    78   1e-14
CAGL0K00693g complement(74637..77267) similar to sp|P32944 Sacch...    78   1e-14
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    77   1e-14
Scas_678.13                                                            76   2e-14
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...    75   2e-14
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    75   3e-14
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    77   3e-14
Scas_667.18                                                            75   4e-14
Scas_721.132                                                           75   6e-14
Scas_336.1                                                             75   7e-14
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...    73   7e-14
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    73   8e-14
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...    73   1e-13
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    74   2e-13
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...    73   2e-13
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...    73   2e-13
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    74   3e-13
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    73   5e-13
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    70   5e-13
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...    72   7e-13
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    72   8e-13
KLLA0C16577g complement(1451181..1452695) some similarities with...    71   1e-12
Kwal_27.11919                                                          68   1e-12
Scas_678.24                                                            71   2e-12
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    69   2e-12
CAGL0F03245g complement(316924..320034) similar to sp|P32361 Sac...    70   3e-12
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...    70   3e-12
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    70   3e-12
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    70   3e-12
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    69   5e-12
Scas_651.19                                                            69   6e-12
Kwal_26.7682                                                           69   7e-12
AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH] (348350..35...    69   1e-11
Kwal_23.3471                                                           65   2e-11
Scas_684.28                                                            68   2e-11
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    67   2e-11
Scas_649.30                                                            67   2e-11
Kwal_33.13681                                                          67   3e-11
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    66   4e-11
ADL043C [1698] [Homologous to ScYLL019C (KNS1) - SH] (612091..61...    66   6e-11
Scas_648.17                                                            64   7e-11
Kwal_33.14434                                                          65   8e-11
KLLA0A06820g complement(615686..618004) some similarities with s...    65   9e-11
CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces c...    65   9e-11
Kwal_27.10004                                                          65   1e-10
Scas_689.24                                                            65   1e-10
Scas_718.90                                                            64   2e-10
AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C (...    64   2e-10
ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH] (503670..50...    63   2e-10
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    62   3e-10
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    62   7e-10
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    61   7e-10
Kwal_26.7276                                                           62   8e-10
KLLA0F22297g complement(2083448..2085547) some similarities with...    62   9e-10
ADR163W [1905] [Homologous to ScYDR247W - SH; ScYPL026C (SKS1) -...    61   1e-09
KLLA0F02838g 264329..266596 some similarities with sp|P32581 Sac...    62   1e-09
Scas_711.15                                                            62   1e-09
CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces...    61   1e-09
Scas_677.18                                                            62   1e-09
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    60   2e-09
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    60   2e-09
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    61   2e-09
CAGL0I05390g complement(508677..510041) similar to sp|Q12505 Sac...    61   2e-09
Scas_683.12                                                            60   2e-09
Scas_610.7                                                             61   2e-09
CAGL0I06248g 600351..602792 similar to sp|P38970 Saccharomyces c...    61   2e-09
CAGL0I05192g complement(493635..494756) highly similar to sp|P15...    60   3e-09
Scas_22.1                                                              59   3e-09
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...    60   3e-09
Scas_673.34*                                                           60   3e-09
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    60   4e-09
Scas_568.13                                                            60   4e-09
AFR076W [3268] [Homologous to ScYJL106W (IME2) - SH] complement(...    60   4e-09
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...    60   5e-09
KLLA0C03938g complement(358851..360632) some similarities with s...    59   6e-09
Scas_704.50                                                            59   6e-09
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...    59   7e-09
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    58   7e-09
Scas_653.25                                                            59   7e-09
Scas_654.17                                                            59   8e-09
Kwal_27.11777                                                          59   8e-09
AFR372W [3564] [Homologous to ScYJR059W (PTK2 ) - SH] complement...    59   9e-09
Kwal_47.18098                                                          58   9e-09
YDR247W (VHS1) [1081] chr4 (956005..957390) Serine/threonine pro...    58   1e-08
Kwal_27.11830                                                          59   1e-08
CAGL0H01837g complement(176352..178736) tr|Q9C1R8 Candida glabra...    59   1e-08
AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH] (234347..23...    58   1e-08
CAGL0M13167g complement(1291524..1293356) similar to sp|P32801 S...    58   1e-08
KLLA0F01507g 144356..145774 some similarities with sp|P47042 Sac...    58   1e-08
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    57   1e-08
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    58   2e-08
CAGL0H09152g complement(895722..898055) similar to sp|P47116 Sac...    58   2e-08
Kwal_55.20189                                                          58   2e-08
Scas_695.33                                                            58   2e-08
CAGL0D06600g 626571..628748 similar to tr|Q12399 Saccharomyces c...    58   2e-08
Kwal_55.21709                                                          57   2e-08
KLLA0D11814g complement(1007240..1009021) similar to sp|P39073 S...    57   2e-08
Scas_671.16                                                            57   2e-08
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    57   3e-08
Scas_697.12                                                            57   3e-08
Kwal_33.14192                                                          57   3e-08
AFR040W [3232] [Homologous to ScYHR135C (YCK1) - SH; ScYNL154C (...    57   4e-08
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...    57   4e-08
KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183 Sacch...    55   5e-08
Kwal_33.14596                                                          56   5e-08
CAGL0G06138g complement(585585..587204) similar to sp|P23291 Sac...    56   5e-08
Scas_698.37                                                            55   5e-08
KLLA0B06501g complement(576636..579089) some similarities with s...    57   5e-08
Kwal_55.21900                                                          56   6e-08
KLLA0F08877g 825217..826182 gi|27526975|emb|CAD36965.1 Kluyverom...    55   6e-08
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    56   7e-08
CAGL0M08360g complement(833220..835520) some similarities with s...    56   7e-08
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    56   8e-08
Scas_458.1                                                             55   8e-08
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    55   1e-07
CAGL0H10208g complement(996853..999936) similar to sp|P38080 Sac...    55   1e-07
CAGL0J05940g 560563..562023 similar to sp|P23291 Saccharomyces c...    55   2e-07
Kwal_26.8941                                                           55   2e-07
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    55   2e-07
KLLA0E08371g complement(756205..758538) similar to sp|P40494 Sac...    54   3e-07
Scas_584.11                                                            54   3e-07
CAGL0K11990g complement(1155395..1158370) some similarities with...    54   3e-07
KLLA0D11044g complement(942458..944068) gi|730472|sp|P40230|RAG8...    54   3e-07
Kwal_47.17345                                                          54   3e-07
CAGL0K01661g complement(146952..148400) some similarities with t...    54   3e-07
Scas_689.22                                                            54   3e-07
Kwal_27.11542                                                          54   3e-07
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    54   4e-07
Scas_655.2                                                             54   4e-07
Kwal_14.1249                                                           53   4e-07
CAGL0J05082g 481179..483140 similar to sp|P47042 Saccharomyces c...    54   5e-07
Scas_703.47                                                            53   6e-07
KLLA0D13266g complement(1137750..1141208) similar to sp|P32361 S...    52   1e-06
CAGL0G02607g complement(240244..242310) similar to sp|P40494 Sac...    52   1e-06
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    52   1e-06
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    52   2e-06
AEL173W [2333] [Homologous to ScYJL057C (IKS1) - SH] complement(...    51   2e-06
CAGL0K11275g 1093797..1095374 similar to tr|Q03785 Saccharomyces...    50   4e-06
CAGL0K12496g 1218391..1219473 similar to sp|P43568 Saccharomyces...    50   4e-06
KLLA0D12100g complement(1031728..1033161) some similarities with...    50   5e-06
Scas_721.61                                                            50   6e-06
Kwal_27.10945                                                          50   6e-06
KLLA0F18612g 1711131..1713575 some similarities with sp|P38080 S...    50   7e-06
Scas_601.6                                                             50   7e-06
Scas_661.27                                                            49   9e-06
KLLA0C04345g 397899..399326 similar to sp|P06243 Saccharomyces c...    49   1e-05
Scas_707.7                                                             48   1e-05
ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C (...    49   2e-05
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    48   2e-05
AEL179W [2327] [Homologous to NOHBY] complement(302948..303817) ...    47   2e-05
Scas_627.4                                                             47   3e-05
ABR088C [679] [Homologous to ScYKL048C (ELM1) - SH] (546324..547...    47   3e-05
Scas_692.24                                                            47   4e-05
AER216C [2718] [Homologous to ScYDL017W (CDC7) - SH] (1032840..1...    47   4e-05
ADR293C [2034] [Homologous to ScYHR079C (IRE1) - SH] (1207023..1...    47   4e-05
YBR059C (AKL1) [250] chr2 complement(356821..360147) Serine/thre...    47   6e-05
Scas_584.8                                                             47   7e-05
CAGL0K01815g 162144..163658 similar to sp|P06243 Saccharomyces c...    46   8e-05
AFL091W [3102] [Homologous to ScYPL204W (HRR25) - SH] complement...    45   1e-04
Kwal_14.2554                                                           45   1e-04
Kwal_55.20221                                                          46   1e-04
Scas_718.72                                                            45   1e-04
YDL017W (CDC7) [843] chr4 (424206..425729) Protein kinase that a...    45   2e-04
AGR027C [4337] [Homologous to ScYBR059C (AKL1) - SH] (763309..76...    45   2e-04
Kwal_33.13225                                                          45   3e-04
YER123W (YCK3) [1553] chr5 (404809..406383) Casein kinase I isof...    44   3e-04
AGR315C [4626] [Homologous to ScYGR188C (BUB1) - SH; ScYJL013C (...    44   4e-04
Kwal_27.9804                                                           43   6e-04
AFL143C [3052] [Homologous to ScYPL236C - SH] (164241..165326) [...    43   6e-04
YFL029C (CAK1) [1654] chr6 complement(78053..79159) Cdk-activati...    43   6e-04
CAGL0H03553g complement(328668..330155) highly similar to sp|P29...    43   6e-04
Kwal_47.17314                                                          43   8e-04
Kwal_56.24274                                                          42   0.001
AEL120W [2386] [Homologous to ScYKL171W - SH] complement(396394....    43   0.001
KLLA0D03168g 265761..267278 some similarities with sp|P29295 Sac...    42   0.001
Kwal_56.24064                                                          42   0.001
KLLA0F22605g complement(2109034..2111913) similar to sp|P41695 S...    43   0.001
Scas_720.24                                                            42   0.001
CAGL0H08437g complement(825191..829423) similar to sp|P22219 Sac...    42   0.001

>Kwal_26.7635
          Length = 691

 Score = 1325 bits (3430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 648/681 (95%), Positives = 648/681 (95%)

Query: 1   MYSWKIASKFRFGRSXXXXXXXXXXXXXXXXXXHGLFHHKSHKSDSSYMEPPRESVDRKE 60
           MYSWKIASKFRFGRS                  HGLFHHKSHKSDSSYMEPPRESVDRKE
Sbjct: 1   MYSWKIASKFRFGRSKEEKEKEKEKDKTKEKEKHGLFHHKSHKSDSSYMEPPRESVDRKE 60

Query: 61  TIVASSSSIAPVRLSSEVNKFPAXXXXXXXXXXXXXXXGEYDGMYDGNGSSSVMDEAFDS 120
           TIVASSSSIAPVRLSSEVNKFPA               GEYDGMYDGNGSSSVMDEAFDS
Sbjct: 61  TIVASSSSIAPVRLSSEVNKFPATDSSVSTVRDSVSTSGEYDGMYDGNGSSSVMDEAFDS 120

Query: 121 NNSTTDEPNFSGIMTIKVYGGEVLRLPFPITSNVQILKKLLHSGVINQDTDEASADELVS 180
           NNSTTDEPNFSGIMTIKVYGGEVLRLPFPITSNVQILKKLLHSGVINQDTDEASADELVS
Sbjct: 121 NNSTTDEPNFSGIMTIKVYGGEVLRLPFPITSNVQILKKLLHSGVINQDTDEASADELVS 180

Query: 181 SLSQLHLSDGGDEENLIDGNTATRYIPATITLPNSTDLNPLLYFTLEFDNTVATIEPESG 240
           SLSQLHLSDGGDEENLIDGNTATRYIPATITLPNSTDLNPLLYFTLEFDNTVATIEPESG
Sbjct: 181 SLSQLHLSDGGDEENLIDGNTATRYIPATITLPNSTDLNPLLYFTLEFDNTVATIEPESG 240

Query: 241 TISNLTFNKISTFDVTRKLNFLKIDVFARIPSILLPSKSWQQLNSSDPSLKDILDRINDN 300
           TISNLTFNKISTFDVTRKLNFLKIDVFARIPSILLPSKSWQQLNSSDPSLKDILDRINDN
Sbjct: 241 TISNLTFNKISTFDVTRKLNFLKIDVFARIPSILLPSKSWQQLNSSDPSLKDILDRINDN 300

Query: 301 QDIHIDSYNLPLTLDFDTASSFRLYNHQWIGLAQGNGKLNLSVDYKPATNRALSVDDFEL 360
           QDIHIDSYNLPLTLDFDTASSFRLYNHQWIGLAQGNGKLNLSVDYKPATNRALSVDDFEL
Sbjct: 301 QDIHIDSYNLPLTLDFDTASSFRLYNHQWIGLAQGNGKLNLSVDYKPATNRALSVDDFEL 360

Query: 361 LKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPFIVP 420
           LKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPFIVP
Sbjct: 361 LKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPFIVP 420

Query: 421 LKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLDVIYR 480
           LKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLDVIYR
Sbjct: 421 LKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLDVIYR 480

Query: 481 DLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVDWW 540
           DLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVDWW
Sbjct: 481 DLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVDWW 540

Query: 541 TLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGLLSRDPKRRLG 600
           TLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGLLSRDPKRRLG
Sbjct: 541 TLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGLLSRDPKRRLG 600

Query: 601 FNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSLDTSNFDQEFTKELPVDSVVNDF 660
           FNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSLDTSNFDQEFTKELPVDSVVNDF
Sbjct: 601 FNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSLDTSNFDQEFTKELPVDSVVNDF 660

Query: 661 LSESVQQQFGGWTYVGSEQLG 681
           LSESVQQQFGGWTYVGSEQLG
Sbjct: 661 LSESVQQQFGGWTYVGSEQLG 681

>ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C
           (YPK2) - SH] complement(345955..348123) [2169 bp, 722
           aa]
          Length = 722

 Score =  959 bits (2478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/712 (66%), Positives = 560/712 (78%), Gaps = 33/712 (4%)

Query: 1   MYSWKIASKFRFGRSXXXX---XXXXXXXXXXXXXXHGLFHHKSHKSDSSYME------- 50
           MY WK+ +K +FGRS                     HG+F H S +  S+  +       
Sbjct: 3   MYGWKLTNKLKFGRSKEEKDKDREKERDSRHNSGSKHGVFGHLSKRLSSTEEQVRCRTEE 62

Query: 51  ------PPRESVDRKETIVASSSSIAPVRLSSEVNK--FPAXXXXXXXXXXXXXXXGEYD 102
                  PR S DRKETIVA+++SIAPVRLS++V    +P                 E  
Sbjct: 63  ANTGAGTPRTSKDRKETIVATANSIAPVRLSTDVAAPGWPNEGVQSSVPSSFRDAGSETT 122

Query: 103 GMYD----GNGSSSVMDEAFDSNNSTTDEP-------NFSGIMTIKVYGGEVLRLPFPIT 151
            + D    G  S SV+ E  + ++++  E        N +GIMTIKVY G   +LPF +T
Sbjct: 123 DVGDEERAGTSSGSVVPEQANHSSASVSEERGEASMVNSTGIMTIKVYNGNSFKLPFALT 182

Query: 152 SNVQILKKLLHSGV-INQDTDEASADELVSSLSQLHLSDGGDEENLIDGNTATRYIPATI 210
           SN QIL KLL SGV     T  +S DEL+SS+ Q+ LS+  DE+ L+ G+ AT YIPATI
Sbjct: 183 SNPQILGKLLSSGVNAISRTGRSSVDELISSVEQVTLSE--DEDKLLPGDAATNYIPATI 240

Query: 211 TLPNSTDLNPLLYFTLEFDNTVATIEPESGTISNLTFNKISTFDVTRKLNFLKIDVFARI 270
            LP+S DLNPL+Y T+EFDNTVATIEPE G + +  FNKISTFDVTRKL +LK++VF RI
Sbjct: 241 KLPDSEDLNPLIYLTIEFDNTVATIEPECGNLKSPVFNKISTFDVTRKLPYLKVNVFVRI 300

Query: 271 PSILLPSKSWQQLNSS-DPSLKDILDRINDNQDIHIDSYNLPLTLDFDTASSFRLYNHQW 329
           PSILLPSK+WQQ+ ++ DP L+D+L ++N N D+ +DS+ LPL L F++A+S RLYNHQW
Sbjct: 301 PSILLPSKAWQQVYAAQDPELQDLLKKVNSNMDVQLDSFQLPLNLQFNSATSIRLYNHQW 360

Query: 330 IGLAQGNGKLNLSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAI 389
           + + +G G++N+++DYKP+ N+ LS+DDF+LLKVIGKGSFGKVMQV+KKDTNK+YALKAI
Sbjct: 361 LNMEKGLGRVNITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAI 420

Query: 390 RKSYIVSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQR 449
           RKSYIVSKSEV HTLAERTVLARV+NPFIVPLKF+FQSP+KLY+VLAFINGGELF+HLQ+
Sbjct: 421 RKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFFHLQK 480

Query: 450 EGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKG 509
           EGRF LSRAR YTAELLCALETLH+L+VIYRDLKPENILLD+QGHIALCDFGLCKLNMK 
Sbjct: 481 EGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMKD 540

Query: 510 QDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKIL 569
           QDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEM+TGLPPYYDEDVPKMYKKIL
Sbjct: 541 QDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKIL 600

Query: 570 QEPLRFPDGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKRLWMKGYIPP 629
           QEPLRFPDGFD++AK+LLI LL RDPKRRLG+NGADEIK HPFFSQLSWKRLWMKGYIPP
Sbjct: 601 QEPLRFPDGFDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYIPP 660

Query: 630 YKPPVMNSLDTSNFDQEFTKELPVDSVVNDFLSESVQQQFGGWTYVGSEQLG 681
           YKPPVM++LDTSNFDQEFT+E PVDSVVNDFLSESVQQQFGGWTYVGSEQLG
Sbjct: 661 YKPPVMSALDTSNFDQEFTREKPVDSVVNDFLSESVQQQFGGWTYVGSEQLG 712

>Scas_721.124
          Length = 684

 Score =  907 bits (2345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/653 (68%), Positives = 527/653 (80%), Gaps = 9/653 (1%)

Query: 35  GLFHHKSHKSDSSYMEPPRES----VDRKETIVASSSSIAPVRLSSEVNKFPAXXXXXXX 90
           G F+    K +SS     + S     DRKETI+ S +++AP+R S E +   +       
Sbjct: 25  GFFNSGDSKKESSPTSKTQSSGDYSSDRKETIINSPNTMAPMRSSYEAS---SSTSTFDN 81

Query: 91  XXXXXXXXGEYDGMYDGNGSSSVMDEAFDSNNSTTDEPNFSGIMTIKVYGGEVLRLPFPI 150
                      +  ++ + S    D A +  +      + SGIMTIK+Y G+   LPFPI
Sbjct: 82  GSHTSSDENSNNISHESSVSQISQDTASNDPHPQNTHISSSGIMTIKIYNGDAFTLPFPI 141

Query: 151 TSNVQILKKLLHSGVINQDTDEASADELVSSLSQLHLSDGG-DEENLIDGNTATRYIPAT 209
           TSN QIL KLL SG+    T     D LVS LS++ L + G  EENL+  + ++++IPAT
Sbjct: 142 TSNQQILSKLLGSGISPPSTATPDVDTLVSQLSRVQLQNQGPAEENLLASDVSSKFIPAT 201

Query: 210 ITLPNSTDLNPLLYFTLEFDNTVATIEPESGTISNLTFNKISTFDVTRKLNFLKIDVFAR 269
           I LP S+ LNPLLYFT+EFDNTVATIEPE GT++   FNKISTFDVTRKL FLKIDVFAR
Sbjct: 202 IKLPGSSVLNPLLYFTIEFDNTVATIEPEYGTMTKPVFNKISTFDVTRKLPFLKIDVFAR 261

Query: 270 IPSILLPSKSWQQ-LNSSDPSLKDILDRINDNQDIHIDSYNLPLTLDFDTASSFRLYNHQ 328
           IPSILLPSK WQQ ++++D  LK++L++IN NQD+H+DS+ LP+ L FDTAS+ RLYNH 
Sbjct: 262 IPSILLPSKMWQQEMSANDEKLKEMLEKINSNQDVHLDSFQLPINLKFDTASNIRLYNHH 321

Query: 329 WIGLAQGNGKLNLSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKA 388
           W+ L  G G++N+S+DYKP+ N+ LS+DDF+LLKVIGKGSFGKVMQVRKKDT K+YALKA
Sbjct: 322 WVSLENGLGRINISIDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKA 381

Query: 389 IRKSYIVSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQ 448
           IRK+YIVSKSEV HTLAERTVLAR++ PFIVPLKF+FQSPDKLY+VLA INGGELFYHLQ
Sbjct: 382 IRKAYIVSKSEVTHTLAERTVLARIDCPFIVPLKFSFQSPDKLYLVLACINGGELFYHLQ 441

Query: 449 REGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMK 508
           +EGRF LSR+R Y AELLCALETLHNL+VIYRDLKPENILLD+QGHIALCDFGLCKLNMK
Sbjct: 442 KEGRFDLSRSRFYAAELLCALETLHNLNVIYRDLKPENILLDYQGHIALCDFGLCKLNMK 501

Query: 509 GQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKI 568
             DKT+TFCGTPEYLAPELLLGQGY+KVVDWWTLGVLLYEM+TGLPPYYDEDVPKMYKKI
Sbjct: 502 DDDKTDTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKI 561

Query: 569 LQEPLRFPDGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKRLWMKGYIP 628
           LQ+PLRFPDGFD+DAKDLLIGLLSRDP RRLG NGADEIK+HPFFSQLSWKRL MKGYIP
Sbjct: 562 LQDPLRFPDGFDRDAKDLLIGLLSRDPTRRLGCNGADEIKNHPFFSQLSWKRLLMKGYIP 621

Query: 629 PYKPPVMNSLDTSNFDQEFTKELPVDSVVNDFLSESVQQQFGGWTYVGSEQLG 681
           PYKPPV +++DTSNFDQEFT+E PVDSVV++FLSESVQ+QFGGWTYVGSEQLG
Sbjct: 622 PYKPPVTSAIDTSNFDQEFTREKPVDSVVDEFLSESVQKQFGGWTYVGSEQLG 674

>Scas_717.69
          Length = 674

 Score =  892 bits (2304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/649 (69%), Positives = 511/649 (78%), Gaps = 15/649 (2%)

Query: 37  FHHKSHKSDSSYMEPPRESVDRKETIVASSSSIAPVRLSSEVNKFPAXXXXXXXXXXXXX 96
           FHH+   S     E      DRK+TIV S SS+APVRLSSE                   
Sbjct: 31  FHHEKRHSRGDLNESDDTFSDRKKTIVRSPSSVAPVRLSSEAAS-----------SSSTF 79

Query: 97  XXGEYDGMYDGNGSSSVMDEAFDSNNSTTDEPNFSGIMTIKVYGGEVLRLPFPITSNVQI 156
             G+ D     +  S  M     +  S  D    +GIMTIKVY GE   LP  ITSN  I
Sbjct: 80  LNGDDDVSTGRDVHSRTMSTTSATEMSNKDIDGTAGIMTIKVYNGEGFILPVSITSNETI 139

Query: 157 LKKLLHSGVINQDTDEAS-ADELVSSLS--QLHLSDGGDEENLIDGNTATRYIPATITLP 213
           L +LL SG+ +   + ++  D L+S LS  QL  S    EE LI+G T T+YIPAT+ LP
Sbjct: 140 LSRLLSSGINSAHVNLSNEVDALISRLSRMQLETSRNIQEEKLINGETCTKYIPATVKLP 199

Query: 214 NSTDLNPLLYFTLEFDNTVATIEPESGTISNLTFNKISTFDVTRKLNFLKIDVFARIPSI 273
            S  LNPLLYFT+EFDNTVATIEPE G +++  FNKISTFDVTRKL +LKIDVFARIPSI
Sbjct: 200 GSNRLNPLLYFTIEFDNTVATIEPEYGLMADPVFNKISTFDVTRKLPYLKIDVFARIPSI 259

Query: 274 LLPSKSWQQLNSS-DPSLKDILDRINDNQDIHIDSYNLPLTLDFDTASSFRLYNHQWIGL 332
           LLPSK WQQ  S  D  +K ILD+IN NQD+H+DS  +P+ L FD+A++ RLYNH W+ L
Sbjct: 260 LLPSKLWQQTQSEHDSRMKVILDKINSNQDVHLDSLQIPINLKFDSAANIRLYNHHWVTL 319

Query: 333 AQGNGKLNLSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKS 392
               G++N+SVDYKP+ N+ L++DDF+LLKVIGKGSFGKVMQVRK+DT K+YALKAIRKS
Sbjct: 320 ENTLGRINISVDYKPSKNKRLTIDDFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKS 379

Query: 393 YIVSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGR 452
           YIVSKSEV HTLAERTVLARV  PFIVPLKF+FQSP+KLY+VLA INGGELFYHLQ+EGR
Sbjct: 380 YIVSKSEVTHTLAERTVLARVNCPFIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGR 439

Query: 453 FSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDK 512
           F LSRAR YTAELLCALETLHNLDVIYRDLKPENILLD+QGHIALCDFGLCKLNMK QDK
Sbjct: 440 FELSRARFYTAELLCALETLHNLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDQDK 499

Query: 513 TNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEP 572
           T+TFCGTPEYLAPELLL QGYSKVVDWWTLG+LLYEM+TGLPPYYDEDVPKMY+KILQ+P
Sbjct: 500 TDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPYYDEDVPKMYRKILQDP 559

Query: 573 LRFPDGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKRLWMKGYIPPYKP 632
           LRFP+GFD+DAKDLLIGLLSRDP RRLG NGA EIK+HPFFSQLSWKRLW KGYIPPYKP
Sbjct: 560 LRFPEGFDRDAKDLLIGLLSRDPDRRLGCNGAHEIKNHPFFSQLSWKRLWNKGYIPPYKP 619

Query: 633 PVMNSLDTSNFDQEFTKELPVDSVVNDFLSESVQQQFGGWTYVGSEQLG 681
           PV ++ DT NFDQEFTKE P+DSVV+++LSESVQ+QFGGWTYVGSEQLG
Sbjct: 620 PVSDAADTRNFDQEFTKEKPIDSVVDEYLSESVQKQFGGWTYVGSEQLG 668

>CAGL0K03399g complement(310487..312598) highly similar to sp|P12688
           Saccharomyces cerevisiae YKL126w
           Serine/threonine-protein kinase, start by similarity
          Length = 703

 Score =  877 bits (2267), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/576 (72%), Positives = 495/576 (85%), Gaps = 4/576 (0%)

Query: 110 SSSVMDEAFDSNNSTTDEPNF--SGIMTIKVYGGEVLRLPFPITSNVQILKKLLHSGVIN 167
           SSS +D+    + ++T + +   +G+MTIKVY G+  RLPFPITSN +IL +LL SG+ +
Sbjct: 118 SSSHIDQVSQKSATSTKKTSTPSTGVMTIKVYNGDGFRLPFPITSNKKILSRLLESGIAS 177

Query: 168 QDTDEA-SADELVSSLSQLHLSDGGDEENLIDGNTATRYIPATITLPNSTDLNPLLYFTL 226
            + D +   + ++  +S+L L++    ENL+ G+ AT+ IP+TI LPNS  LNPLLYFT+
Sbjct: 178 DNHDTSLEVEAILQRISRLELTNSNSNENLLPGDIATQSIPSTIKLPNSVPLNPLLYFTI 237

Query: 227 EFDNTVATIEPESGTISNLTFNKISTFDVTRKLNFLKIDVFARIPSILLPSKSWQQ-LNS 285
           EFDNTVATIEPESGT++   FNKISTFDVTRKL  L IDVF RIPSILLP K WQQ + +
Sbjct: 238 EFDNTVATIEPESGTMAQPIFNKISTFDVTRKLPQLNIDVFVRIPSILLPPKQWQQEMGA 297

Query: 286 SDPSLKDILDRINDNQDIHIDSYNLPLTLDFDTASSFRLYNHQWIGLAQGNGKLNLSVDY 345
            D  L+ +LD+IN NQD+H+DS+ LP+ L  D+A++ RLYNH W+ L  G GK+N+SVDY
Sbjct: 298 QDEKLQALLDKINTNQDVHLDSFQLPVNLLIDSAATIRLYNHHWVELRDGLGKINISVDY 357

Query: 346 KPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLA 405
           KP+ N+ LS+DDF+LLKVIGKGSFGKVMQVRKKDT K+YALKAIRKSYIVSKSEV HTLA
Sbjct: 358 KPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLA 417

Query: 406 ERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAEL 465
           ERTVLAR++ PFIVPLKF+FQS +KLY+VLA INGGELFYHLQREGRF LSR+R Y AEL
Sbjct: 418 ERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAEL 477

Query: 466 LCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAP 525
           LCAL+TLH +DVIYRDLKPENILLD+QGHIALCDFGLCKLNMK +DKT+TFCGTPEYLAP
Sbjct: 478 LCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDEDKTDTFCGTPEYLAP 537

Query: 526 ELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKD 585
           ELLLGQGYSKVVDWWTLGVLLYEM+TGLPPYYDE+VPKMYKKILQ+PL FPDGFD+DAKD
Sbjct: 538 ELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKMYKKILQDPLVFPDGFDRDAKD 597

Query: 586 LLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSLDTSNFDQ 645
           LLIGLLSRDP+RRLG+NGADEIK+HPFFSQLSWKRL MKGYIPPYKPPV ++ DTSNFDQ
Sbjct: 598 LLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSNFDQ 657

Query: 646 EFTKELPVDSVVNDFLSESVQQQFGGWTYVGSEQLG 681
           EFT+E P+DSVV+++LSESVQ+QFGGWTYVGSEQLG
Sbjct: 658 EFTREKPIDSVVDEYLSESVQKQFGGWTYVGSEQLG 693

>KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces
           cerevisiae YKL126w YPK1 ser/thr-specific protein kinase,
           start by similarity
          Length = 716

 Score =  878 bits (2268), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/553 (75%), Positives = 483/553 (87%), Gaps = 4/553 (0%)

Query: 131 SGIMTIKVYGGEVLRLPFPITSNVQILKKLLHSGV-INQDTDEASADELVSSLSQLHLSD 189
           +GI+T+KVY G+  +LP PIT N Q+L KLL SGV +   T + S +EL+ S+  L L  
Sbjct: 155 NGILTVKVYSGDSFKLPLPITYNEQVLSKLLSSGVDVTSTTQQDSLEELIQSMHGLSLLR 214

Query: 190 GGDEENLIDGNTATRYIPATITLPNSTDLNPLLYFTLEFDNTVATIEPESGTISNLTFNK 249
             +E+ L+ G  A+ +IPA++ LP S +LN LLYFT+EFDNT+ATIEPESGT++   FNK
Sbjct: 215 --EEDKLLSGEDASHFIPASVILPGSKNLNSLLYFTIEFDNTIATIEPESGTLNRPIFNK 272

Query: 250 ISTFDVTRKLNFLKIDVFARIPSILLPSKSWQQLN-SSDPSLKDILDRINDNQDIHIDSY 308
           ISTFDVTR+L FLKIDVFARIPSILLPS++WQ+   S++  L D + +I +N DIH+DS+
Sbjct: 273 ISTFDVTRRLPFLKIDVFARIPSILLPSQNWQETQISNNDILGDYVKKIRNNSDIHLDSF 332

Query: 309 NLPLTLDFDTASSFRLYNHQWIGLAQGNGKLNLSVDYKPATNRALSVDDFELLKVIGKGS 368
           +LPL L  D+AS+ RLYNH WI L    GKLNLSVDYKP+T++ LS+DDF+LLKVIGKGS
Sbjct: 333 HLPLNLKIDSASNIRLYNHHWIELESKMGKLNLSVDYKPSTHKHLSIDDFDLLKVIGKGS 392

Query: 369 FGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPFIVPLKFTFQSP 428
           FGKVMQVRK+DTNK+YALKAIRKSYIVSKSEV HTLAERTVLARV+NPFIVPLKF+FQS 
Sbjct: 393 FGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSS 452

Query: 429 DKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENIL 488
           +KLY+VLAFINGGELFYHLQREGRF LSR+R YTAELLCALE LH+ D+IYRDLKPENIL
Sbjct: 453 EKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFDIIYRDLKPENIL 512

Query: 489 LDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYE 548
           LD+QGHIALCDFGLCKLNMK Q+KT TFCGTPEYLAPELLLGQGY+KVVDWWTLGVLLYE
Sbjct: 513 LDYQGHIALCDFGLCKLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYE 572

Query: 549 MMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGLLSRDPKRRLGFNGADEIK 608
           M+TGLPPYYDEDVPKMYKKILQ+PLRFPD FDKDAKDLLIGLL RDPKRRLG++G+DEIK
Sbjct: 573 MLTGLPPYYDEDVPKMYKKILQDPLRFPDDFDKDAKDLLIGLLCRDPKRRLGYHGSDEIK 632

Query: 609 SHPFFSQLSWKRLWMKGYIPPYKPPVMNSLDTSNFDQEFTKELPVDSVVNDFLSESVQQQ 668
           SHPFF+QLSWKRL MKGYIPPYKPPVM ++DTSNFDQEFT+E PVDSVVNDFLSESVQQQ
Sbjct: 633 SHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTREQPVDSVVNDFLSESVQQQ 692

Query: 669 FGGWTYVGSEQLG 681
           FGGWTYVGSEQLG
Sbjct: 693 FGGWTYVGSEQLG 705

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 32/73 (43%), Gaps = 16/73 (21%)

Query: 1  MYSWKIASKFRFGRSXXXXXXXXXXXXXXXXXXHGLFHHKSHKSDSSYMEPPRESVDRKE 60
          MYSWK++SKFRFGRS                      HHK            R SVDRK 
Sbjct: 1  MYSWKLSSKFRFGRSKDKDEK----------------HHKHMDEVDIDGNDNRSSVDRKA 44

Query: 61 TIVASSSSIAPVR 73
          TIV  S+++   R
Sbjct: 45 TIVPGSATVVQSR 57

>CAGL0K07458g complement(736336..738450) similar to sp|P12688
           Saccharomyces cerevisiae YKL126w or sp|P18961
           Saccharomyces cerevisiae YMR104c ser/thr-specific
           protein kinases, start by similarity
          Length = 704

 Score =  773 bits (1997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/707 (56%), Positives = 503/707 (71%), Gaps = 33/707 (4%)

Query: 1   MYSWKIASKFRFGRSXXXXXXXXXXXXXXXXXXHGLFHHKSHKSDSSYMEPPRESVDRKE 60
           MY WK+  +F+FGR                          +   DS +  P   SV+R++
Sbjct: 1   MYGWKL-HRFKFGRGKDDDSRKKKMIISSSQSSLN--SADTAAGDSIFSRP---SVERRD 54

Query: 61  TIVASSSSIAPVRLSSE------------VNKF--PAXXXXXXXXXXXXXXXGEYDGMYD 106
           T+ A++ SIAPVR+S +            ++KF  P+                       
Sbjct: 55  TVTAANGSIAPVRVSQDSYMSYFKESNENMSKFDLPSWLRSHKDSFSPFNSSSNSSSNLG 114

Query: 107 GNGSSSVM-------DEAFDSNN-STTDEPNFSGIMTIKVYGGEVLRLPFPITSNVQILK 158
            N  SS+        D AF S      DE   SG++T+KVY G    +P PITS+  IL 
Sbjct: 115 SNRDSSMTDVTELLNDTAFKSTPFDRIDENMHSGLLTVKVYSGSNFTMPVPITSDQGILH 174

Query: 159 KLLHSGVINQDTDE---ASADELVSSLSQLHLSDGGDEENLIDGNTATRYIPATITLPNS 215
            LL+S + + + D    A  ++L++ LSQ+HL++   EE LI    ++ +IPA I +P  
Sbjct: 175 NLLNSSISSLEGDNNTYAEMEQLITQLSQVHLANQTSEEQLISNAFSSTFIPAVIKVPGH 234

Query: 216 TDLNPLLYFTLEFDNTVATIEPESGTISNLTFNKISTFDVTRKLNFLKIDVFARIPSILL 275
            D  PL+Y T+E+DNT+ATI PE GTIS   FNKISTFDVTRKL FLK  VF +IPS LL
Sbjct: 235 DDY-PLIYMTVEYDNTMATIYPEGGTISKPVFNKISTFDVTRKLPFLKCSVFIKIPSALL 293

Query: 276 PSKSWQQLNS-SDPSLKDILDRINDNQDIHIDSYNLPLTLDFDTASSFRLYNHQWIGLAQ 334
           PS  WQQ  + +DP+++ IL+ I+  ++I +DS+ LP+ LD ++AS+FRL+NHQWI L Q
Sbjct: 294 PSMRWQQEAALADPNMRSILETIHAGKEIFLDSFTLPVVLDMNSASNFRLFNHQWINLKQ 353

Query: 335 GNGKLNLSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYI 394
           G G +NL+VD+KP+ ++ + +DDFELL V+GKGS+GKVMQVRKKDT K+YALKAIRKSYI
Sbjct: 354 GLGTINLTVDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYI 413

Query: 395 VSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFS 454
           V+KSEVIHTLAERT+LARVE PFIVPLKFTFQ+P+KLY+VLA INGGELF+HLQREG F 
Sbjct: 414 VAKSEVIHTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFD 473

Query: 455 LSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTN 514
           +SRAR Y +ELL AL++LH +DV+YRDLKPENILLD QGHIALCDFGLCKLNMK  +KT+
Sbjct: 474 ISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLCKLNMKDNEKTS 533

Query: 515 TFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLR 574
           TFCGTPEYLAPE+LLG+GY+KVVDWWTLGVLLYEM+TGLPPYYDE+V +MYKKIL+ PL 
Sbjct: 534 TFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMYKKILKSPLI 593

Query: 575 FPDGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPV 634
           FPDG D DAKDLL  LL+RDP RRLG NGADEIK+H FF+ L W  +W K Y+PP++P V
Sbjct: 594 FPDGMDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDV 653

Query: 635 MNSLDTSNFDQEFTKELPVDSVVNDFLSESVQQQFGGWTYVGSEQLG 681
            N+ DTSNFD EFTK+ PVDSV++++LSESVQ QF GW+Y+GSEQLG
Sbjct: 654 QNANDTSNFDNEFTKQKPVDSVIDEYLSESVQNQFKGWSYLGSEQLG 700

>Kwal_47.16761
          Length = 744

 Score =  356 bits (913), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 180/372 (48%), Positives = 251/372 (67%), Gaps = 19/372 (5%)

Query: 321 SFRLYNH-QWIGLAQG------NGKLNLSVDYKPATNRALSVDDFELLKVIGKGSFGKVM 373
           SF   NH QW  L          G +++  D+K    +     DFE+L+++GKG+FG+V 
Sbjct: 290 SFSHSNHEQWYKLQSRIVGESVTGHISVKWDFKATMKQHYGPQDFEVLRLLGKGTFGQVY 349

Query: 374 QVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVEN---PFIVPLKFTFQSPDK 430
           QVRKKDT ++YA+K + K  IV K+E+ HT+ ER +L R  +   PFIV LKF+FQ+P  
Sbjct: 350 QVRKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVRTASKSCPFIVGLKFSFQTPAD 409

Query: 431 LYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLD 490
           LY+V  F++GGELF+HLQ+EGRF+  RAR Y AEL+ ALE LH  D++YRDLKPENILLD
Sbjct: 410 LYLVTDFMSGGELFWHLQKEGRFAEDRARFYIAELVLALEYLHENDIVYRDLKPENILLD 469

Query: 491 HQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQ-GYSKVVDWWTLGVLLYEM 549
             G+IALCDFGL K ++K  D+TNTFCGT EYLAPELLL + GY+K+VD+W+LGVL++EM
Sbjct: 470 ANGNIALCDFGLSKADLK--DRTNTFCGTTEYLAPELLLDESGYTKMVDFWSLGVLIFEM 527

Query: 550 MTGLPPYYDEDVPKMYKKILQEPLRFP-DGFDKDAKDLLIGLLSRDPKRRLG-FNGADEI 607
             G  P++ ED  KMY+KI    ++FP D    + +  + GLL+R+P+ RLG  +   E+
Sbjct: 528 CCGWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLNRNPRHRLGAIDDGREL 587

Query: 608 KSHPFFSQLSWKRLWMKGYIPPYKPPVMNSLDTSNFDQEFTKE----LPVDSVVNDFLSE 663
           ++HPFF+++ W+ L  K   PP+KP +    DTSNFD EFT+     +    +    LS 
Sbjct: 588 RAHPFFAEIDWEALRQKKIPPPFKPHLTGETDTSNFDPEFTQTSTSFMNKQGIAATPLSP 647

Query: 664 SVQQQFGGWTYV 675
           ++Q +F G+T+V
Sbjct: 648 AMQAKFVGFTFV 659

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score =  351 bits (901), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 174/350 (49%), Positives = 244/350 (69%), Gaps = 12/350 (3%)

Query: 336 NGKLNLSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIV 395
           +G++ +  +Y     R     DFE+L+++GKG+FG+V QVRKKDT ++YA+K + K  IV
Sbjct: 282 SGEILVRWEYWHTEKRHYGPQDFEVLRLLGKGTFGQVYQVRKKDTKRIYAMKVLSKKVIV 341

Query: 396 SKSEVIHTLAERTVLARVEN---PFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGR 452
            K+E+ HT+ ER +L R  +   PFIV LKF+FQ+P  LY+V  F++GGELF+HLQ+EGR
Sbjct: 342 KKNEIAHTIGERNILVRTASKSCPFIVGLKFSFQTPTDLYLVTDFLSGGELFWHLQKEGR 401

Query: 453 FSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDK 512
           F+  RA+ Y AEL+ ALE LH+ D++YRDLKPENILLD  G+IALCDFGL K ++K  D+
Sbjct: 402 FTEERAKFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLK--DR 459

Query: 513 TNTFCGTPEYLAPELLLGQ-GYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQE 571
           TNTFCGT EYLAPELLL + GY+K+VD+W+LGVL++EM  G  P++ ED  KMY+KI   
Sbjct: 460 TNTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFG 519

Query: 572 PLRFP-DGFDKDAKDLLIGLLSRDPKRRLG-FNGADEIKSHPFFSQLSWKRLWMKGYIPP 629
            ++FP D    + +  + GLL+R+PK RLG  N   E+++HPF S + W+ L  K   PP
Sbjct: 520 KVKFPRDVLSPEGRSFVKGLLNRNPKHRLGAVNDGAEVRAHPFLSDIDWEALRNKQIPPP 579

Query: 630 YKPPVMNSLDTSNFDQEFTKE----LPVDSVVNDFLSESVQQQFGGWTYV 675
           +KP + +  DTSNFD EFT+     +    +    LS ++Q +F G+T+V
Sbjct: 580 FKPHLTSETDTSNFDPEFTQTSTSFMNKQPIAATPLSPAMQAKFAGFTFV 629

>Scas_703.5
          Length = 749

 Score =  350 bits (899), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 175/353 (49%), Positives = 245/353 (69%), Gaps = 19/353 (5%)

Query: 337 GKLNLSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVS 396
           G + +  +Y     R    +DFE+L+++GKG+FG+V QV+KKDT ++YA+K + K  IV 
Sbjct: 323 GDILIKWEYSSTKKRHYGPNDFEVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLSKKVIVK 382

Query: 397 KSEVIHTLAERTVL---ARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRF 453
           K+EV HT+ ER +L   A   +PFIV LKF+FQ+P  LY+V  F++GGELF+HLQ+EGRF
Sbjct: 383 KNEVAHTIGERNILVTTATKASPFIVGLKFSFQTPTDLYLVTDFMSGGELFWHLQKEGRF 442

Query: 454 SLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKT 513
           +  RA+ Y AEL+ ALE LH+ D++YRDLKPENILLD  G+IALCDFGL K ++K  D+T
Sbjct: 443 TEERAKFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLK--DRT 500

Query: 514 NTFCGTPEYLAPELLLGQ-GYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEP 572
           NTFCGT EYLAPELLL + GY+K+VD+W+LGVL++EM  G  P++ ED  KMY+KI    
Sbjct: 501 NTFCGTTEYLAPELLLDEAGYTKMVDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGK 560

Query: 573 LRFP-DGFDKDAKDLLIGLLSRDPKRRLG-FNGADEIKSHPFFSQLSWKRLWMKGYIPPY 630
           ++FP D    + +  + GLL+R+PK RLG  +   E+++HPFF+ + W  L  K   PP+
Sbjct: 561 VKFPRDVLSPEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFADIDWDALREKKIPPPF 620

Query: 631 KPPVMNSLDTSNFDQEFT--------KELPVDSVVNDFLSESVQQQFGGWTYV 675
           KP +++  DTSNFD EFT        K  P+ +     LS ++Q +F G+T+V
Sbjct: 621 KPHLVSETDTSNFDPEFTQTSTSYMNKHQPIAATP---LSPAMQAKFAGFTFV 670

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score =  346 bits (888), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 170/349 (48%), Positives = 243/349 (69%), Gaps = 12/349 (3%)

Query: 337 GKLNLSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVS 396
           G + +  +Y     R     DFE+L+++GKG+FG+V QVRKKDT ++YA+K + K  IV 
Sbjct: 304 GDILIHWEYTSTKKRQYGPQDFEVLRLLGKGTFGQVYQVRKKDTMRIYAMKVLSKKVIVK 363

Query: 397 KSEVIHTLAERTVLARV---ENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRF 453
           K+E+ HT+ ER +L R     +PFIV LKF+FQ+P  LY+V  F++GGELF+HLQ+EGRF
Sbjct: 364 KNEIAHTIGERNILVRTASKSSPFIVGLKFSFQTPTDLYLVTDFMSGGELFWHLQKEGRF 423

Query: 454 SLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKT 513
           +  RA+ Y AEL+ ALE LH+ D++YRDLKPENILLD  G+IALCDFGL K ++K  D+T
Sbjct: 424 TEDRAKFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLK--DRT 481

Query: 514 NTFCGTPEYLAPELLLGQ-GYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEP 572
           NTFCGT EYLAPELL+ + GY+K+VD+W+LGVL++EM  G  P++  D  KMY+KI    
Sbjct: 482 NTFCGTTEYLAPELLMDETGYTKMVDFWSLGVLIFEMCCGWSPFFASDNQKMYQKIAFGK 541

Query: 573 LRFP-DGFDKDAKDLLIGLLSRDPKRRLG-FNGADEIKSHPFFSQLSWKRLWMKGYIPPY 630
           ++FP D    + +  + GLL+R+PK RLG  +   E+++HPFF+ + W+ +  K   PP+
Sbjct: 542 VKFPRDVLSPEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFNDIDWEAVRQKKIPPPF 601

Query: 631 KPPVMNSLDTSNFDQEFTKE----LPVDSVVNDFLSESVQQQFGGWTYV 675
           KP +++  DTSNFD EFT+     +    +    LS ++Q +F G+T+V
Sbjct: 602 KPHLISETDTSNFDPEFTQTSTSFMNKQPIAATPLSPAMQAKFVGFTFV 650

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score =  345 bits (886), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 174/352 (49%), Positives = 243/352 (69%), Gaps = 17/352 (4%)

Query: 337 GKLNLSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVS 396
           G++ +   Y     R     DFE+L+++GKG+FG+V QV+KKDT ++YA+K + K  IV 
Sbjct: 319 GEILVKWHYTLTKKRHYGPQDFEVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLSKKVIVK 378

Query: 397 KSEVIHTLAERTVLARVEN---PFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRF 453
           K+E+ HT+ ER +L    +   PFIV LKF+FQ+P  LY+V  +++GGELF+HLQREGRF
Sbjct: 379 KNEIAHTIGERNILVTTSSKASPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQREGRF 438

Query: 454 SLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKT 513
           +  RA+ Y AEL+ ALE LH+ D++YRDLKPENILLD  G+IALCDFGL K ++K  D+T
Sbjct: 439 TEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLK--DRT 496

Query: 514 NTFCGTPEYLAPELLLGQ-GYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEP 572
           NTFCGT EYLAPELLL + GY+K+VD+W+LGVL++EM  G  P+Y ED  KMY+KI    
Sbjct: 497 NTFCGTTEYLAPELLLDESGYTKMVDFWSLGVLIFEMCCGWSPFYAEDNQKMYQKIAFGK 556

Query: 573 LRFP-DGFDKDAKDLLIGLLSRDPKRRLG-FNGADEIKSHPFFSQLSWKRLWMKGYIPPY 630
           ++FP D    + +  + GLL+R+PK RLG  +   E+++HPFF+ + W+ L  K   PP+
Sbjct: 557 VKFPRDILSPEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFADIDWELLKQKKIPPPF 616

Query: 631 KPPVMNSLDTSNFDQEFTKELPVDSVVNDF-------LSESVQQQFGGWTYV 675
           KP +++  DTSNFD EFT+     S +N         LS  +Q +F G+T+V
Sbjct: 617 KPHLVSETDTSNFDPEFTQT--STSYMNKHHQMAATPLSPGMQAKFAGFTFV 666

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score =  276 bits (706), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 134/301 (44%), Positives = 198/301 (65%), Gaps = 6/301 (1%)

Query: 348 ATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAER 407
            T+   ++ DF++L+ +G GSFG+V  VR     + YA+K ++K+ +V   +V HT  ER
Sbjct: 135 VTSGKYALYDFQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKNTVVKLKQVEHTNDER 194

Query: 408 TVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLC 467
            +L+ V +PFI+ +  TFQ   +L++++ +I GGELF  L++  RF    A+ Y AE+  
Sbjct: 195 NMLSIVSHPFIIRMWGTFQDSQQLFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCL 254

Query: 468 ALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPEL 527
           ALE LH+  +IYRDLKPENILLD  GHI L DFG  K      D T T CGTP+Y+APE+
Sbjct: 255 ALEYLHSKGIIYRDLKPENILLDKNGHIKLTDFGFAKY---VPDVTYTLCGTPDYIAPEV 311

Query: 528 LLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLL 587
           +  + Y+K VDWW+ GVL+YEM+ G  P+YD +  K Y+ IL  P+RFP  F  DA+DL+
Sbjct: 312 VSTKPYNKSVDWWSFGVLIYEMLAGYTPFYDSNTIKTYENILNAPVRFPPFFHSDAQDLI 371

Query: 588 IGLLSRDPKRRLGF--NGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSL-DTSNFD 644
             L++RD  +RLG   NG++++K+HP+FS++ W++L  K    PY+PP+     DTS +D
Sbjct: 372 SKLITRDLSQRLGNLQNGSEDVKNHPWFSEVVWEKLLCKNIETPYEPPIQAGQGDTSQYD 431

Query: 645 Q 645
           +
Sbjct: 432 R 432

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score =  273 bits (699), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 133/304 (43%), Positives = 197/304 (64%), Gaps = 6/304 (1%)

Query: 345 YKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTL 404
           Y   T+   ++ DF++L+ +G GSFG+V  +R     + YALKA++K  +V   +V HT 
Sbjct: 139 YGANTSGKYTLSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKALKKHTVVKLKQVEHTN 198

Query: 405 AERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAE 464
            ER +L+ V +PFI+ +  TFQ    +++V+ +I GGELF  L++  RF    A+ Y AE
Sbjct: 199 DERRMLSIVSHPFIIRMWGTFQDSQHVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAE 258

Query: 465 LLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLA 524
           +  ALE LH+ ++IYRDLKPENILLD  GHI + DFG  K      D T T CGTP+Y+A
Sbjct: 259 VCLALEYLHSKEIIYRDLKPENILLDKNGHIKITDFGFAKY---VPDVTYTLCGTPDYIA 315

Query: 525 PELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAK 584
           PE++  + Y+K VDWW+ G+L+YEM+ G  P+YD +  K Y+ IL   L+FP  F  D +
Sbjct: 316 PEVVSTKPYNKSVDWWSFGILIYEMLAGYTPFYDANTMKTYEHILNSELKFPSFFHPDVQ 375

Query: 585 DLLIGLLSRDPKRRLG--FNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSL-DTS 641
           DLL  L++RD  +RLG   NG++++K+HP+FS++ W++L  +    PY+PP+     DTS
Sbjct: 376 DLLSKLITRDLSKRLGNLQNGSEDVKNHPWFSEVVWEKLLARYIETPYEPPIQQGQGDTS 435

Query: 642 NFDQ 645
            FD+
Sbjct: 436 QFDR 439

>Scas_651.18
          Length = 371

 Score =  269 bits (688), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 132/306 (43%), Positives = 201/306 (65%), Gaps = 6/306 (1%)

Query: 349 TNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERT 408
           T+   +++DF++L+ +G GSFG+V  +R     + YALK ++K  IV   +V HT  ER 
Sbjct: 50  TSGKYTLNDFQILRTLGTGSFGRVHLIRSNHNGRFYALKVLKKHTIVKLKQVEHTNDERL 109

Query: 409 VLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCA 468
           +L+ V +PF+V +  TFQ  +++++++ +I GGELF  L++  RF    A+ Y AE+  A
Sbjct: 110 MLSVVSHPFLVRMWGTFQDFEQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLA 169

Query: 469 LETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELL 528
           LE LH++D+IYRDLKPENILLD  GHI + DFG  K      D T T CGTP+Y+APE++
Sbjct: 170 LEYLHSMDIIYRDLKPENILLDKNGHIKITDFGFAKY---VPDITYTLCGTPDYIAPEVV 226

Query: 529 LGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLI 588
             + Y+K VDWW+ G+L+YEM+ G  P+YD +  K Y+ IL   L+FP+ F  D KDLL 
Sbjct: 227 STKPYNKSVDWWSFGILIYEMLAGYTPFYDSNTMKTYENILNCKLKFPNFFHDDVKDLLS 286

Query: 589 GLLSRDPKRRLG--FNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSL-DTSNFDQ 645
            L++++   RLG   NG++++K HP+FS++ W++L  +    PY+PP+     DTS FD+
Sbjct: 287 KLITKNLTERLGNLQNGSEDVKRHPWFSEVIWEKLLSRNIETPYEPPIQQGQGDTSQFDR 346

Query: 646 EFTKEL 651
              +E+
Sbjct: 347 YPEEEI 352

>Scas_689.25*
          Length = 409

 Score =  269 bits (687), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 135/300 (45%), Positives = 192/300 (64%), Gaps = 6/300 (2%)

Query: 349 TNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERT 408
           T+   ++DDF +L+  G GSFG+V  VR     + YALK ++K  +V   +V HT  ER 
Sbjct: 90  TSGKYTIDDFNILRTSGTGSFGRVHLVRSVHNGRFYALKVLKKQTVVRLKQVEHTNDERR 149

Query: 409 VLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCA 468
           +L+   + FIV L  TFQ  + L++++ ++ GGELF  L+R  RF    A+ Y AE+  A
Sbjct: 150 MLSVSVHAFIVRLWGTFQDSEHLFMIMDYVEGGELFSLLRRSQRFPNPVAKFYAAEVCLA 209

Query: 469 LETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELL 528
           L+ LH+LD+IYRDLKPEN+LLD  GHI + DFG  K      D T T CGTP+Y+APE++
Sbjct: 210 LDYLHSLDIIYRDLKPENLLLDRNGHIKVTDFGFAKY---VPDVTYTLCGTPDYIAPEVI 266

Query: 529 LGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLI 588
             + Y+K VDWW+ G+L+YEM++G  P+YD    K Y+ IL  PL+FP  F  DA+DLL 
Sbjct: 267 SAKPYNKSVDWWSFGILIYEMLSGHTPFYDSSTMKTYENILNAPLKFPKYFTPDAQDLLS 326

Query: 589 GLLSRDPKRRLG--FNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSL-DTSNFDQ 645
            L++RD   RLG   NG ++IK+H +FS++ W +L  +    PY+PP+     DTS FD+
Sbjct: 327 RLITRDLTERLGNLQNGTEDIKNHAWFSEVIWDKLLDRCIETPYEPPIQQGQGDTSQFDR 386

>Kwal_33.13846
          Length = 375

 Score =  267 bits (682), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 130/314 (41%), Positives = 199/314 (63%), Gaps = 6/314 (1%)

Query: 349 TNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERT 408
           T+   +++DF +L+ +G GSFG+V  VR     + YA+K ++K  IV   +V HT  ER 
Sbjct: 56  TSGKYTLNDFHILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKRTIVKLKQVEHTNDERR 115

Query: 409 VLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCA 468
           +L+ V +PFI+ +  TFQ  + +++++ +I GGELF  L++  RF    A+ Y AE+  A
Sbjct: 116 MLSVVSHPFIIRMWGTFQDAEHVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLA 175

Query: 469 LETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELL 528
           LE LH  D+IYRDLKPEN+LLD  GH+ + DFG  K      D T T CGTP+Y+APE++
Sbjct: 176 LEYLHAQDIIYRDLKPENVLLDKNGHVKITDFGFAKF---VPDVTYTLCGTPDYIAPEVV 232

Query: 529 LGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLI 588
             + Y+K VDWW+ G+L++EM+ G  P+YD +  K Y+ IL   L+FP  F  D +DLL 
Sbjct: 233 STKPYNKSVDWWSFGILIFEMLAGYTPFYDSNTMKTYENILNAELQFPPFFHSDVQDLLS 292

Query: 589 GLLSRDPKRRLG--FNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSL-DTSNFDQ 645
            L++RD  +RLG   NG++++K+H +FS++ W++L  +    PY+PPV     DTS +D+
Sbjct: 293 QLITRDLSKRLGNLKNGSEDVKNHAWFSEVVWEKLLCRNIETPYEPPVQAGQGDTSQYDR 352

Query: 646 EFTKELPVDSVVND 659
              +E+   +   D
Sbjct: 353 YPEEEMCYGAEAED 366

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score =  265 bits (677), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 133/295 (45%), Positives = 191/295 (64%), Gaps = 6/295 (2%)

Query: 354 SVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARV 413
           S+ DF +++ +G GSFG+V  VR     + YA+K ++K+ +V   ++ HT  ER +L  V
Sbjct: 47  SLQDFHIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKAQVVKMKQIEHTNDERRMLKLV 106

Query: 414 ENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLH 473
           E+PF++ +  TFQ    L++V+ +I GGELF  L++  RF    A+ Y AE+  ALE LH
Sbjct: 107 EHPFLIRMWGTFQDSRNLFMVMDYIEGGELFTLLRKSQRFPNPVAKFYAAEVTLALEYLH 166

Query: 474 NLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGY 533
             ++IYRDLKPENILLD  GHI + DFG  K   + +  T T CGTP+Y+APE++  + Y
Sbjct: 167 FHNIIYRDLKPENILLDRNGHIKITDFGFAK---EVETVTWTLCGTPDYIAPEVIATKPY 223

Query: 534 SKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGLLSR 593
           +K VDWW+LGVL+YEM+ G  P+YD    K Y+KIL   + +P  F+ D  DLL  LL+ 
Sbjct: 224 NKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILHGKVVYPQFFNSDVIDLLSKLLTA 283

Query: 594 DPKRRLG--FNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSL-DTSNFDQ 645
           D  RR+G    GA +IKSHP+F+++ W++L  K    PY+PP+   + DTS FDQ
Sbjct: 284 DLTRRIGNLQKGAQDIKSHPWFAEVVWEKLLAKDIETPYEPPITAGVGDTSLFDQ 338

>Kwal_56.24059
          Length = 353

 Score =  263 bits (673), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 134/309 (43%), Positives = 199/309 (64%), Gaps = 6/309 (1%)

Query: 354 SVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARV 413
           S++DF++L+ +G GSFG+V  VR     + YA+K ++K  ++   ++ HT  ER +L  V
Sbjct: 39  SLNDFQILRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQVIRMKQIEHTNDERRMLKLV 98

Query: 414 ENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLH 473
           ++PF++ +  TFQ    L++V+ +I GGELF  L++  RF    A+ Y AE++ ALE LH
Sbjct: 99  DHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLH 158

Query: 474 NLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGY 533
           + D+IYRDLKPENILLD  GHI + DFG  K   +    T T CGTP+Y+APE++  + Y
Sbjct: 159 SHDIIYRDLKPENILLDRNGHIKITDFGFAK---EVDTVTWTLCGTPDYIAPEVIATKPY 215

Query: 534 SKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGLLSR 593
           +K VDWW+LG+L++EM+ G  P+YD    K Y+KILQ  + +P  F  D  DLL  L++ 
Sbjct: 216 NKSVDWWSLGILIFEMLAGYTPFYDATPMKTYEKILQGKVAYPPFFHPDVVDLLCKLITS 275

Query: 594 DPKRRLG--FNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSL-DTSNFDQEFTKE 650
           D  RRLG   +G  ++KSHP+FS++ W++L  K    PY+PP+   + DTS FDQ   ++
Sbjct: 276 DLTRRLGNLQSGPQDVKSHPWFSEVVWEKLLAKDIETPYEPPITAGVGDTSLFDQYPEEQ 335

Query: 651 LPVDSVVND 659
           L   S  +D
Sbjct: 336 LDYGSQGDD 344

>AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH]
           complement(274336..275376) [1041 bp, 346 aa]
          Length = 346

 Score =  258 bits (659), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 131/295 (44%), Positives = 191/295 (64%), Gaps = 6/295 (2%)

Query: 354 SVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARV 413
           S+ DF++++ +G GSFG+V  VR     + YA+K ++K  ++   ++ HT  ER +L  V
Sbjct: 32  SLQDFQIMRTLGTGSFGRVHLVRSIHNGRYYAIKVLKKQQVIRMKQIEHTNDERRMLKVV 91

Query: 414 ENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLH 473
           E+PF++ +  TFQ    L+IV+ +I GGELF  L++  RF    A+ Y AE+  ALE LH
Sbjct: 92  EHPFLIRMWGTFQDARNLFIVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLH 151

Query: 474 NLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGY 533
             ++IYRDLKPENILLD  GHI + DFG  K   +    T T CGTP+Y+APE++  + Y
Sbjct: 152 AHNIIYRDLKPENILLDRNGHIKITDFGFAK---EVDTVTWTLCGTPDYIAPEVITTKPY 208

Query: 534 SKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGLLSR 593
           +K +DWW+LG+L++EM+ G  P+YD    K Y+KIL   + FP  F  DA DLL  L++ 
Sbjct: 209 NKSIDWWSLGILIFEMLAGYTPFYDVTPIKTYEKILAGKVVFPPFFHPDAIDLLGKLITD 268

Query: 594 DPKRRLG--FNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSL-DTSNFDQ 645
           D  RRLG   +G+ +IKSHP+FS++ W++L  K    PY+PP+   + D+S FDQ
Sbjct: 269 DLTRRLGNLQSGSQDIKSHPWFSEVIWEKLLAKDIETPYEPPITAGVGDSSLFDQ 323

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score =  255 bits (651), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 129/295 (43%), Positives = 191/295 (64%), Gaps = 6/295 (2%)

Query: 354 SVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARV 413
           ++ DF++++ +G GSFG+V  VR     + YA+K ++K  I+   ++ HT  ER +L  V
Sbjct: 58  TLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQIIRMKQIEHTNDERRMLKLV 117

Query: 414 ENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLH 473
           E+PF++ +  TFQ    L++V+ +I GGELF  L++  RF    A+ Y AE+  ALE LH
Sbjct: 118 EHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLH 177

Query: 474 NLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGY 533
           + ++IYRDLKPENILLD  GHI + DFG  K  +     T T CGTP+Y+APE++  + Y
Sbjct: 178 SHNIIYRDLKPENILLDRNGHIKITDFGFAKEVIT---VTWTLCGTPDYIAPEVITTKPY 234

Query: 534 SKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGLLSR 593
           +K VDWW+LG+L++EM+ G  P+YD    K Y+KIL   + +P  F  D  DLL  L++ 
Sbjct: 235 NKSVDWWSLGILIFEMLAGYTPFYDVTPMKTYEKILAGEVVYPPFFHPDVVDLLGKLITA 294

Query: 594 DPKRRLG--FNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSL-DTSNFDQ 645
           D  RRLG   +G D+IKSHP+F+++ W++L  K    PY+PP+   + D+S FDQ
Sbjct: 295 DLTRRLGNLQSGPDDIKSHPWFAEVIWEKLVAKDIETPYEPPIAVGVGDSSLFDQ 349

>Scas_690.13
          Length = 354

 Score =  254 bits (648), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 128/295 (43%), Positives = 189/295 (64%), Gaps = 6/295 (2%)

Query: 354 SVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARV 413
           ++ DF++++ +G GSFG+V  VR     + YA+K ++K  +V   ++ HT  ER +L  V
Sbjct: 40  TLHDFQVMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVRMKQIEHTNDERRMLKLV 99

Query: 414 ENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLH 473
           E+PF++ +  TFQ    L++V+ +I GGELF  L++  RF    A+ Y AE+   LE LH
Sbjct: 100 EHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLGLEYLH 159

Query: 474 NLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGY 533
           + ++IYRDLKPENILLD  GHI + DFG  K   +    T T CG P+Y+APE++  + Y
Sbjct: 160 SHNIIYRDLKPENILLDRNGHIKITDFGFAK---EVDTVTWTLCGPPDYIAPEVIATKPY 216

Query: 534 SKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGLLSR 593
           +K VDWW+LGVL++EM+ G  P+YD    K Y+KILQ  + +P  F  D  DLL  L++ 
Sbjct: 217 NKSVDWWSLGVLIFEMLAGYTPFYDTTPMKTYEKILQGKVVYPTFFHPDVVDLLGKLITA 276

Query: 594 DPKRRLG--FNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSL-DTSNFDQ 645
           D  RR+G   +G+ +IK HP+FS++ W++L  K    PY+PP+   + DTS FDQ
Sbjct: 277 DLTRRIGNLQSGSKDIKCHPWFSEVVWEKLLAKDIETPYEPPITTGIGDTSLFDQ 331

>KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732.1
            Kluyveromyces lactis protein kinase C, start by
            similarity
          Length = 1161

 Score =  271 bits (693), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 136/328 (41%), Positives = 210/328 (64%), Gaps = 6/328 (1%)

Query: 353  LSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVL-- 410
            +S+DDF LLKV+GKG+FGKV+  R K+T+ + A+K ++K  I+   ++    AE+ V   
Sbjct: 829  VSLDDFILLKVLGKGNFGKVLLARSKNTSNLCAIKVLKKDNIIKNHDIESARAEKKVFLL 888

Query: 411  -ARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCAL 469
                ++PF+  L  +FQ+ +++Y  + FI GG+L +H+Q   R S+ RA+ Y AE+L +L
Sbjct: 889  ATETKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNR-RLSVRRAKFYAAEVLLSL 947

Query: 470  ETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLL 529
            +  H+  VIYRDLK ENILL  +GHI + D+GLCK NM   +KT+TFCGTPE++APE+L 
Sbjct: 948  KYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDNMWYGNKTSTFCGTPEFMAPEILK 1007

Query: 530  GQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIG 589
            GQ Y+K VDWWT GVLLY+M+    P+  ED  +++  IL +   +P     D   +  G
Sbjct: 1008 GQAYTKAVDWWTFGVLLYQMLLCQSPFSGEDEDEVFNAILTDEPLYPIDMAGDIVQIFQG 1067

Query: 590  LLSRDPKRRLGFNGAD--EIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSLDTSNFDQEF 647
            LL++DP++RLG    D  EI + PFFS +++  +      PP+ P +  + DTS F++EF
Sbjct: 1068 LLTKDPEKRLGAGPKDALEIMAEPFFSNINFDDILNLRVEPPFVPEIKAADDTSYFEKEF 1127

Query: 648  TKELPVDSVVNDFLSESVQQQFGGWTYV 675
            T   P  + +   LS  +Q++F G++++
Sbjct: 1128 TSAPPTLTPLPSVLSSVLQEEFRGFSFM 1155

>CAGL0M09361g complement(928484..931918) highly similar to sp|P24583
            Saccharomyces cerevisiae YBL105c PKC1 ser/thr protein
            kinase, start by similarity
          Length = 1144

 Score =  270 bits (690), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 137/328 (41%), Positives = 209/328 (63%), Gaps = 6/328 (1%)

Query: 353  LSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVL-- 410
            +S+D+F LLKV+GKG+FGKV+  R K+TN++ A+K ++K  I+   ++    AE+ V   
Sbjct: 812  VSLDNFVLLKVLGKGNFGKVILSRSKNTNRLCAIKVLKKDNIIQNHDIESARAEKKVFLL 871

Query: 411  -ARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCAL 469
              + ++PF+  L  +FQ+ +++Y  + FI GG+L +H+Q + R S+ RA+ Y AE+L AL
Sbjct: 872  ATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYAAEVLLAL 930

Query: 470  ETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLL 529
            +  H+  VIYRDLK ENILL  +GHI + D+GLCK  M   +KT+TFCGTPE++APELL 
Sbjct: 931  KFFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDGMWYGNKTSTFCGTPEFMAPELLR 990

Query: 530  GQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIG 589
             Q Y+K VDWW  GVLLY+M+    P+  +D  +++  IL +   +P     D   +  G
Sbjct: 991  EQDYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGDIVQIFQG 1050

Query: 590  LLSRDPKRRLGFNGAD--EIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSLDTSNFDQEF 647
            LL++DP++RLG    D  EI   PFF  +++  L      PPY P + ++ DTS F+QEF
Sbjct: 1051 LLTKDPEKRLGAGPRDALEIMEEPFFRNINFDDLLNLRIKPPYIPEIKSAEDTSYFEQEF 1110

Query: 648  TKELPVDSVVNDFLSESVQQQFGGWTYV 675
            T   P  + +   LS + Q++F G++Y+
Sbjct: 1111 TSAPPSLTPLPSVLSTTQQEEFRGFSYM 1138

>ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..683847)
            [3450 bp, 1149 aa]
          Length = 1149

 Score =  269 bits (687), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 132/335 (39%), Positives = 212/335 (63%), Gaps = 6/335 (1%)

Query: 346  KPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLA 405
            K    R +S+DDF LLKV+GKG+FGKV+  R K+T+++ A+K ++K +I+   ++    A
Sbjct: 810  KTPKRRKVSLDDFILLKVLGKGNFGKVLLARSKNTDRLCAIKVLKKDHIIQNHDIESARA 869

Query: 406  ERTVL---ARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYT 462
            E+ V     + ++PF+  L  +FQ+ +++Y  + FI GG+L +H+Q + R S+ RA+ Y 
Sbjct: 870  EKKVFLLATKAKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYA 928

Query: 463  AELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEY 522
            AE+L AL+  H+  +IYRDLK ENILL  +GHI + D+GLCK  M   ++T+TFCGTPE+
Sbjct: 929  AEVLLALKYFHDNGIIYRDLKLENILLTLEGHIKIADYGLCKDEMWFGNRTSTFCGTPEF 988

Query: 523  LAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKD 582
            +APE+L  Q Y+K VDWW  GVLLY+M+    P+  +D  +++  IL +   +P     D
Sbjct: 989  MAPEILREQAYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGD 1048

Query: 583  AKDLLIGLLSRDPKRRLGFNGAD--EIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSLDT 640
               +  GLL++DP++RLG    D  E+   PFF  +++  +      PPY P +  + DT
Sbjct: 1049 IVQIFQGLLTKDPEKRLGAGSRDALEVMEEPFFRNINFDDILNLRVEPPYIPTIKAADDT 1108

Query: 641  SNFDQEFTKELPVDSVVNDFLSESVQQQFGGWTYV 675
            S F++EFT   P  + +   LS ++Q++F G++++
Sbjct: 1109 SYFEKEFTAAPPTLTPLPSILSSNLQEEFRGFSFM 1143

>Kwal_27.10581
          Length = 1154

 Score =  268 bits (684), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 133/330 (40%), Positives = 208/330 (63%), Gaps = 6/330 (1%)

Query: 351  RALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVL 410
            R +S+DDF LLKV+GKG+FGKV+    K+  ++ A+K ++K +I+   ++    AE+ V 
Sbjct: 820  RKISLDDFVLLKVLGKGNFGKVLLAESKNNERLCAIKVLKKDHIIKNHDIESARAEKKVF 879

Query: 411  ---ARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLC 467
                + ++PF+  L  +FQ+ +++Y  + FI GG+L +H+Q + R S+ RA+ Y AE+L 
Sbjct: 880  LLATKAKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYAAEVLL 938

Query: 468  ALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPEL 527
            AL+  H+  VIYRDLK ENILL  +GHI + D+GLCK  M   +KT+TFCGTPE++APE+
Sbjct: 939  ALKYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDEMWYGNKTSTFCGTPEFMAPEI 998

Query: 528  LLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLL 587
            L  Q Y+K VDWW  GVLLY+M+    P+  ED  +++  IL +   +P     D   + 
Sbjct: 999  LKEQEYTKAVDWWAFGVLLYQMLLCQSPFSGEDEDEVFNAILTDEPLYPIDMAGDIVQIF 1058

Query: 588  IGLLSRDPKRRLGFNGAD--EIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSLDTSNFDQ 645
             GLL++DP+RRLG    D  E+ + PFF  + +  +      PPY P +  + DTS F++
Sbjct: 1059 QGLLTKDPERRLGAGPRDAAEVMAEPFFRNIVFDDILNLRVQPPYIPEIKAADDTSYFEK 1118

Query: 646  EFTKELPVDSVVNDFLSESVQQQFGGWTYV 675
            EFT   P  + +   LS ++Q++F G++++
Sbjct: 1119 EFTSAPPTLTPLPSVLSSNLQEEFRGFSFM 1148

>Scas_715.34
          Length = 1150

 Score =  268 bits (684), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 132/330 (40%), Positives = 208/330 (63%), Gaps = 6/330 (1%)

Query: 351  RALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVL 410
            R +S+D+F LLKV+GKG+FGKV+  R K+T ++ A+K ++K  I+   ++    AE+ V 
Sbjct: 816  RKVSLDNFILLKVLGKGNFGKVILSRSKNTGRLCAIKVLKKDNIIQNHDIESARAEKKVF 875

Query: 411  ---ARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLC 467
                + ++PF+  L  +FQ+ +++Y  + FI GG+L +H+Q + R S+ RA+ Y AE+L 
Sbjct: 876  LLATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYAAEVLL 934

Query: 468  ALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPEL 527
            AL+  H+  VIYRDLK ENILL  QGHI + D+GLCK  M   +KT+TFCGTPE++APE+
Sbjct: 935  ALKYFHDNGVIYRDLKLENILLTPQGHIKIADYGLCKDEMWYNNKTSTFCGTPEFMAPEI 994

Query: 528  LLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLL 587
            L  QGY++ VDWW  GVLLY+M+    P+  +D  +++  IL +   +P     D   + 
Sbjct: 995  LKEQGYTRAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGDIVQIF 1054

Query: 588  IGLLSRDPKRRLGFNGAD--EIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSLDTSNFDQ 645
             GLL++DP+ RLG    D  E+   PFF  ++++ +      PPY P + +  DTS F+ 
Sbjct: 1055 QGLLTKDPENRLGAGQRDALEVMEEPFFRNINFEDILNLRVQPPYVPEIKSPEDTSYFEH 1114

Query: 646  EFTKELPVDSVVNDFLSESVQQQFGGWTYV 675
            EFT   P  + +   L+ + Q++F G++++
Sbjct: 1115 EFTSAPPTLTPLPSILTTTQQEEFRGFSFM 1144

>AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C
           (TPK1) - SH] (405062..406222) [1161 bp, 386 aa]
          Length = 386

 Score =  251 bits (640), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 127/292 (43%), Positives = 190/292 (65%), Gaps = 6/292 (2%)

Query: 357 DFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENP 416
           DF++L+ +G GSFG+V  VR     + YA+K ++K  +V   +V HT  ER +L+ V +P
Sbjct: 75  DFQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKHVVVKLKQVEHTNDERKMLSVVSHP 134

Query: 417 FIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLD 476
           FI+ +  TFQ   ++++++ +I GGELF  L++  RF    A+ Y AE+  ALE LH+ D
Sbjct: 135 FIIRMWGTFQDAHQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKD 194

Query: 477 VIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKV 536
           +IYRDLKPENILLD  GHI L DFG  K      D T T CGTP+Y+APE++  + Y+K 
Sbjct: 195 IIYRDLKPENILLDKNGHIKLTDFGFAKYV---PDVTYTLCGTPDYIAPEVVSTKPYNKS 251

Query: 537 VDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGLLSRDPK 596
           VDWW+ G+L+YEM+ G  P+YD++    Y+ IL   ++FP  F+   +DLL  L++RD  
Sbjct: 252 VDWWSFGILIYEMLAGYTPFYDQNTMGTYENILNAEVKFPPFFNAKVRDLLSQLITRDLS 311

Query: 597 RRLG--FNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPV-MNSLDTSNFDQ 645
           +RLG   NG+ ++K+HP+FS++ W +L  +    PY+PP+     DTS +D+
Sbjct: 312 KRLGNLQNGSQDVKAHPWFSEVIWDKLLCRNIETPYEPPIHAGQGDTSQYDR 363

>YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase C,
            regulates MAP kinase cascade involved in regulating cell
            wall metabolism [3456 bp, 1151 aa]
          Length = 1151

 Score =  266 bits (681), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 132/335 (39%), Positives = 212/335 (63%), Gaps = 6/335 (1%)

Query: 346  KPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLA 405
            + A  R +S+D+F LLKV+GKG+FGKV+  + K+T+++ A+K ++K  I+   ++    A
Sbjct: 812  RAAKRRKVSLDNFVLLKVLGKGNFGKVILSKSKNTDRLCAIKVLKKDNIIQNHDIESARA 871

Query: 406  ERTVL---ARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYT 462
            E+ V     + ++PF+  L  +FQ+ +++Y  + FI GG+L +H+Q + R S+ RA+ Y 
Sbjct: 872  EKKVFLLATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYA 930

Query: 463  AELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEY 522
            AE+L AL+  H+  VIYRDLK ENILL  +GHI + D+GLCK  M   ++T+TFCGTPE+
Sbjct: 931  AEVLLALKYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDEMWYGNRTSTFCGTPEF 990

Query: 523  LAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKD 582
            +APE+L  Q Y+K VDWW  GVLLY+M+    P+  +D  +++  IL +   +P     +
Sbjct: 991  MAPEILKEQEYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGE 1050

Query: 583  AKDLLIGLLSRDPKRRLGF--NGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSLDT 640
               +  GLL++DP++RLG     ADE+   PFF  +++  +      PPY P + +  DT
Sbjct: 1051 IVQIFQGLLTKDPEKRLGAGPRDADEVMEEPFFRNINFDDILNLRVKPPYIPEIKSPEDT 1110

Query: 641  SNFDQEFTKELPVDSVVNDFLSESVQQQFGGWTYV 675
            S F+QEFT   P  + +   L+ S Q++F G++++
Sbjct: 1111 SYFEQEFTSAPPTLTPLPSVLTTSQQEEFRGFSFM 1145

>YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine
           protein kinase with unknown role [2163 bp, 720 aa]
          Length = 720

 Score =  224 bits (572), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 116/298 (38%), Positives = 179/298 (60%), Gaps = 25/298 (8%)

Query: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPF 417
           FE ++++G+G  GKV  +R++DTN+++ALK + K  ++ + ++   L E+ +LA  ++PF
Sbjct: 324 FEKIRLLGQGDVGKVYLMRERDTNQIFALKVLNKHEMIKRKKIKRVLTEQEILATSDHPF 383

Query: 418 IVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSR--ARLYTAELLCALETLHNL 475
           IV L  +FQ+ D LY+ + +  GGE F  LQ      ++   A+ Y +E++ ALE LH L
Sbjct: 384 IVTLYHSFQTKDYLYLCMEYCMGGEFFRALQTRKSKCIAEEDAKFYASEVVAALEYLHLL 443

Query: 476 DVIYRDLKPENILLDHQGHIALCDFGLC-------KLNMKGQD-----------KTNTFC 517
             IYRDLKPENILL   GH+ L DF L        K  MK              +TN+F 
Sbjct: 444 GFIYRDLKPENILLHQSGHVMLSDFDLSIQATGSKKPTMKDSTYLDTKICSDGFRTNSFV 503

Query: 518 GTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPD 577
           GT EYLAPE++ G G++  VDWWTLG+L+YEM+ G  P+  ++  + +  IL + ++FP 
Sbjct: 504 GTEEYLAPEVIRGNGHTAAVDWWTLGILIYEMLFGCTPFKGDNSNETFSNILTKDVKFPH 563

Query: 578 G--FDKDAKDLLIGLLSRDPKRRLGF-NGADEIKSHPFFSQLSWKRLWMKGYIPPYKP 632
                K+ KDL+  LL+++  +RLG  +GA +IK HPFF ++ W   +++   PP  P
Sbjct: 564 DKEVSKNCKDLIKKLLNKNEAKRLGSKSGAADIKRHPFFKKVQWS--FLRNQDPPLIP 619

>CAGL0C03509g complement(350846..353533) similar to sp|P53739
           Saccharomyces cerevisiae YNR047w or sp|P25341
           Saccharomyces cerevisiae YCR091w KIN82, hypothetical
           start
          Length = 895

 Score =  227 bits (578), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 123/321 (38%), Positives = 186/321 (57%), Gaps = 40/321 (12%)

Query: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPF 417
           FE ++++G+G  GKV  V++K TN++YALK   KS ++ + ++   LAE+ +LA   +PF
Sbjct: 497 FEKIRLLGQGDVGKVYLVKEKRTNRLYALKIFSKSEMIKRKKIKRILAEQEILATSNHPF 556

Query: 418 IVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSR--ARLYTAELLCALETLHNL 475
           +V L  +FQS D LY+ + +  GGE F  LQ      +S   A+ Y +E+  ALE LH L
Sbjct: 557 VVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKSKCISEEDAKFYASEVTAALEYLHLL 616

Query: 476 DVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQD------------------------ 511
             IYRDLKPENILL   GHI L DF L    ++ +D                        
Sbjct: 617 GFIYRDLKPENILLHQSGHIMLSDFDLS---IQAKDAKVPVVKGNAQSTVVDTKICSDGF 673

Query: 512 KTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQE 571
           +TN+F GT EY+APE++ G G++  VDWWTLG+L+YEM+ G  P+  E+  + +  IL++
Sbjct: 674 RTNSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGENTNETFSNILKK 733

Query: 572 PLRFPDG--FDKDAKDLLIGLLSRDPKRRLGFN-GADEIKSHPFFSQLSWKRLWMKGYIP 628
            + FP+     ++ KDL+  LL ++  +RLG   GA +IK HPFF +++W  L  +    
Sbjct: 734 DVTFPNNNEVSRNCKDLIKKLLIKNESKRLGSKMGAADIKKHPFFKKVNWTLLRNQ---- 789

Query: 629 PYKPPVMNSLDTSNFDQEFTK 649
             +PP++  L  + +D  FTK
Sbjct: 790 --EPPLIPVLTENGYD--FTK 806

>Scas_629.16
          Length = 918

 Score =  226 bits (577), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 123/301 (40%), Positives = 173/301 (57%), Gaps = 28/301 (9%)

Query: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPF 417
           FE +K++G+G  GKV  VR+K TN++YALK   KS ++ + ++   LAE+ +LA   +PF
Sbjct: 519 FEKIKLLGQGDVGKVYLVREKKTNRLYALKIFSKSEMIKRKKIKRILAEQEILATSNHPF 578

Query: 418 IVPLKFTFQSPDKLYIVLAFINGGELFYHLQ--REGRFSLSRARLYTAELLCALETLHNL 475
           +V L  +FQS D LY  + +  GGE F  LQ  R    S   AR Y +E+  ALE LH L
Sbjct: 579 VVTLYHSFQSEDYLYFCMEYCMGGEFFRALQTRRTKCISEDDARFYASEVTAALEYLHLL 638

Query: 476 DVIYRDLKPENILLDHQGHIALCDFGLCKLN-------MKGQD--------------KTN 514
             IYRDLKPENILL   GHI L DF L           MKG                +TN
Sbjct: 639 GFIYRDLKPENILLHKSGHIMLSDFDLSVQAKDAKVPVMKGSAESTVVDTKICSDGFRTN 698

Query: 515 TFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLR 574
           +F GT EY+APE++ G G++  VDWWTLG+L+YEM+ G  P+      + +  IL+  + 
Sbjct: 699 SFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGSSSNETFSNILKNDVS 758

Query: 575 FPDGFD--KDAKDLLIGLLSRDPKRRLGFN-GADEIKSHPFFSQLSWKRLWMKGYIPPYK 631
           FP+  D  ++ KDL+  LL ++  +RLG   GA ++K HPFF ++ W   +++   PP  
Sbjct: 759 FPNNNDISRNCKDLIKKLLCKNEAKRLGSKMGAADVKRHPFFKKVQWS--FLRNQEPPLI 816

Query: 632 P 632
           P
Sbjct: 817 P 817

>Kwal_23.6458
          Length = 868

 Score =  224 bits (570), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 122/321 (38%), Positives = 184/321 (57%), Gaps = 40/321 (12%)

Query: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPF 417
           FE +K++G+G  GKV  V++K TN++YALK   K  ++ + ++   LAE+ +LA   +PF
Sbjct: 464 FEKIKLLGQGDVGKVYLVKEKKTNRLYALKIFSKEEMIKRKKIKRILAEQEILATSNHPF 523

Query: 418 IVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSR--ARLYTAELLCALETLHNL 475
           IV L  +FQS D LY+ + +  GGE F  LQ      +    AR Y++E++ A+E LH +
Sbjct: 524 IVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKTKCIDEDDARFYSSEVVAAIEYLHLM 583

Query: 476 DVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQD------------------------ 511
             IYRDLKPENILL   GHI L DF    L+++ +D                        
Sbjct: 584 GFIYRDLKPENILLHKSGHIMLSDF---DLSVQAKDTKNPVVKGSAQSSLLDTKICSDGF 640

Query: 512 KTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQE 571
           +TN+F GT EY+APE++ G G++  VDWWTLG+L+YEM+ G  PY  ++  K +  +L+ 
Sbjct: 641 RTNSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPYKGDNTNKTFSNVLKN 700

Query: 572 PLRFPDG--FDKDAKDLLIGLLSRDPKRRLGFN-GADEIKSHPFFSQLSWKRLWMKGYIP 628
            + FP+     ++ KDL+  LL +   RRLG   GA +IK HPFF ++ W  L  +    
Sbjct: 701 EVSFPNNNEVSRNCKDLIRKLLIKSETRRLGSKFGASDIKKHPFFKKVQWSLLRNQ---- 756

Query: 629 PYKPPVMNSLDTSNFDQEFTK 649
             +PP++  L  + +D  FT+
Sbjct: 757 --EPPLIPVLTENGYD--FTR 773

>CAGL0J06072g complement(572377..574698) similar to sp|P53894
           Saccharomyces cerevisiae YNL161w CBK1, hypothetical
           start
          Length = 773

 Score =  221 bits (562), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 126/358 (35%), Positives = 189/358 (52%), Gaps = 63/358 (17%)

Query: 356 DDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVEN 415
           +DF  ++VIGKG+FG+V  V+KKDT K+YA+K + KS +  K ++ H  AER VLA  ++
Sbjct: 368 EDFHTVQVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGTDS 427

Query: 416 PFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNL 475
           P+IV L ++FQ    LY+++ F+ GG+L   L R   F+    R Y AE + A+ET+H L
Sbjct: 428 PWIVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRWQLFTEDVTRFYMAECILAIETIHKL 487

Query: 476 DVIYRDLKPENILLDHQGHIALCDFGLC-------------------------------- 503
             I+RD+KP+NIL+D +GHI L DFGL                                 
Sbjct: 488 GFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYYKKLLQQDEATTKNGAPNDAG 547

Query: 504 --------------KLNMKGQDKTNTF-----------CGTPEYLAPELLLGQGYSKVVD 538
                          L M  + +  T+            GTP+Y+APE+ L QGY +  D
Sbjct: 548 DGSNNRQTMIVDSINLTMSNRQQIQTWRKSRRLMAYSTVGTPDYIAPEIFLYQGYGQDCD 607

Query: 539 WWTLGVLLYEMMTGLPPYYDEDVPKMYKKIL--QEPLRFPDG--FDKDAKDLLIGLLSRD 594
           WW+LG ++YE + G PP+  E   + Y+KI+  ++ L+FP+      +A+DL+  LL+  
Sbjct: 608 WWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQFPEDVHISYEAEDLIRRLLTHS 667

Query: 595 PKRRLGFNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSLDTSNFDQEFTKELP 652
            +R     GADEIKSHPFF  + W  +  +    PY P + +  DT  F  +  + +P
Sbjct: 668 NQRLGRQGGADEIKSHPFFRGVDWNTI--RQVEAPYIPKLSSITDTRFFPTDELENVP 723

>Kwal_56.22788
          Length = 515

 Score =  213 bits (543), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 125/386 (32%), Positives = 201/386 (52%), Gaps = 62/386 (16%)

Query: 354 SVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVS--------------KSE 399
           +++DF  ++V+G+G++GKV+ V+   T+++YA+K ++K+ I+               +  
Sbjct: 121 TLEDFAPVRVLGRGAYGKVLLVKDSHTSRLYAMKQLKKAEILIHDGSSEEGQPDSNLEKR 180

Query: 400 VIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRAR 459
           +  T AERT+L+++E+P IV L ++F    KLY++L FI GGELFYHL+ +G        
Sbjct: 181 LERTFAERTILSQLEHPNIVKLFYSFHDHHKLYLILQFIPGGELFYHLKEQGTLDEDTVA 240

Query: 460 LYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCK------------LNM 507
            Y AE+ CAL  LH   V+YRDLKPEN LLD +GH+ L DFGL K            +N 
Sbjct: 241 FYAAEISCALRFLHKRGVVYRDLKPENCLLDERGHLVLTDFGLSKVSASDDSADGGDVNT 300

Query: 508 KGQDKT-----NTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVP 562
            G +       ++  GTPEY APE+L G+ Y++  DW++LG L+++M+ G PPY   +  
Sbjct: 301 NGHEGESVCTLHSIIGTPEYCAPEILEGKPYTQNCDWYSLGCLIFDMLIGKPPYTGVNHK 360

Query: 563 KMYKKILQEPL-RFPDGFDKDAKDLLIGLLSRD------------------PKRRLGFNG 603
            +  KIL++ + + P    +  KD L  LL +D                   K++ G   
Sbjct: 361 VILNKILKDKIPKIPSYLSEGMKDFLAALLKKDVTKRWDVDKFWNTDGPKLKKKKAGQAK 420

Query: 604 ADEIKSHPFFSQLSWKRL----WMKGYIPPYKPPVMNSLDTSNFDQEFT--------KEL 651
               ++H  F ++SW ++      +    P  P + +     NFD EFT        ++ 
Sbjct: 421 TTSFQAHFVFRKISWLKMETGELQRNTEGPILPIITDWELAENFDSEFTEMRLDSEAQDQ 480

Query: 652 PVDSVVNDFLSESVQQQFGGWTYVGS 677
           P +  +N F     +  F G++YV S
Sbjct: 481 PANLQINGFSRSGDKDVFKGFSYVAS 506

>ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) -
           SH] complement(994583..997204) [2622 bp, 873 aa]
          Length = 873

 Score =  217 bits (553), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 119/313 (38%), Positives = 176/313 (56%), Gaps = 32/313 (10%)

Query: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPF 417
           FE ++++G+G  GKV  VR+K ++++YALK   K+ ++ + ++   LAE+ +LA   +PF
Sbjct: 461 FEKIRLLGQGDVGKVYLVREKKSDRLYALKIFGKAEMIKRKKIKRILAEQEILATSNHPF 520

Query: 418 IVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSR--ARLYTAELLCALETLHNL 475
           IV L  +FQ+ D LY+ + +  GGE F  LQ      +S   AR Y +E+  ALE LH +
Sbjct: 521 IVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRKTKCISEDDARFYASEVTAALEYLHLM 580

Query: 476 DVIYRDLKPENILLDHQGHIALCDF-------GLCKLNMKGQD--------------KTN 514
             IYRDLKPENILL   GH+ L DF       G     +KG                +TN
Sbjct: 581 GFIYRDLKPENILLHQSGHVMLSDFDLSVQAKGTRNPQVKGNAQSSLVDTKVCSDGFRTN 640

Query: 515 TFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLR 574
           +F GT EY+APE++ G G++  VDWWTLG+L YEM+ G  P+  ++  + +  IL+  + 
Sbjct: 641 SFVGTEEYIAPEVIRGNGHTASVDWWTLGILTYEMLFGFTPFKGDNTNQTFSNILKNDVY 700

Query: 575 FPDGFD--KDAKDLLIGLLSRDPKRRLGFN-GADEIKSHPFFSQLSWKRLWMKGYIPPYK 631
           FP+  D  +  KDL+  LL +   +RLG   GA EIK HPFF  + W  L  +      +
Sbjct: 701 FPNNNDISRTCKDLIKKLLVKKESKRLGSKFGASEIKKHPFFKTVQWALLRNQ------E 754

Query: 632 PPVMNSLDTSNFD 644
           PP++  L    +D
Sbjct: 755 PPLIPVLTEDGYD 767

>KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1
           Kluyveromyces lactis MUP1 protein, hypothetical start
          Length = 774

 Score =  215 bits (548), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 115/301 (38%), Positives = 170/301 (56%), Gaps = 28/301 (9%)

Query: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPF 417
           FE ++++G+G  G+V  VR+K TN++YALK   K  ++ + ++   L E+ +LA   +PF
Sbjct: 379 FEKIRLLGQGDVGRVYLVREKQTNRLYALKIFSKPEMIKRKKIKRILTEQEILATSNHPF 438

Query: 418 IVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSR--ARLYTAELLCALETLHNL 475
           IV L  +FQ+ D LY+ + +  GGE F  LQ      +S   AR Y++E+  ALE LH +
Sbjct: 439 IVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRKTKCISEDDARFYSSEVTAALEYLHLM 498

Query: 476 DVIYRDLKPENILLDHQGHIALCDFGLC-------KLNMKGQD--------------KTN 514
             IYRDLKPENILL   GHI L DF L           +KG                +TN
Sbjct: 499 GFIYRDLKPENILLHQSGHIMLSDFDLSVQAKDTKNPQVKGNASHSLVDTKICSDGFRTN 558

Query: 515 TFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLR 574
           +F GT EY+APE++ G G++  VDWWTLG+L+YEM+ G  P+  ++  + +  IL+  + 
Sbjct: 559 SFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGDNTNQTFSNILKNEVV 618

Query: 575 FPDGFD--KDAKDLLIGLLSRDPKRRLGFN-GADEIKSHPFFSQLSWKRLWMKGYIPPYK 631
            P+  +  +  KDL+  LL ++  +RLG   GA +IK HPFF    W    ++   PP  
Sbjct: 619 IPNNNETSRACKDLIRKLLIKNENKRLGSKLGASDIKKHPFFKNDQWS--LLRNQEPPLI 676

Query: 632 P 632
           P
Sbjct: 677 P 677

>KLLA0F24618g complement(2288943..2290613) similar to sp|P38070
           Saccharomyces cerevisiae YBR028c, start by similarity
          Length = 556

 Score =  206 bits (525), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 125/352 (35%), Positives = 193/352 (54%), Gaps = 48/352 (13%)

Query: 355 VDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVI------------- 401
           +DDF  ++ +G+G++GKV+ V+   ++K+YA+K ++K+ I+   + I             
Sbjct: 167 LDDFVPIRCLGEGAYGKVLLVKDSLSSKLYAMKQLKKAEILISEDSIEKDANTTVEKRIE 226

Query: 402 HTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLY 461
            T AERT+L+++E+P IV L ++F    KLY+VL +I GGELFYHL+ +G         Y
Sbjct: 227 RTFAERTILSQLEHPNIVKLFYSFHDNHKLYLVLQYIPGGELFYHLKEQGTLDEGTVAFY 286

Query: 462 TAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNM--------KGQDKT 513
            AEL CAL+ LH+  ++YRDLKPEN LL+ +GH+ L DFGL K ++        +G++  
Sbjct: 287 AAELSCALKFLHSKGIVYRDLKPENCLLNERGHLVLTDFGLSKKSVFDDAATPEEGENVN 346

Query: 514 NTFC--GTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQE 571
             +   GTPEY APE+L G+ Y++  DW++LG L+Y+M+ G PP+   +   +  KI QE
Sbjct: 347 QLYSIIGTPEYCAPEILAGEPYTQNCDWYSLGCLVYDMLIGKPPFTGVNHKIILNKIKQE 406

Query: 572 P--LRFPDGFDKDAKDLLIGLLSRDPKRRLGFN-------------GADEIKS-----HP 611
               R P       KD L  LL +DP +R   +              A + K+     H 
Sbjct: 407 KTGARIPSYLSDGFKDYLGALLRKDPTKRWDVDKYWAQDGPKTKKKKAGQAKTTNYIGHF 466

Query: 612 FFSQLSWKRL----WMKGYIPPYKPPVMNSLDTSNFDQEFTKELPVDSVVND 659
            F ++ WK+L      K  + P  P + +     NFD EFT E  +D+ + D
Sbjct: 467 IFRKIIWKQLLSGDLQKISVGPILPIITDWELAENFDTEFT-EKRLDTSIYD 517

>Scas_720.103
          Length = 804

 Score =  211 bits (536), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 116/308 (37%), Positives = 171/308 (55%), Gaps = 36/308 (11%)

Query: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPF 417
           FE +K++G+G  GKV  V++K TN +YA+K   K  ++ + ++   + E+ +LA   +PF
Sbjct: 405 FEKIKLLGQGDVGKVFLVKEKKTNGLYAMKIYNKKDMIKREKIKRVITEQEILATSNHPF 464

Query: 418 IVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSR--ARLYTAELLCALETLHNL 475
           IV L  +FQ+ D LY+ + +  GGE F  LQ      +    AR Y +E+L ALE LH L
Sbjct: 465 IVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRDSKCICEDDARFYASEVLAALEYLHLL 524

Query: 476 DVIYRDLKPENILLDHQGHIALCDFGL----------------------------CKLNM 507
             IYRDLKPENILL   GHI L DF L                             K+  
Sbjct: 525 GFIYRDLKPENILLHKSGHIMLSDFDLSVHAKDSKNPIFMKDGILPTTNSNLIVDTKICS 584

Query: 508 KGQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKK 567
           +G  +TN+F GT EY+APE++ G G++  VDWWTLG+L++EM+ G  P+  +   + +  
Sbjct: 585 EGF-RTNSFVGTEEYIAPEVIRGNGHTVAVDWWTLGILIFEMLFGKTPFKGDTTNETFAN 643

Query: 568 ILQEPLRFPDGFD--KDAKDLLIGLLSRDPKRRLGFN-GADEIKSHPFFSQLSWKRLWMK 624
           IL +   FP+  D  ++ K+L+  LL+++  +RLG   GA EIK H FF  ++W  L  +
Sbjct: 644 ILSKDFEFPNSNDITRNCKNLIKKLLTKNETKRLGSKMGAAEIKKHSFFKNVNWNML--R 701

Query: 625 GYIPPYKP 632
              PP  P
Sbjct: 702 NEEPPLIP 709

>YBR028C (YBR028C) [220] chr2 complement(294387..295964)
           Serine/threonine protein kinase with similarity to
           Ypk2p/Ykr2p and Ypk1p [1578 bp, 525 aa]
          Length = 525

 Score =  204 bits (519), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 125/360 (34%), Positives = 188/360 (52%), Gaps = 65/360 (18%)

Query: 354 SVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIV-------SKSE------- 399
           ++ DF+ ++V+G+G++GKV+ V+  +T+K+YA+K +RK+ I+       SK E       
Sbjct: 124 NLHDFKPVRVLGQGAYGKVLLVKDVNTSKLYAMKQLRKAEILISQTATDSKREDEDKNDG 183

Query: 400 ------------VIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHL 447
                       +  T AER++L+ +E+P IV L ++F    KLY++L +I GGELFYHL
Sbjct: 184 NNNDNDDGLSKRLERTFAERSILSEIEHPNIVKLFYSFHDNSKLYLLLQYIPGGELFYHL 243

Query: 448 QREGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLN- 506
           +  G    +    Y AE+ CAL  LH   V+YRDLKPEN LL+ +GH+ L DFGL K + 
Sbjct: 244 KEHGTLDETTVSFYAAEISCALRFLHTKGVVYRDLKPENCLLNQRGHLVLTDFGLSKKSA 303

Query: 507 ----MKGQDKTN-----TFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYY 557
               +  +D  N     +  GTPEY APE+LLG+ YS+  DW++LG LLY+M+ G PPY 
Sbjct: 304 NDSAVDEEDPENVNALYSIIGTPEYCAPEILLGKAYSQNCDWYSLGCLLYDMLVGKPPYT 363

Query: 558 DEDVPKMYKKILQ--EPLRFPDGFDKDAKDLLIGLLSRDPKRRLGFN------GADE--- 606
             +   +  KI Q  +  + P    +  KD+L  LL ++  +R   +      GA+    
Sbjct: 364 GSNHKVIINKIQQNKQGPKIPFYLSEGMKDILNALLKKETAKRWNVDKYWAKTGANNKPT 423

Query: 607 --------------IKSHPFFSQLSWKRL----WMKGYIPPYKPPVMNSLDTSNFDQEFT 648
                            H  F ++ WK L      K  + P  P + +     NFD EFT
Sbjct: 424 KSKKKKSGAARTSLFTEHFIFRKIDWKLLESGQLQKTTLGPIVPVITDLELAENFDTEFT 483

>CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces
           cerevisiae YBR028c, start by similarity
          Length = 542

 Score =  203 bits (516), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 131/387 (33%), Positives = 195/387 (50%), Gaps = 80/387 (20%)

Query: 336 NGKLNLSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIV 395
           +G   +  D +   +R +S  DF+ ++V+G+G++GKV+ V+ K T+K+YA+K ++K+ I+
Sbjct: 125 DGGAIVGGDVRTGISREIS--DFKPIRVLGQGAYGKVILVKDKQTSKLYAMKQLKKAEIL 182

Query: 396 ----------------------SKSE-----VIHTLAERTVLARVENPFIVPLKFTFQSP 428
                                 S+ E     +  T AERT+L+++E+P IV L ++F   
Sbjct: 183 IAPTDANTESMDKLAELDKPVDSEDEKLSKRIERTFAERTILSQLEHPNIVKLFYSFHDT 242

Query: 429 DKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENIL 488
            KLY++L +I GGELF+HL+  G         Y AE+ CAL+ LH+  V+YRDLKPEN L
Sbjct: 243 SKLYLLLQYIPGGELFFHLKEHGTLEEDTVAFYAAEISCALKFLHSKGVVYRDLKPENCL 302

Query: 489 LDHQGHIALCDFGLCKLNM------------KGQD--KTNTFCGTPEYLAPELLLGQGYS 534
           L+  GH+ L DFGL K +             +G+D  + ++  GTPEY APE+LLGQ Y+
Sbjct: 303 LNQNGHLVLTDFGLSKSSASNASQEDLGAGNEGEDVNELHSIIGTPEYCAPEILLGQPYT 362

Query: 535 KVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQE------PLRFPDGFDKDAKDLLI 588
              DW++LG LLY+M+TG PPY   +   +  KI  +      P    DG     KD+L 
Sbjct: 363 ANCDWYSLGCLLYDMLTGKPPYTGANHKVIANKIKNDKQGPKIPYYLSDGM----KDVLG 418

Query: 589 GLLSRDPKRRLGFNG-----------------------ADEIKSHPFFSQLSWKRL---- 621
            LL  DPK+R   +                            +SH  F ++ WK L    
Sbjct: 419 ALLKSDPKKRWDVDKYWSEPKKDNSQKKGQKKKKSKERTSPFQSHFVFRKVDWKGLSSGE 478

Query: 622 WMKGYIPPYKPPVMNSLDTSNFDQEFT 648
                  P  P + +     NFD EFT
Sbjct: 479 LQNTTFGPIVPVITDWELAENFDSEFT 505

>AEL083W [2423] [Homologous to ScYBR028C - SH]
           complement(470964..472574) [1611 bp, 536 aa]
          Length = 536

 Score =  200 bits (509), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 118/346 (34%), Positives = 183/346 (52%), Gaps = 52/346 (15%)

Query: 355 VDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKS---------------- 398
           ++DF+ ++V+G+G++GKV+ V+ + T+K++A+K ++K+ IV  +                
Sbjct: 143 LEDFKPVRVLGRGAYGKVLLVKDQLTSKLFAMKQLKKAEIVVTAPEEESTDGEDAVLLPA 202

Query: 399 ----EVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFS 454
                V  T AERT+L+++E+P IV L ++F    KLY+VL +I GGELFYHL+ +G   
Sbjct: 203 VVEKRVERTFAERTILSQLEHPNIVKLFYSFHDHHKLYLVLQYIPGGELFYHLKEQGTLD 262

Query: 455 LSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQD--- 511
                 Y AE+ CAL+ LH+  ++YRDLKPEN LLD +GH+ L DFGL K  +   D   
Sbjct: 263 EVTVSFYAAEISCALKFLHSKGIVYRDLKPENCLLDDKGHLVLTDFGLSKRGVNQADSPL 322

Query: 512 ------KTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMY 565
                 +  +  GTPEY APE+L GQ Y++  DW++LG L Y+M+ G PP+   +   + 
Sbjct: 323 GGEQVEELYSIIGTPEYCAPEILCGQPYTQNCDWYSLGSLTYDMLIGKPPFTGANHKVIL 382

Query: 566 KKILQEP-LRFPDGFDKDAKDLLIGLLSRDPKRRLGFN------------------GADE 606
            KI Q+  ++ P       KD L  LL +D  +R   +                      
Sbjct: 383 SKIKQDKGIKIPHYLSDGMKDYLNALLKKDIGKRWDVDRFWDKEGTKTKKKKAGQAKTSC 442

Query: 607 IKSHPFFSQLSWKRL----WMKGYIPPYKPPVMNSLDTSNFDQEFT 648
            +SH  F +++WK +      +    P  P + +     NFD EFT
Sbjct: 443 YQSHFIFRKINWKLMENGDLQRTTYGPIIPVITDWELAENFDSEFT 488

>Scas_593.14d
          Length = 495

 Score =  194 bits (494), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 107/278 (38%), Positives = 165/278 (59%), Gaps = 33/278 (11%)

Query: 354 SVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIV------SKSE-------- 399
           +V DF  ++V+G+G++GKV+ V+ K TNK+YA+K ++K+ I+      S  E        
Sbjct: 132 TVKDFRPVRVLGQGAYGKVILVKDKLTNKLYAMKQLKKAEILITESPKSNEEDDVNLGKR 191

Query: 400 VIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRAR 459
           +  T AE+++LA +E+P IV L ++F    KLY++L +I GGELF+HL+ +G        
Sbjct: 192 IERTFAEKSILAELEHPNIVKLFYSFHDNSKLYLLLQYIPGGELFFHLKEQGTLDEDTVA 251

Query: 460 LYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCK--------------- 504
            Y AE+ CAL+ LH+  ++YRDLKPEN LL+ +GH+ L DFGL K               
Sbjct: 252 FYAAEISCALKFLHDKGIVYRDLKPENCLLNDKGHLVLTDFGLSKKSVTQNSANPSEVTS 311

Query: 505 LNMKGQDKT--NTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVP 562
           LN   +D +  ++  GTPEY APE+L G  Y+K  DW++LG L+Y+M++G PPY   +  
Sbjct: 312 LNEPSEDLSTLHSIIGTPEYCAPEILQGLPYNKNCDWYSLGCLIYDMLSGKPPYTGANHK 371

Query: 563 KMYKKILQEPL--RFPDGFDKDAKDLLIGLLSRDPKRR 598
            +  KI ++    + P    +  KD+L  LL +D  +R
Sbjct: 372 VILNKIQKDKQGPKIPYYLSEGMKDMLNWLLKKDQSKR 409

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score =  177 bits (448), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 100/268 (37%), Positives = 152/268 (56%), Gaps = 4/268 (1%)

Query: 346 KPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLA 405
           K   N  LS+ DFE+ + +GKG FGKV  VR K +  + ALKAI K+ I+  + +     
Sbjct: 88  KSTYNNKLSLKDFEVGRKLGKGKFGKVYCVRHKKSGFICALKAIEKNEILQFNLLKQLKR 147

Query: 406 ERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAEL 465
           E  +   +++P I+ L   F    ++Y+++     GEL+  L+  G F+   A  Y  ++
Sbjct: 148 EVDIQLGMDHPNIIKLYAHFHDEKRVYLLMEHSINGELYKSLKNNGPFNDVLASHYIYQI 207

Query: 466 LCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAP 525
             AL  +H   +I+RD+KPEN+L+     + L DFG   LN +G  K  T CGT +YL+P
Sbjct: 208 ADALHYMHKKRIIHRDVKPENVLIGFDNVVKLADFGWSILNPEG-SKRKTLCGTIDYLSP 266

Query: 526 ELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKD 585
           E++  + Y + VD W LGVL YE++ G+PP+ +      YK+IL+  L FP+   KDAKD
Sbjct: 267 EMITPREYDEQVDVWALGVLAYELVVGVPPFEENSKELTYKRILKCDLNFPESISKDAKD 326

Query: 586 LLIGLLSRDPKRRLGFNGADEIKSHPFF 613
           L+  LL  D  +RL   G   +K+HP+ 
Sbjct: 327 LISKLLVTDTTQRLSLTG---VKTHPWI 351

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score =  174 bits (440), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 95/263 (36%), Positives = 150/263 (57%), Gaps = 4/263 (1%)

Query: 353 LSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLAR 412
           L + DFE+ KV+GKG FG+V  VR  ++  V ALKA+ K  I+  +       E  + + 
Sbjct: 104 LKLADFEIGKVLGKGKFGRVYCVRHIESGFVCALKAMEKKDIIQYNIEKQFRREVEIQSS 163

Query: 413 VENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETL 472
           + +P +  L   F    ++Y+++ ++  GEL+ HL+    F+   A  Y  ++  AL+ +
Sbjct: 164 LRHPNLTQLYGYFHDEKRVYLLMEYLVNGELYKHLKGRSHFNDVVASYYVYQMADALDYM 223

Query: 473 HNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQG 532
           H  ++++RD+KPENI++     I L DFG   +  KG  K  T CGT +YL+PEL+  + 
Sbjct: 224 HERNILHRDIKPENIIIGFNNTIKLTDFGWSVITPKG-SKRKTLCGTVDYLSPELIRSRE 282

Query: 533 YSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGLLS 592
           Y++ VD W LGVL YE++ G PP+ +E     YK+IL+  L FPD  D +A+ L+  LL 
Sbjct: 283 YNEKVDVWALGVLTYELLVGSPPFEEESKELTYKRILKRNLIFPDHVDTEARHLISRLLE 342

Query: 593 RDPKRRLGFNGADEIKSHPFFSQ 615
            DP  R+      E+K HP+  +
Sbjct: 343 YDPGDRIPLK---EVKKHPWIEK 362

>Kwal_56.24091
          Length = 381

 Score =  169 bits (427), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 99/269 (36%), Positives = 157/269 (58%), Gaps = 4/269 (1%)

Query: 347 PATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAE 406
           P   + +S+DDFE+ K +GKG FGKV  V+ K T  + ALKA++KS IV  +       E
Sbjct: 112 PVHYQDISLDDFEVGKKLGKGKFGKVYCVKHKRTGFICALKAMKKSEIVQYNVQKQFRRE 171

Query: 407 RTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELL 466
             + + +++P +  L   F    ++Y+++ ++  GEL+ HL+  G F+   A  +  ++ 
Sbjct: 172 VEIQSSLKHPNLTRLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDITASHFVHQMA 231

Query: 467 CALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPE 526
            AL  +H+ ++++RD+KPENILL  Q  + L DFG    N+ G  K  T CGT +YL+PE
Sbjct: 232 DALNYMHSKNILHRDIKPENILLGFQNTLKLTDFGWSVSNV-GNSKRKTLCGTMDYLSPE 290

Query: 527 LLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDL 586
           L+  + Y   VD W LGVL YE++ G PP+ ++     YK+I++  LRFPD     A+DL
Sbjct: 291 LIKSREYDNKVDVWALGVLTYELLVGSPPFEEDTKELTYKRIIKRDLRFPDQVSPHARDL 350

Query: 587 LIGLLSRDPKRRLGFNGADEIKSHPFFSQ 615
           +  LL  DP+ R+      ++K HP+  +
Sbjct: 351 ISRLLEYDPQNRIPLK---DVKRHPWIKK 376

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score =  168 bits (425), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 92/263 (34%), Positives = 155/263 (58%), Gaps = 6/263 (2%)

Query: 353 LSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLAR 412
           +++ DFE+ K++GKG FGKV  V+ ++T  + ALKA+ K  IV  +       E  +   
Sbjct: 95  MTLQDFEIGKILGKGKFGKVYCVKHRETGLICALKAMEKKEIVQYTIQKQFRREVEIQGS 154

Query: 413 VENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETL 472
            ++  +  L   F    ++Y+++ ++  GEL+  L+  G  + + A  +  ++  AL+ +
Sbjct: 155 FKHKNLTQLYGFFYDEKRVYLLMEYVYYGELYKFLKNNGPLNETLASYFVYQMANALDYM 214

Query: 473 HNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQG 532
           H+ ++++RD+KPENIL+     I L DFG    N  GQ K  T CGT +YL+PEL+  + 
Sbjct: 215 HSKNILHRDIKPENILIGFNNTIKLTDFGWSVYNEDGQ-KRKTLCGTIDYLSPELIKSRE 273

Query: 533 YSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKM-YKKILQEPLRFPDGFDKDAKDLLIGLL 591
           Y+  VD W LGVL YE++ G PP ++ED  +M Y++IL+  L+FP      A+DL++ LL
Sbjct: 274 YNNKVDVWALGVLTYELLVGSPP-FEEDTKEMTYRRILRCDLKFPLNVSPQARDLIVRLL 332

Query: 592 SRDPKRRLGFNGADEIKSHPFFS 614
             +P +R+  +   E+KSH + +
Sbjct: 333 QFEPSKRIPLS---EVKSHAWIA 352

>Kwal_23.3992
          Length = 571

 Score =  169 bits (428), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 106/343 (30%), Positives = 170/343 (49%), Gaps = 56/343 (16%)

Query: 357 DFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENP 416
           DFE++  +G+G +G+V   RK+DT ++ ALK + K  ++  +E  H L ER +L    + 
Sbjct: 175 DFEMITQVGQGGYGQVYLARKRDTREICALKILNKKLLIKLNETNHVLTERDILTTTRSE 234

Query: 417 FIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLD 476
           ++V L + FQ P  LY+ + F+ GG+    L          AR Y +E+ CA++ LH L 
Sbjct: 235 WLVKLLYAFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLG 294

Query: 477 VIYRDLKPENILLDHQGHIALCDFGLC------------------------------KLN 506
             +RDLKPEN L+D +GHI L DFGL                                +N
Sbjct: 295 YTHRDLKPENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMN 354

Query: 507 MKGQDKTN----------TFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPY 556
            + +  TN          +  G+P+Y+A E+L  + Y   VD+W+LG +L+E + G  P+
Sbjct: 355 DRREMYTNLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 414

Query: 557 YDEDVPKMY------KKILQEPLRFPDG---FDKDAKDLLIGLLSRDPKRRLGFNGADEI 607
                 + Y      K++L+ P R  +G   F     DL+I L++ DP  RL     + +
Sbjct: 415 SGSSTNETYENLRCWKQVLRRP-RCDNGRYAFSDRTWDLIIRLIA-DPISRL--RSFEHV 470

Query: 608 KSHPFFSQLSWKRLWMKGYIPPYKPPVMNSLDTSNFDQEFTKE 650
           K   +F+++S++ L  +   PP+ P + N  D   FD +FT E
Sbjct: 471 KKMKYFAEISFENL--RNVSPPFIPQLDNETDAGYFD-DFTSE 510

>CAGL0B04147g 402798..404498 highly similar to sp|P22204
           Saccharomyces cerevisiae YGR092w DBF2 ser/thrprotein
           kinase related to DBF20P or sp|P32328 Saccharomyces
           cerevisiae YPR111w DBF20 cell cycle protein kinase
           related to DBF2P, hypothetical start
          Length = 566

 Score =  167 bits (424), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 112/373 (30%), Positives = 170/373 (45%), Gaps = 60/373 (16%)

Query: 326 NHQWIGLAQGNGKLNLSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYA 385
           N +W    Q   ++      KP         DFE++  +G+G +G+V   RK+DT +V A
Sbjct: 145 NEEWNNYLQKEHEVLRKRRLKPKNK------DFEMITQVGQGGYGQVYLARKRDTKEVCA 198

Query: 386 LKAIRKSYIVSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFY 445
           LK + K  +V  +E  H L ER +L    + ++V L + FQ P+ LY+ + F+ GG+   
Sbjct: 199 LKILNKKLLVKLNETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRT 258

Query: 446 HLQREGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCK- 504
            L          AR Y +E+ CA+  LH L   +RDLKPEN L+D +GHI L DFGL   
Sbjct: 259 LLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAG 318

Query: 505 -------------------------------------LNMKGQD--KTNTFCGTPEYLAP 525
                                                 N++  D    N+  G+P+Y+A 
Sbjct: 319 TVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMAL 378

Query: 526 ELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMY------KKILQEPLRFPDGF 579
           E+L G+ Y   VD+W+LG +L+E + G  P+      + Y      K+ L+ P    DG 
Sbjct: 379 EVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPF-LNDGR 437

Query: 580 D--KDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNS 637
               D    LI  L  DP  RL     + +K   +F ++++  L  +   PP+ P + N 
Sbjct: 438 SAISDRAWELITRLIADPINRL--RSFEHVKRMNYFHEINFDTL--RQLSPPFTPQLDNE 493

Query: 638 LDTSNFDQEFTKE 650
            D   FD +FT E
Sbjct: 494 TDAGYFD-DFTNE 505

>Scas_705.23
          Length = 553

 Score =  167 bits (422), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 112/375 (29%), Positives = 176/375 (46%), Gaps = 64/375 (17%)

Query: 326 NHQWIGLAQGNGKLNLSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYA 385
           N++W    Q    +      KP         DFE++  +G+G +G+V   RK+DT +V A
Sbjct: 132 NNEWTAYLQQEHDVLRKRRLKPKNK------DFEMITQVGQGGYGQVYLARKRDTKEVCA 185

Query: 386 LKAIRKSYIVSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFY 445
           LK + K  +   +E  H L ER +L    + ++V L + FQ  + LY+ + F+ GG+ F 
Sbjct: 186 LKILNKKLLFKLNETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGD-FR 244

Query: 446 HLQREGRF-SLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLC- 503
            L    RF   + AR Y +E+ CA+  LH L   +RDLKPEN L+D +GHI L DFGL  
Sbjct: 245 TLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAA 304

Query: 504 ---------------------------------------KLNMKGQDKTNTFCGTPEYLA 524
                                                   L     +  N+  G+P+Y+A
Sbjct: 305 GTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMA 364

Query: 525 PELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMY------KKILQEPLRFPDG 578
            E+L G+ Y   VD+W+LG +L+E + G  P+      + Y      KK L+ P+   +G
Sbjct: 365 LEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPV-LDNG 423

Query: 579 ---FDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVM 635
              F     D++  L++ DP  RL     + IK  P+F+++++  L  +   PP+ P + 
Sbjct: 424 RPAFSDRTWDIITRLIA-DPINRL--RSFEHIKRMPYFAEVNFNTL--RQSAPPFTPQLD 478

Query: 636 NSLDTSNFDQEFTKE 650
           +  D   FD +FT E
Sbjct: 479 SETDAGYFD-DFTNE 492

>CAGL0G03047g 282299..283918 highly similar to sp|P22204
           Saccharomyces cerevisiae YGR092w DBF2 ser/thrprotein
           kinase or sp|P32328 Saccharomyces cerevisiae YPR111w
           DBF20, hypothetical start
          Length = 539

 Score =  163 bits (413), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 108/371 (29%), Positives = 168/371 (45%), Gaps = 60/371 (16%)

Query: 328 QWIGLAQGNGKLNLSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALK 387
           +W G       +      KP  N      DFE+L  +G+G +G+V   RK+DT +V ALK
Sbjct: 120 EWRGYLAKENNILRKRRLKPKNN------DFEMLTQVGQGGYGQVYLARKRDTKEVCALK 173

Query: 388 AIRKSYIVSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHL 447
            + K  +   +E  H L ER +L    + ++V L + FQ    LY+ + F+ GG+    L
Sbjct: 174 ILNKKLLHRLNETNHVLTERDILTTTRSEWLVKLLYAFQDSSSLYLAMEFVPGGDFRTLL 233

Query: 448 QREGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNM 507
                   + AR Y +E+ CA+  LH L   +RDLKPEN L+D +GHI L DFGL    +
Sbjct: 234 INTKYLKSTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAKGHIKLTDFGLAAGTV 293

Query: 508 KGQ----------------------------------------DKTNTFCGTPEYLAPEL 527
             +                                        +  N+  G+P+Y+A E+
Sbjct: 294 SNERIESMKIRLEEVKNLEFPAFTERPIEDRRKMYHDLRDTDINYANSMVGSPDYMALEV 353

Query: 528 LLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMY------KKILQEPLRFPDG--F 579
           L G+ Y   VD+W+LG +L+E +    P+      + Y      +K L+ P R  +G   
Sbjct: 354 LEGKKYDFTVDYWSLGCMLFESLVSFTPFSGATTNETYENLRHWRKTLRRP-RLGNGRYA 412

Query: 580 DKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSLD 639
             D     I  L  DP  RL     + +K  P+FS++ + +L  +   PP+ P + + +D
Sbjct: 413 VSDRTWAFITSLIADPINRL--KSFEHVKRMPYFSEIDFSKL--REMSPPFIPQLDSEVD 468

Query: 640 TSNFDQEFTKE 650
              FD +FT E
Sbjct: 469 AGYFD-DFTNE 478

>KLLA0E03487g complement(323764..325707) similar to sgd|S0002874
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 647

 Score =  164 bits (415), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 94/284 (33%), Positives = 154/284 (54%), Gaps = 12/284 (4%)

Query: 350 NRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERT- 408
           +R  +  DF   + +G GS+  V +   + T +++A+K   K +I+S+++V +   E+  
Sbjct: 2   SRKRTPQDFSFKERLGHGSYSTVYKAVDRSTGQLFAIKVCSKKHIISENKVKYVTIEKNT 61

Query: 409 --VLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELL 466
             +LA   +P I+ L +TF   + LY VL F  GGEL   LQ +GRF+ +  + +  +L+
Sbjct: 62  LNLLAHGNHPGIIKLYYTFHDSENLYFVLDFAPGGELLQLLQTQGRFNEAWTKHFMCQLI 121

Query: 467 CALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDK---TNTFCGTPEYL 523
            ALE +H   V++RDLKPEN+LL  +G + + DFG+   N+   D    T++F GT EY+
Sbjct: 122 DALEYIHGCKVVHRDLKPENLLLSSEGKLMITDFGVAS-NLAATDNLSSTSSFVGTAEYV 180

Query: 524 APELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDA 583
           +PELLL    +   D W +G +LY+   G PP+  E+    ++KI+     +     +  
Sbjct: 181 SPELLLQNKSNFCSDIWAVGCMLYQFTQGTPPFRGENELAAFEKIVNLDYHWIYMVSQHI 240

Query: 584 KDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSW--KRLWMKG 625
            DL+  +L  DP  R       +IK+H +F  + W  K L  KG
Sbjct: 241 TDLVSKILVLDPDSRYTL---PQIKNHAWFQGIDWTNKELIWKG 281

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score =  165 bits (417), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 94/291 (32%), Positives = 162/291 (55%), Gaps = 17/291 (5%)

Query: 355 VDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVE 414
           ++DF+  + +G GS+  V+     ++NK YA+K + K Y++ + +V +   E+  L R++
Sbjct: 152 INDFKFGETLGDGSYSTVLLATSIESNKKYAVKILNKEYLIKQKKVKYVNIEKNTLQRLK 211

Query: 415 N-PFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLH 473
           N   I+ L FTFQ    LY +L +   G+L   +++ G  +    + Y A+++ AL  +H
Sbjct: 212 NTKGIISLYFTFQDESSLYFLLEYAPNGDLLSLMRKHGSVNEKCTQYYAAQIIDALGFMH 271

Query: 474 NLDVIYRDLKPENILLDHQGHIALCDFGLCK-LNMKGQD--------KTNTFCGTPEYLA 524
           +  VI+RDLKPENILLD    + L DFG  + L+   +D        ++N+F GT EY++
Sbjct: 272 DKGVIHRDLKPENILLDVDMKVKLTDFGTARLLDSTSEDDLKYDLLTRSNSFVGTAEYVS 331

Query: 525 PELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAK 584
           PELL         D W  G +L++M+ G PP+   +    ++K+++    F  GF    +
Sbjct: 332 PELLNDNYVDFRCDIWAFGCILFQMIAGKPPFKANNEYLTFQKVMKVQFAFTAGFPMTVR 391

Query: 585 DLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKR--LWMKG--YIPPYK 631
           DL+  +L ++P+RRL  N   +IK+H FF+ +++    +W K    + PYK
Sbjct: 392 DLVKNILIKNPERRLLIN---QIKAHQFFADVNFGNGSVWDKDPPELGPYK 439

>Scas_660.20
          Length = 957

 Score =  164 bits (416), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 97/290 (33%), Positives = 162/290 (55%), Gaps = 25/290 (8%)

Query: 349 TNRALSVDDFELLKVIGKGSFGKVMQ-VRKKDTNKVYALKAIRKSYIVSKSEVIHTLAER 407
           ++R  S  DF   + +G GS+  V + + K++T +++A+K   K++I+ +S+V +   E+
Sbjct: 2   SSRKRSPHDFIFKEELGHGSYSTVYKAIDKRNTKRIFAIKVCSKAHIIKESKVKYVTIEK 61

Query: 408 T---VLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAE 464
               +LA+  +P IV L +TF   + LY VL ++ GGEL   L +   FS   ++ +T +
Sbjct: 62  NTLNLLAKAHHPGIVKLYYTFHDEENLYYVLDYLPGGELLSLLHKMKTFSEVWSKHFTVQ 121

Query: 465 LLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTN----TFCGTP 520
           L+  LE +H+  VI+RDLKPEN+LLD  G + + DFG       G +  N    +F GT 
Sbjct: 122 LVDTLEFIHSQGVIHRDLKPENVLLDRDGKLMITDFGAAYTTTAGNNDANKSSSSFVGTA 181

Query: 521 EYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFP---- 576
           EY++PELLL    S   D W LG ++++ +TG PP+  E+  K ++KI+   L +P    
Sbjct: 182 EYVSPELLLHNQCSFSSDVWALGCMIFQFVTGSPPFRGENELKTFEKIVA--LDYPWSST 239

Query: 577 ----DGFDKDAKDLLIGLLSR----DPKRRLGFNGADEIKSHPFFSQLSW 618
               + F  +   L+I L+ +    +PK RL      +IK  P+F+ ++W
Sbjct: 240 NIHNNKFLNNINPLIINLVRKILVLEPKDRLSL---KKIKQDPWFATVNW 286

>Scas_716.33
          Length = 573

 Score =  160 bits (405), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 114/375 (30%), Positives = 174/375 (46%), Gaps = 64/375 (17%)

Query: 326 NHQWIGLAQGNGKLNLSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYA 385
           N++W G  Q   ++      KP         DFE++  +G+G +G+V   RKKDTN+V A
Sbjct: 152 NNEWNGYIQREHQVLRKRRLKPKHK------DFEMITQVGQGGYGQVYLARKKDTNEVCA 205

Query: 386 LKAIRKSYIVSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFY 445
           LK + K  +   +E  H L ER +L    + ++V L + FQ    LY+ + F+ GG+ F 
Sbjct: 206 LKILNKKLLFKLNETNHVLTERDILTTTRSQWLVKLLYAFQDTQNLYLAMEFVPGGD-FR 264

Query: 446 HLQREGRFSLS-RARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCK 504
            L    RF  S  AR Y +E+  A+  LH+L   +RDLKPEN L+D +GHI L DFGL  
Sbjct: 265 TLLINTRFLKSTHARFYISEMFLAVNALHDLGYTHRDLKPENFLIDAKGHIKLTDFGLAA 324

Query: 505 LNMKG---------------------QDKT-------------------NTFCGTPEYLA 524
             +                        DK+                   N+  G+P+Y+A
Sbjct: 325 GTISNDRIQSMKVRLEEVKNLEFPEFSDKSIEDRRQMYQKYRETEVNYANSMVGSPDYMA 384

Query: 525 PELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMY------KKILQEPLRFPDG 578
            E+L G+ Y   VD+W+L  +L+E + G  P+      + Y      KK L+ P+   +G
Sbjct: 385 LEVLEGKKYDFTVDYWSLSCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPM-LDNG 443

Query: 579 ---FDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVM 635
              F     D +  L++ DP  RL     + +K   +F  + +  L  +   PP+ P + 
Sbjct: 444 RPAFSDRTWDFITRLIA-DPINRL--RSFEHVKRMTYFESVDFNTL--RDLSPPFIPQLD 498

Query: 636 NSLDTSNFDQEFTKE 650
           N  D   FD +FT E
Sbjct: 499 NETDAGYFD-DFTNE 512

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score =  162 bits (410), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 94/297 (31%), Positives = 159/297 (53%), Gaps = 21/297 (7%)

Query: 353 LSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLAR 412
           + + DF+  + +G GS+  V+    +D+ K YA+K + K Y++ + +V +   E+  L +
Sbjct: 120 MGIKDFKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEYLIRQKKVKYVTVEKLALQK 179

Query: 413 VE-NPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALET 471
           +     I  L FTFQ    LY +L +   G+    +++ G  + + AR Y ++++ A+++
Sbjct: 180 LNGTKGIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKYGSLNETCARYYASQIIDAVDS 239

Query: 472 LHNLDVIYRDLKPENILLDHQGHIALCDFGLCKL-------NMKGQ------DKTNTFCG 518
           LHN+ +I+RD+KPENILLD    + L DFG  K+          G+       K+ +F G
Sbjct: 240 LHNIGIIHRDIKPENILLDKNMKVKLTDFGTAKILPEEPSNTADGKPYFDLYAKSKSFVG 299

Query: 519 TPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDG 578
           T EY++PELL         D W  G +LY+M+ G PP+   +    ++K+++    F  G
Sbjct: 300 TAEYVSPELLNDNYTDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAG 359

Query: 579 FDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWK--RLWMKG--YIPPYK 631
           F +  KDL+  LL RDP  RL      +IK+H FF +++++   +W      I PYK
Sbjct: 360 FPQIVKDLVKKLLVRDPNDRLTIK---QIKAHLFFHEVNFEDGSVWDDNPPEIQPYK 413

>KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1
           Kluyveromyces lactis DBF2, start by similarity
          Length = 567

 Score =  159 bits (401), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 105/353 (29%), Positives = 165/353 (46%), Gaps = 56/353 (15%)

Query: 357 DFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENP 416
           DFE++  +G+G +G+V   RKKDT ++ ALK + K  ++      H L ER +L    + 
Sbjct: 171 DFEMITQVGQGGYGQVYLARKKDTKEICALKILNKKLLMKLEGTDHVLTERDILTTTRSE 230

Query: 417 FIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLD 476
           ++V L + FQ P  LY+ + F+ GG+    L          AR Y +E+ CA+  LH L 
Sbjct: 231 WLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFCAVNALHQLG 290

Query: 477 VIYRDLKPENILLDHQGHIALCDFGLC--------------------------------- 503
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 291 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEFPEFRERSMD 350

Query: 504 -------KLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPY 556
                  KL  +     ++  G+P+Y+A E+L  + Y   VD+W+LG +L+E + G  P+
Sbjct: 351 DRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 410

Query: 557 YDEDVPKMY------KKILQEPLRFPDG---FDKDAKDLLIGLLSRDPKRRLGFNGADEI 607
                 + Y      K +LQ P +  +G   F     +L+  L++ DP  RL     + +
Sbjct: 411 SGNSTNETYENLRNWKHVLQRP-KCDNGRYAFSDRTWELITRLIA-DPINRL--KSFEHV 466

Query: 608 KSHPFFSQLSWKRLWMKGYIPPYKPPVMNSLDTSNFDQEFTKELPVDSVVNDF 660
           K   +FS++ +  L  +   PP+ P + N  D   FD +FT E  +   V+ F
Sbjct: 467 KRMRYFSEIDFNTL--RTIHPPFIPQLDNEEDVGYFD-DFTNEEHMARYVDVF 516

>ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W
           (DBF20) - SH] complement(764718..766451) [1734 bp, 577
           aa]
          Length = 577

 Score =  157 bits (397), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 100/343 (29%), Positives = 165/343 (48%), Gaps = 56/343 (16%)

Query: 357 DFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENP 416
           DFE++  +G+G +G+V   RKKDT ++ ALK + K+ +   +   H L ER +L    + 
Sbjct: 181 DFEIITQVGQGGYGQVYLARKKDTKEICALKILNKNLLAKLNGTDHVLTERDILTTTRSE 240

Query: 417 FIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLD 476
           ++V L + FQ P  LY+ + F+ GG+    L          AR Y +E+ CA++ LH L 
Sbjct: 241 WLVKLLYAFQDPHSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHKLG 300

Query: 477 VIYRDLKPENILLDHQGHIALCDFGLC--------------------------------- 503
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 301 YTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMRIRLEEVKNLEFPEFKETSMD 360

Query: 504 -------KLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPY 556
                  ++  K  +  ++  G+P+Y+A E+L  + Y   VD+W+LG +L+E + G  P+
Sbjct: 361 YRRKMYHRVREKELNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPF 420

Query: 557 YDEDVPKMY------KKILQEPLRFPDG---FDKDAKDLLIGLLSRDPKRRLGFNGADEI 607
                 + Y      K++L+ P R  +G   F     +L+  L++ DP  RL     + +
Sbjct: 421 SGSSSNETYENLRRWKQVLRRP-RCENGRPAFSDRTWELITRLIA-DPINRL--RSFEHV 476

Query: 608 KSHPFFSQLSWKRLWMKGYIPPYKPPVMNSLDTSNFDQEFTKE 650
           K   +F+++ +  L  +   PP+ P + +  D   FD +FT E
Sbjct: 477 KKMKYFAEIDFANL--RSMSPPFIPQLDSETDAGYFD-DFTNE 516

>Scas_627.7
          Length = 349

 Score =  152 bits (383), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 95/263 (36%), Positives = 148/263 (56%), Gaps = 4/263 (1%)

Query: 351 RALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVL 410
           + LS+DDFE+ K +GKG FGKV  VR K+T  + ALK + K+ IV  +       E  + 
Sbjct: 84  KPLSLDDFEIGKKLGKGKFGKVYCVRHKETGFICALKVMDKAEIVQYNLQKQFRREVEIQ 143

Query: 411 ARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALE 470
             + +P +  L   F    ++Y+++ ++  GEL+  L+  G F+   A  +  ++  AL 
Sbjct: 144 TSLNHPNLTKLYGHFHDEKRVYLLMEYLVYGELYKLLRSHGPFNDVIASRFVFQIADALN 203

Query: 471 TLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLG 530
            LH+  +I+RDLKPENIL+     I L DFG   +N +G  K  T CGT +YL+PE++  
Sbjct: 204 YLHDKQIIHRDLKPENILIGFNNVIKLTDFGWSIINPRGV-KRKTLCGTIDYLSPEMIRS 262

Query: 531 QGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGL 590
           + Y   VD W LGVL YE++ G PP+ ++     YK+IL+  ++FP+    D KDL+  L
Sbjct: 263 REYDDKVDVWALGVLTYELIVGSPPFEEDTKELTYKRILKNDIKFPETVSHDVKDLISKL 322

Query: 591 LSRDPKRRLGFNGADEIKSHPFF 613
           L  +P  R+      ++  HP+ 
Sbjct: 323 LKYNPSERISMR---DVMKHPWI 342

>Kwal_56.22693
          Length = 984

 Score =  159 bits (402), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 86/273 (31%), Positives = 150/273 (54%), Gaps = 12/273 (4%)

Query: 355 VDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVE 414
           + DF   +V+G GS+  VM  R  D+ K YA+K + K Y++ + +V +   E+  L R+ 
Sbjct: 155 IKDFRFGEVLGDGSYSTVMLARSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKNTLQRLN 214

Query: 415 NPF-IVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLH 473
           +   ++ L FTFQ    LY +L +   G+    +++ G  S   A  Y+A++L A++ LH
Sbjct: 215 DGRGVIKLYFTFQDEASLYFLLEYAPNGDFLSVIKKFGSLSQECAVYYSAQILDAIDYLH 274

Query: 474 NLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQ--------DKTNTFCGTPEYLAP 525
           +  +++RD+KPENILLD    + L DFG  ++  K +        +++ +F GT EY++P
Sbjct: 275 HKGIVHRDIKPENILLDKDMKVKLTDFGTARILEKDETTQTFNLLERSKSFVGTAEYVSP 334

Query: 526 ELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKD 585
           ELL         D W  G +L++M+ G PP+   +    ++K+++    F  GF    +D
Sbjct: 335 ELLNDNYVDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLVIRD 394

Query: 586 LLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSW 618
           L+  +L + P++RL    A +IK H FF  +++
Sbjct: 395 LIKKILVKSPEQRL---DASQIKKHHFFKDVNF 424

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score =  158 bits (400), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 91/293 (31%), Positives = 156/293 (53%), Gaps = 19/293 (6%)

Query: 355 VDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVE 414
           + DF+  +++G G++  VM    KD+ K YA+K + K Y++ + +V +   E+  L R+ 
Sbjct: 179 IKDFKFGEMVGDGAYSTVMLATAKDSGKKYAVKVLNKEYLIKQKKVKYVNIEKNALQRLN 238

Query: 415 NPF-IVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLH 473
           N   IV L FTFQ    LY +L +   G+    +++ G  S    R Y+A+++  ++ LH
Sbjct: 239 NSRGIVKLFFTFQDESSLYFLLEYAPNGDFLSVMKKYGSLSEDCTRYYSAQIIDGIKYLH 298

Query: 474 NLDVIYRDLKPENILLDHQGHIALCDFGLCK-LNMKGQDKTN----------TFCGTPEY 522
           +  +I+RD+KPENILLD    + + DFG  K L  K +D+ N          +F GT EY
Sbjct: 299 SKGIIHRDIKPENILLDKDMKVKITDFGTAKILEPKNEDEDNPEFNLLTRSKSFVGTAEY 358

Query: 523 LAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKD 582
           ++PELL         D W  G ++++M+ G PP+   +    ++K+++    F  GF   
Sbjct: 359 VSPELLNDSYVDARCDIWAFGCMVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPVV 418

Query: 583 AKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWK--RLWMKGY--IPPYK 631
            +DL+  +L + P++RL      +I+ H F+  +S++   +W      I PYK
Sbjct: 419 VRDLVKRILLKVPEQRLTI---PQIEKHHFYKDISFEDGSVWTAPAPEIQPYK 468

>YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine
           protein kinase of unknown function [2697 bp, 898 aa]
          Length = 898

 Score =  157 bits (398), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 101/309 (32%), Positives = 161/309 (52%), Gaps = 40/309 (12%)

Query: 349 TNRALSVDDFELLKVIGKGSFGKVMQ-VRKKDTNKVYALKAIRKSYIVSKSEVIHTLAER 407
           T+R  S  DF   + +G GS+  V + + KK  NK+YA+K   K +I+ +++V +   E+
Sbjct: 2   TSRKRSPHDFIFKEELGHGSYSTVFKALDKKSPNKIYAIKVCSKKHIIKEAKVKYVTIEK 61

Query: 408 T---VLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAE 464
               +LA+  +  I+ L +TF   + LY VL F  GGEL   L + G F+    R +TA+
Sbjct: 62  NTMNLLAQKHHAGIIKLYYTFHDEENLYFVLDFAPGGELLSLLHKMGTFNDIWTRHFTAQ 121

Query: 465 LLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGL------------CKLN-----M 507
           L+ ALE +H+  +I+RDLKPEN+LLD  G + + DFG              K N      
Sbjct: 122 LIDALEFIHSHGIIHRDLKPENVLLDRDGRLMITDFGAAATIDPSLSGDSAKFNSDSNGS 181

Query: 508 KGQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKK 567
           K      +F GT EY++PELLL        D W LG ++Y+ + G PP+  E+  K ++K
Sbjct: 182 KDNQNCASFVGTAEYVSPELLLYNQCGYGSDIWALGCMIYQFVQGQPPFRGENELKTFEK 241

Query: 568 ILQEPLRFPDGFDKDAKD-------LLIGLLSR----DPKRRLGFNGADEIKSHPFFSQL 616
           I+   L +P G +    +       L+I L+ +    +   R+     ++IK HP+FS++
Sbjct: 242 IVA--LDYPWGPNNRINNSTSPINPLVINLVQKILVIEVNERISL---EQIKRHPYFSKV 296

Query: 617 SWK---RLW 622
            W    ++W
Sbjct: 297 DWNDKIKIW 305

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score =  156 bits (394), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 93/287 (32%), Positives = 152/287 (52%), Gaps = 27/287 (9%)

Query: 354 SVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERT---VL 410
           S  DF   + +G GS+  V +V ++ +   YA+K   K +I+ +++V +   E+    +L
Sbjct: 6   SPHDFLFREELGHGSYSTVYRVVERSSQHQYAIKICSKRHIIGENKVKYVTIEKNTLNLL 65

Query: 411 ARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALE 470
            +  +P I+ L +TF   + LY V+    GGEL   L+R+  FS + AR Y  +L+  +E
Sbjct: 66  GQANHPGIIKLYYTFHDQENLYFVMDLAPGGELLQLLRRQRVFSEAWARHYMCQLVDTVE 125

Query: 471 TLHNLDVIYRDLKPENILLDHQGHIALCDFGLC------KLNMKGQDKTNTFCGTPEYLA 524
            +H++ VI+RDLKPEN+LLD +G + + DFG             G     +F GT EY++
Sbjct: 126 YIHSMGVIHRDLKPENVLLDKEGRLMIADFGAAYTVGQSDAGSDGDKPATSFVGTAEYVS 185

Query: 525 PELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKI--LQEPLRFPDGFDKD 582
           PELLL        D W LG +LY+ + G PP+  ++  + +++I  L    R P      
Sbjct: 186 PELLLENKSYYSSDVWALGCMLYQFLQGTPPFRGQNEMETFEQIVNLDYTWRIP------ 239

Query: 583 AKDLLIGLLSR----DPKRRLGFNGADEIKSHPFFSQLSW---KRLW 622
           A  L  GL+S+    DP +R      ++IK H +FS + W   +++W
Sbjct: 240 ANPLAAGLVSKILVLDPSQRYTL---EQIKKHKWFSGVDWNNKEKIW 283

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score =  154 bits (389), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 90/310 (29%), Positives = 160/310 (51%), Gaps = 30/310 (9%)

Query: 355 VDDFELLKVIGKGSFGKV-MQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARV 413
           + DF+   ++G GS+ +V +   K D++K YA+K + K Y++ + +V +   E+T L  +
Sbjct: 115 IKDFKFGDMLGDGSYSQVFLATSKTDSSKTYAVKVLNKEYLIKQKKVKYVNIEKTALQNL 174

Query: 414 EN-PFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETL 472
           ++   ++ L FTFQ    LY +L +   G+    +++ G  +      Y+A+++ A+ ++
Sbjct: 175 KSVTGVINLSFTFQDEANLYFLLEYAPNGDFLSLIKKFGTLNEECTIYYSAQIIDAIGSM 234

Query: 473 HNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDK-----------TNTFCGTPE 521
           H+  +I+RD+KPENILLD    I L DFG  KL  K  DK           +++F GT E
Sbjct: 235 HSHGIIHRDIKPENILLDGNMKIKLTDFGTAKLLQKKSDKNGKPHYNLLTRSSSFVGTAE 294

Query: 522 YLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDK 581
           Y++PELL         D W  G L+Y+M+ G PP+   +    ++K+++    F  GF  
Sbjct: 295 YVSPELLSDNYTDYKCDIWAFGCLVYQMIAGKPPFKATNEYLTFQKVMKVQFAFTAGFPT 354

Query: 582 DAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSW--KRLWMK------------GYI 627
             +DL+  +L + P++RL      +IK H  F  +++    +W +              +
Sbjct: 355 IIRDLVKNILVKQPEKRLTI---PQIKEHCLFENINFSDNSVWNRDPPKILPYRINAKSM 411

Query: 628 PPYKPPVMNS 637
            P+ PP+  S
Sbjct: 412 QPFSPPIPQS 421

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score =  152 bits (383), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 96/298 (32%), Positives = 162/298 (54%), Gaps = 17/298 (5%)

Query: 330 IGLAQGNGKLNLSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAI 389
           I  A  N  +N +   K   NR  +V  ++L K +GKGS G+V   +  +T K+ A+K +
Sbjct: 47  ISTASSNANVNNTKTSK-RRNRD-TVGPWKLGKTLGKGSSGRVRLAKNMETGKLSAIKIV 104

Query: 390 RKSYIVSKSEVIHTL-----AERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELF 444
            K ++  KS  I  L      E  ++  + +P ++ L   +++  +LY+VL ++ GGELF
Sbjct: 105 PKKFV--KSNQIKQLPYGIEREIIIMKLISHPNVMGLYEVWENKSELYLVLEYVEGGELF 162

Query: 445 YHLQREGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGH-IALCDFGLC 503
            +L  +G+   S A  Y  +++ A+   H  ++ +RDLKPEN+LLD +   I + DFG+ 
Sbjct: 163 DYLVSKGKLPESEAIHYFKQIVQAVAYCHGFNICHRDLKPENLLLDKKKRSIKIADFGMA 222

Query: 504 KLNMKGQDK-TNTFCGTPEYLAPELLLGQGY-SKVVDWWTLGVLLYEMMTGLPPYYDEDV 561
            L  +  DK   T CG+P Y +PE++LG+ Y     D W+ G++L+ ++TG  P+ D++V
Sbjct: 223 AL--ETSDKLLETSCGSPHYASPEIVLGRKYHGSPSDVWSCGIILFALLTGHLPFNDDNV 280

Query: 562 PKMYKKILQEPLRFPDGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWK 619
            K+  K+     + P     +AKDL+  +L  DP RR+     D+I  H   ++   K
Sbjct: 281 KKLLLKVQSGKYQMPQWLSVEAKDLISRILVVDPNRRITI---DQILQHELLTKYDQK 335

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score =  151 bits (382), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 100/345 (28%), Positives = 171/345 (49%), Gaps = 30/345 (8%)

Query: 311 PLTLDFDT---ASSFRLYNHQWIGLAQGNGKLNLSVDYKPATNRAL------SVDDFELL 361
           P+ + + +   A ++R    +W    +G  KL   V   P T +         + DF+  
Sbjct: 147 PMPMQYTSLSVAEAYRRRQEEWA--ERGAAKLMKDV-RDPQTGQITRQLIKKGIKDFKFG 203

Query: 362 KVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVEN---PFI 418
           + +G GS+  V+     ++ K YA K + K Y++ + +V +   E+  L R+ +   P +
Sbjct: 204 EALGDGSYSTVVLATCIESGKKYAAKILNKEYLIKQKKVKYVNIEKNTLQRLNSSRVPGV 263

Query: 419 VPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLDVI 478
           + L FTFQ    LY +L +   G+    ++R G  S    + Y A++L A+  LH   +I
Sbjct: 264 IKLYFTFQDEANLYFLLEYAPNGDFLSVMKRFGTLSEECTKYYGAQILDAIHHLHKQGII 323

Query: 479 YRDLKPENILLDHQGHIALCDFGLCKLNMKGQD--------KTNTFCGTPEYLAPELLLG 530
           +RD+KPENILLD    I L DFG  KL  +  +        ++ +F GT EY++PELL  
Sbjct: 324 HRDVKPENILLDKTMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFVGTAEYVSPELLND 383

Query: 531 QGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGL 590
                  D W  G +L++M+ G PP+   +    ++K+++    F  GF    +DL+  L
Sbjct: 384 NYVDSRCDIWAFGCILFQMVAGKPPFKATNEYLTFQKVMRVQYAFTAGFPMILRDLIKQL 443

Query: 591 LSRDPKRRLGFNGADEIKSHPFFSQLSWKR--LWMK--GYIPPYK 631
           L + P++RL      +I+ H FF+ ++++   +W      I PYK
Sbjct: 444 LVKKPEQRLTI---LQIEKHHFFNDINFRNGSVWSNPAPQIAPYK 485

>Kwal_33.14554
          Length = 714

 Score =  150 bits (378), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 112/370 (30%), Positives = 169/370 (45%), Gaps = 77/370 (20%)

Query: 356 DDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVEN 415
           +DF+ +KVIGKG+FG+V  V+KKDT K+YA+K + KS +  K ++ H  AER VLA  ++
Sbjct: 301 EDFQTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGSDS 360

Query: 416 PFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNL 475
           P++V L ++FQ    LY+++ F+ GG+L   L R   F+    R Y AE + A+E +H L
Sbjct: 361 PWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRWQIFTEDVTRFYMAECILAIEAIHKL 420

Query: 476 DVIYRDLKPENILLDHQGHIALCDFGLCKLNMK-----------GQDKTNTFCGTPEYLA 524
             I+RD+KP+NIL+D +GHI L DFGL     K            QD+ N   G+ +   
Sbjct: 421 GFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYYKKLLQQDEVNAAAGSLQ--K 478

Query: 525 PEL------------------------LLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDED 560
           P++                        L      ++  W     L+     G P Y   +
Sbjct: 479 PQMGIVAGNNGGGSGNNRNTMFVDAIHLTMTNRQQIQTWRKSRRLMAYSTVGTPDYIAPE 538

Query: 561 V--------------------------PKMYKKILQEPLRFPDGFDKDAK---DLLIGLL 591
           +                          P    +  QE  R    F++  +   D+ I   
Sbjct: 539 IFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQFPDDIHISYE 598

Query: 592 SRDPKRRL--------GFNG-ADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSLDTSN 642
           + D  RRL        G +G ADEIKSHPFF  + W  +  +    PY P + +  DT  
Sbjct: 599 AEDLIRRLLTHADQRLGRHGGADEIKSHPFFRGVDWNTI--RQVEAPYIPKLSSITDTRF 656

Query: 643 FDQEFTKELP 652
           F  +  + +P
Sbjct: 657 FPTDELENVP 666

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score =  150 bits (379), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 82/267 (30%), Positives = 146/267 (54%), Gaps = 11/267 (4%)

Query: 354 SVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLA-----ERT 408
           +V  ++L K +GKGS G+V   +   + K+ A+K + K  +    + +  L      E  
Sbjct: 57  TVGPWKLGKTLGKGSSGRVRLAKNMQSGKLAAIKIVPKRNVRHNQKQVTALPYGIEREII 116

Query: 409 VLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCA 468
           ++  + +P I+ L   +++  +LY+VL ++ GGELF +L   G+     A  Y  +++  
Sbjct: 117 IMKLITHPNIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEAIHYFKQIVQG 176

Query: 469 LETLHNLDVIYRDLKPENILLDHQGH-IALCDFGLCKLNMKGQDKTNTFCGTPEYLAPEL 527
           +   HN ++ +RDLKPEN+LLD +   + + DFG+  L    +    T CG+P Y +PE+
Sbjct: 177 VSYCHNFNICHRDLKPENLLLDKKNKTVKIADFGMAALETTNR-LLETSCGSPHYASPEI 235

Query: 528 LLGQGY-SKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDL 586
           ++GQ Y     D W+ G++L+ ++TG  P+ D++V K+  K+     + P    K+AKDL
Sbjct: 236 VMGQKYHGSPSDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMPSNVSKEAKDL 295

Query: 587 LIGLLSRDPKRRLGFNGADEIKSHPFF 613
           +  +L  DP++R+     D+I  HP  
Sbjct: 296 ISKILVVDPEKRITV---DKILEHPLL 319

>Kwal_47.18307
          Length = 621

 Score =  148 bits (373), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 149/271 (54%), Gaps = 11/271 (4%)

Query: 356 DDFELLKVIGKGSFGKVMQ-VRKKDTNKVYALKAIRKSYIVSKSEVIHTLAER---TVLA 411
           D +  L  +G+GS+  V + V + ++ + YA+K   K +I+ + +V +   E+    +LA
Sbjct: 8   DSYVFLDRLGQGSYSTVYRAVERSNSGRNYAIKVCSKKHIIREKKVKYVTIEKDLLNMLA 67

Query: 412 RVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALET 471
           +  +  IV L  TF   + LY VL +++GGEL   +QR GR +   +R  TA+L+  ++ 
Sbjct: 68  KGGHLGIVKLFCTFHDIENLYFVLEYVSGGELLALIQRLGRLTEDLSRHITAQLVDTVDY 127

Query: 472 LHNLDVIYRDLKPENILLDHQGHIALCDFG-LCKL---NMKGQDKTNTFCGTPEYLAPEL 527
           +H+  VI+RDLKPEN+LL  +G + + DFG  C       +   +T +F GT EY++PEL
Sbjct: 128 MHSKGVIHRDLKPENVLLSQEGRVVITDFGAACTAADRKFENTKRTASFVGTAEYVSPEL 187

Query: 528 LLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLL 587
           LL        D W LG ++Y++  G PP+  E+  + ++KI+    ++          ++
Sbjct: 188 LLHSQCGFSSDIWALGCIIYQLNQGKPPFRGENELQTFEKIVALDYKWLFSNSPQVVSIV 247

Query: 588 IGLLSRDPKRRLGFNGADEIKSHPFFSQLSW 618
             +L  DP +R     A ++K +P+F+ + W
Sbjct: 248 QSILVTDPLKR---PSAAQLKQNPWFASIDW 275

>CAGL0K06479g 636296..639271 some similarities with tr|Q03306
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 991

 Score =  147 bits (372), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 101/312 (32%), Positives = 156/312 (50%), Gaps = 41/312 (13%)

Query: 349 TNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKV-YALKAIRKSYIVSKSEVIHTLAER 407
           T+R  S  +F   + +G GS+  V +   K   K  YA+K   K +I+ +++V +   E+
Sbjct: 2   TSRKRSPHEFIFKEELGHGSYSTVYKALDKKDLKKPYAIKVCSKRHIIKEAKVKYVTIEK 61

Query: 408 T---VLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAE 464
               +LAR  +P IV L +TF   + LY VL + +GGEL   L + G F+ S A+ + A+
Sbjct: 62  NTLNLLARGNHPGIVKLYYTFHDEENLYFVLDYASGGELLSLLHKMGTFTDSWAKHFAAQ 121

Query: 465 LLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNT--------- 515
           L+  LE +H   VI+RDLKPEN+LL  +G + + DFG         DK NT         
Sbjct: 122 LVDTLEFMHARGVIHRDLKPENVLLSKEGILMITDFGAAATQNNFSDKDNTRSNANEGIP 181

Query: 516 ---------------FCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDED 560
                          F GT EY++PELLL    S   D W LG ++Y+ + G PP+  E+
Sbjct: 182 KDDVPSSGDKTECSSFVGTAEYVSPELLLYNKCSFGSDIWALGCMVYQFIQGFPPFRGEN 241

Query: 561 VPKMYKKILQ-----EPLRFPD--GFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFF 613
             K ++KI+       P R  +    +    +L+  +L+ D  +R      D+IK  P+F
Sbjct: 242 ELKTFEKIVSLDYSWNPERQTNFGTINIQVVNLVRRMLTIDTTQRATI---DQIKRDPWF 298

Query: 614 SQLSW---KRLW 622
           + + W   K+LW
Sbjct: 299 ANVDWGDKKKLW 310

>KLLA0D07810g complement(669095..671251)
           gi|401646|sp|P31034|YL44_KLULA Kluyveromyces lactis
           Hypothetical 31.8 kDa protein in L44/L41 3 region, start
           by similarity
          Length = 718

 Score =  146 bits (369), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 72/158 (45%), Positives = 104/158 (65%)

Query: 356 DDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVEN 415
           DDF  +KVIGKG+FG+V  V+KKDT K+YA+K + KS + +K ++ H  AER VLA  ++
Sbjct: 301 DDFNSVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYNKDQLAHVKAERDVLAGSDS 360

Query: 416 PFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNL 475
           P++V L ++FQ    LY+++ F+ GG+L   L R   F+    R Y AE + A+E +H L
Sbjct: 361 PWVVSLYYSFQDSQYLYLIMEFLPGGDLMTMLIRWQIFTEDVTRFYMAECILAIEVIHKL 420

Query: 476 DVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKT 513
             I+RD+KP+NIL+D +GHI L DFGL     K  D +
Sbjct: 421 GFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSS 458

 Score =  105 bits (263), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/140 (38%), Positives = 82/140 (58%), Gaps = 6/140 (4%)

Query: 517 CGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKIL--QEPLR 574
            GTP+Y+APE+ L QGY +  DWW+LG ++YE + G PP+  E   + Y+KI+  ++ L+
Sbjct: 531 VGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQ 590

Query: 575 FPDG--FDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKRLWMKGYIPPYKP 632
           FPD      +A+DL+  LL+    R     GADEIK+HPFFS + W  +  +    PY P
Sbjct: 591 FPDDIHISYEAEDLIRRLLTHSENRLGRHGGADEIKAHPFFSGVDWNTI--RQVEAPYIP 648

Query: 633 PVMNSLDTSNFDQEFTKELP 652
            + +  DT  F  +  + +P
Sbjct: 649 KLSSVTDTRFFPTDELENVP 668

>AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH]
           complement(498529..500688) [2160 bp, 719 aa]
          Length = 719

 Score =  145 bits (366), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 69/147 (46%), Positives = 100/147 (68%)

Query: 356 DDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVEN 415
           +DF  +KVIGKG+FG+V  V+KKDT K+YA+K + KS +  K ++ H  AER VLA  ++
Sbjct: 308 EDFHTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGSDS 367

Query: 416 PFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNL 475
           P++V L ++FQ    LY+++ F+ GG+L   L R   F+    R Y AE + A+E +H L
Sbjct: 368 PWVVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRWQIFTEDVTRFYMAECILAIEAIHKL 427

Query: 476 DVIYRDLKPENILLDHQGHIALCDFGL 502
             I+RD+KP+NIL+D +GHI L DFGL
Sbjct: 428 GFIHRDIKPDNILIDIRGHIKLSDFGL 454

 Score =  105 bits (263), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 84/140 (60%), Gaps = 7/140 (5%)

Query: 517 CGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKIL--QEPLR 574
            GTP+Y+APE+ L QGY +  DWW+LG ++YE + G PP+  E   + Y+KI+  ++ L 
Sbjct: 532 VGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLV 591

Query: 575 FPDG--FDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKRLWMKGYIPPYKP 632
           FPD      +A+DL+  LLS     RLG +GA+EIK+HPFF  + W+ +   G   PY P
Sbjct: 592 FPDDIHISYEAEDLIRRLLSH-ADERLGRHGANEIKNHPFFRGVDWETIRQVG--APYIP 648

Query: 633 PVMNSLDTSNFDQEFTKELP 652
            + +  DT  F  +  + +P
Sbjct: 649 KLSSVTDTRFFPTDELENVP 668

>Scas_618.8
          Length = 427

 Score =  141 bits (355), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 83/252 (32%), Positives = 134/252 (53%), Gaps = 10/252 (3%)

Query: 357 DFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTL-AERTVLARVEN 415
           D+E  K +G GSFG V +  KK  N+  A+K + K  +      +  L  E T+L ++ +
Sbjct: 26  DYEFGKTLGAGSFGVVREATKKSNNEEVAIKILLKKALEGNQVQLQMLYDELTILKKLHH 85

Query: 416 PFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNL 475
           P IV  K  F++ DK+YIV     GGELF  + ++GRFS   A     ++L A+E +H+ 
Sbjct: 86  PNIVEFKNWFETDDKIYIVTQLATGGELFDRIIKKGRFSEDDAVKILIQILSAVEYIHSR 145

Query: 476 DVIYRDLKPENILL---DHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQG 532
           D+++RDLKPEN+L         + + DFG+ K   KG+       G+  Y+APE+L   G
Sbjct: 146 DIVHRDLKPENLLYLTEKEDSELVIADFGIAKELKKGEQLIFKAAGSLGYVAPEVLTVDG 205

Query: 533 YSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQE--PLRFP----DGFDKDAKDL 586
           + K  D W++GV+ Y +++G   +  E V     +      P++F     D    DAK+ 
Sbjct: 206 HGKPCDIWSIGVITYTLLSGYAAFVAETVEGFLDECTSGDYPVKFHKPYWDNISDDAKNF 265

Query: 587 LIGLLSRDPKRR 598
           ++  L  +P++R
Sbjct: 266 ILKALDLNPQKR 277

>Scas_502.2
          Length = 1116

 Score =  145 bits (366), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 99/362 (27%), Positives = 179/362 (49%), Gaps = 26/362 (7%)

Query: 290 LKDILDRINDNQD-IHIDSYNLPLTLDFDTASSFRLYNHQWIGLAQGNGKLNLSVDYKPA 348
           L + +D  +DN D   + S +          +SF+    +W    +G  K+ +     P 
Sbjct: 102 LDETIDETDDNDDQASLGSQDNTTMNGLSMDASFKKRKDEWA--ERGAAKI-IQESINPE 158

Query: 349 TNRAL------SVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIH 402
           T + +       + DF+  +++G G++  VM     D+ K YA+K + K Y++ + +V +
Sbjct: 159 TGQKMRHVVKKGIKDFKFGEMLGDGAYSTVMLATSNDSGKKYAVKVLNKEYLIRQKKVKY 218

Query: 403 TLAERTVLARVENPF-IVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLY 461
              E+  L R+ N   I+ L FTFQ    LY +L +   G+L   +++ G  +      Y
Sbjct: 219 VNIEKLALQRLNNSRSIIRLFFTFQDEASLYFLLEYAPNGDLLSLMKKFGSLNEECCCYY 278

Query: 462 TAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCK-LNMKGQ-------DKT 513
            A+++ A++ +H+  +I+RD+KPENILLD    + + DFG  K L+ K          ++
Sbjct: 279 GAQIIDAIKFMHSKGIIHRDIKPENILLDKDMKVKITDFGTAKILDNKPPGTSYDLLTRS 338

Query: 514 NTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPL 573
            +F GT EY++PELL         D W  G ++++M+ G PP+   +    ++K+++   
Sbjct: 339 KSFVGTAEYVSPELLNDNYTDARSDIWAFGCIVFQMIAGKPPFKATNEYLTFQKVMKVQY 398

Query: 574 RFPDGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWK--RLWM--KGYIPP 629
            F  GF    +DL+  +L + P++RL     + I+ H FF   +++   +W      I P
Sbjct: 399 AFTAGFPTVVRDLVKRILIKAPEQRLTI---EAIEKHHFFRSKNFQDSSIWNDPAPEIQP 455

Query: 630 YK 631
           YK
Sbjct: 456 YK 457

>Scas_654.12
          Length = 737

 Score =  144 bits (363), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 69/148 (46%), Positives = 100/148 (67%)

Query: 356 DDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVEN 415
           +DF  +KVIGKG+FG+V  V+K DT K+YA+K + KS +  K ++ H  AER VLA  ++
Sbjct: 317 EDFHTVKVIGKGAFGEVRLVQKIDTGKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGSDS 376

Query: 416 PFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNL 475
           P++V L ++FQ    LY+++ F+ GG+L   L R   F+    R Y AE + A+ET+H L
Sbjct: 377 PWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRWQLFTEDVTRFYMAECILAIETIHKL 436

Query: 476 DVIYRDLKPENILLDHQGHIALCDFGLC 503
             I+RD+KP+NIL+D +GHI L DFGL 
Sbjct: 437 GFIHRDIKPDNILIDIRGHIKLSDFGLS 464

 Score =  104 bits (260), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 54/140 (38%), Positives = 82/140 (58%), Gaps = 6/140 (4%)

Query: 517 CGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKIL--QEPLR 574
            GTP+Y+APE+ L QGY +  DWW+LG ++YE + G PP+  E   + Y+KI+  ++ L+
Sbjct: 548 VGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQ 607

Query: 575 FPDG--FDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKRLWMKGYIPPYKP 632
           FPD      +A+DL+  LL+   +R     GADEIKSHPFF  + W  +  +    PY P
Sbjct: 608 FPDDIHISYEAEDLIRRLLTHADQRLGRHGGADEIKSHPFFRGVDWNTI--RQVEAPYIP 665

Query: 633 PVMNSLDTSNFDQEFTKELP 652
            + +  DT  F  +  + +P
Sbjct: 666 KLSSITDTRFFPTDELENVP 685

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score =  144 bits (363), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 90/287 (31%), Positives = 149/287 (51%), Gaps = 18/287 (6%)

Query: 334 QGNGKLNLSVDYKP-----ATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKA 388
           Q N K  ++  Y       +++    + ++++ K IG+GSFGKV     + T++   LK 
Sbjct: 8   QNNIKATIAASYDKLYSQFSSDELSEIGNYKISKFIGEGSFGKVYLATHRLTHQKVVLKT 67

Query: 389 IRKSYIVSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQ 448
             K       EV +         + + P+I  L     +  ++++VL + +G EL+ HL 
Sbjct: 68  GNKRDPNVVREVFYH-------RQFDFPYITKLYEVIVTESRVWMVLEYCSGHELYEHLL 120

Query: 449 REGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMK 508
           +E R SL  ++   +++  A+   H L  ++RDLK EN+LLD  GH  L DFG  +  M 
Sbjct: 121 KEQRLSLEESKKLFSQIASAVYYAHELKCVHRDLKLENVLLDGNGHAKLTDFGFTR-EMA 179

Query: 509 GQDKTNTFCGTPEYLAPELLLGQGYSKV-VDWWTLGVLLYEMMTGLPPYYDEDVPKMYKK 567
            + +  T CGT  Y+APEL+  + Y    VD W+LG++LY M+ G  P+ ++D  K   K
Sbjct: 180 TRSQLETICGTTVYMAPELIERKCYDGFKVDIWSLGIILYTMINGYMPFDEDDDIKTKLK 239

Query: 568 ILQEPLRF-PDGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFF 613
           I+ + L F  +    DA DL+ G+L ++P  R+      ++ SHPF 
Sbjct: 240 IVNDELDFNQEWISDDAIDLIQGMLRKNPNERISLA---QVLSHPFL 283

>Scas_616.10
          Length = 1461

 Score =  144 bits (364), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 90/322 (27%), Positives = 166/322 (51%), Gaps = 44/322 (13%)

Query: 332 LAQGNGKLNLSVDYKPATNRAL-SVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIR 390
           L+Q + + + S D K +  ++  +V  ++L K +GKGS G+V   +  +T ++ A+K + 
Sbjct: 74  LSQQDSQFSTSTDTKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVP 133

Query: 391 KSYIV----SKSEV------------IHTLA---------------------ERTVLARV 413
           K + +    S S V            I TLA                     E  ++  +
Sbjct: 134 KKHKLFMKSSHSNVSFFSAASNSNSNISTLATSPPMNNGSEKNQPNPYGIEREIVIMKLI 193

Query: 414 ENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLH 473
            +P ++ L   +++  +LY+VL +++GGELF +L  +G+ S   A  Y  +++  +   H
Sbjct: 194 SHPNVMALYEVWENKSELYLVLEYVDGGELFDYLVSKGKLSEKEAVHYFKQIIQGVSYCH 253

Query: 474 NLDVIYRDLKPENILLDHQGH-IALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQG 532
           + ++ +RDLKPEN+LLD +   I + DFG+  L +  +    T CG+P Y +PE+++G+ 
Sbjct: 254 SFNICHRDLKPENLLLDKKNKSIKIADFGMAALELPNK-LLQTSCGSPHYASPEIVMGKS 312

Query: 533 Y-SKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGLL 591
           Y     D W+ G++L+ ++TG  P+ D+++ K+  K+     R P     +A+DL+  +L
Sbjct: 313 YHGGPSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKFRMPSTLSPEAQDLISRIL 372

Query: 592 SRDPKRRLGFNGADEIKSHPFF 613
             DP +R+     D I +HP  
Sbjct: 373 VIDPSKRI---TTDRILNHPLI 391

>Kwal_26.7788
          Length = 1267

 Score =  144 bits (362), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 77/270 (28%), Positives = 149/270 (55%), Gaps = 7/270 (2%)

Query: 354 SVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLAR- 412
           ++  ++L K +GKGS G+V   +  +T K+ A+K + K+       + + +    ++ + 
Sbjct: 54  TIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKTKSSRTGSLPYGIEREIIIMKL 113

Query: 413 VENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETL 472
           + +P ++ L   +++  +L++VL +++GGELF +L   GR     A  Y  +++      
Sbjct: 114 ISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLPEKEAIHYFRQIIEGTAYC 173

Query: 473 HNLDVIYRDLKPENILLDHQG-HIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQ 531
           H  ++ +RDLKPEN+LLD +   I + DFG+  L    +    T CG+P Y +PE+++G+
Sbjct: 174 HGFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNK-LLETSCGSPHYASPEIVMGK 232

Query: 532 GYS-KVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGL 590
            Y+    D W+ G++L+ ++TG  P+ D+++ ++  K+     + P      A+DL+  +
Sbjct: 233 NYNGGPSDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQSVSSGAQDLISRI 292

Query: 591 LSRDPKRRLGFNGADEIKSHPFFSQLSWKR 620
           L  DP +R+  N   EI +HP  ++   KR
Sbjct: 293 LVVDPDKRISIN---EILAHPLLAKYGNKR 319

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score =  140 bits (354), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 92/305 (30%), Positives = 159/305 (52%), Gaps = 14/305 (4%)

Query: 355 VDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLA-ERTVLARV 413
           V +++++K +G+GSFGKV       T +  ALK I K  +++KS++   +  E + L  +
Sbjct: 36  VGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKK-VLAKSDMQGRIEREISYLRLL 94

Query: 414 ENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLH 473
            +P I+ L    +S D++ +V+ +  G ELF ++ +  + S   AR +  +++ A+E  H
Sbjct: 95  RHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRNKMSEQEARRFFQQIISAVEYCH 153

Query: 474 NLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGY 533
              +++RDLKPEN+LLD   ++ + DFGL  +   G +   T CG+P Y APE++ G+ Y
Sbjct: 154 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDG-NFLKTSCGSPNYAAPEVISGKLY 212

Query: 534 SK-VVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGLLS 592
           +   VD W+ GV+LY M+    P+ DE +P ++K I       P      A DL+     
Sbjct: 213 AGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGASDLI----- 267

Query: 593 RDPKRRLGFNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSLDTSNFDQEFTKELP 652
              KR L  N  + I  H    Q  W ++ +  Y+ P         +  + ++E  +E+ 
Sbjct: 268 ---KRMLIVNPLNRISIHEIM-QDEWFKVDLAEYLVPQDLKQQEQFNKKSGNEENVEEID 323

Query: 653 VDSVV 657
            + VV
Sbjct: 324 DEMVV 328

>Kwal_47.18233
          Length = 598

 Score =  139 bits (351), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 95/318 (29%), Positives = 164/318 (51%), Gaps = 16/318 (5%)

Query: 355 VDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLA-ERTVLARV 413
           +  ++++K +G+GSFGKV       T +  ALK I K  +++KS++   +  E + L  +
Sbjct: 28  IGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKK-VLAKSDMQGRIEREISYLRLL 86

Query: 414 ENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLH 473
            +P I+ L    +S D++ +V+ +  G ELF ++ +  + S + AR +  +++ A+E  H
Sbjct: 87  RHPHIIKLYDVVKSKDEIVMVIEYA-GNELFDYIVQRDKMSENEARRFFQQIISAVEYCH 145

Query: 474 NLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGY 533
              +++RDLKPEN+LLD   ++ + DFGL  +   G +   T CG+P Y APE++ G+ Y
Sbjct: 146 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDG-NFLRTSCGSPNYAAPEVISGKLY 204

Query: 534 S-KVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGLLS 592
           +   VD W+ GV+LY M+    P+ DE +P ++K I       P      A +L+     
Sbjct: 205 AGPEVDVWSSGVILYVMLCRRLPFDDESIPVLFKNISNGIYTLPKFLSPGAANLI----- 259

Query: 593 RDPKRRLGFNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSLDTSNFDQEFTKELP 652
              KR L  N  + I  H    Q  W ++ M+ Y+ P  P + N  +    D E   +  
Sbjct: 260 ---KRMLIVNPLNRITIHEIM-QDEWFKVDMQDYLIP--PDLKNEAENHGHDGEQQGQND 313

Query: 653 VDSVVNDFLSESVQQQFG 670
            +  V+D L   + +  G
Sbjct: 314 AEEEVDDSLVTMLSKTMG 331

>CAGL0J11638g complement(1128620..1130860) highly similar to
           sp|P32562 Saccharomyces cerevisiae YMR001c CDC5 involved
           in regulation of DNA replication, hypothetical start
          Length = 746

 Score =  140 bits (354), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 89/306 (29%), Positives = 156/306 (50%), Gaps = 23/306 (7%)

Query: 357 DFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENP 416
           D+   + +G+G F +  Q+ K D+ K++A K + K  I S+      L+E  +   + + 
Sbjct: 80  DYHRGQFLGEGGFARCFQI-KDDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMSHT 138

Query: 417 FIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLD 476
            IV     F+    +YI+L     G L   +++    +    R +  ++   ++ +H+  
Sbjct: 139 NIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTITEPEVRFFMTQICGGIQYMHSNR 198

Query: 477 VIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQ--GYS 534
           VI+RDLK  NI  D   ++ + DFGL  +    +++  T CGTP Y+APE+L+G+  G+S
Sbjct: 199 VIHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKFTICGTPNYIAPEVLMGKHSGHS 258

Query: 535 KVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFP--DGFDKDAKDLLIGLLS 592
             VD W++GV+LY ++ G PP+  +DV  +Y++I Q    +P      +DAK L+  +LS
Sbjct: 259 YEVDIWSIGVMLYALLIGKPPFQAKDVNTIYERIKQRNFAYPKDKKISQDAKYLIDDILS 318

Query: 593 RDPKRRLGFNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSLDTSNFDQEFTKELP 652
            +P  R       EI  +          +W +G  PPY    +NS+ T+  D  ++   P
Sbjct: 319 LNPMERPSIQ---EIMDY----------VWFRGTFPPY---TLNSVMTTVPD--YSHITP 360

Query: 653 VDSVVN 658
            +S +N
Sbjct: 361 QESFMN 366

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score =  138 bits (347), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 88/285 (30%), Positives = 147/285 (51%), Gaps = 26/285 (9%)

Query: 363 VIGKGSFGKVM----------QVRKKDTNKVYALKAIRKSYIVSKSEV-IHTLAERTVLA 411
            +G+G FGKV             ++   +K  A+K IR+  IV  SE  I    E   L 
Sbjct: 49  TLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRDTIVKNSEKEIKIYREINALK 108

Query: 412 RVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALET 471
            + +P +V L+   Q+   + IVL + +GGE + ++QR+ R   S A    A+L+  +  
Sbjct: 109 HLTHPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKESTACRLFAQLISGVTY 168

Query: 472 LHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQ 531
           +H+ ++++RDLK EN+LLD   ++ + DFG     +   +   T CG+P Y APEL++  
Sbjct: 169 MHSKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLPDNEYMKTSCGSPCYAAPELVIST 228

Query: 532 G--YSKVVDWWTLGVLLYEMMTGLPPYYD-------EDVPKMYKKILQEPLRFPDGFDKD 582
               ++  D W+ G++LY M+ G  P+ D       +D+ K+Y+ I + PL+FP+     
Sbjct: 229 RPYVARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDIGKLYQYITRTPLKFPEYITPI 288

Query: 583 AKDLLIGLLSRDPKRRLGF---NGADEIKSH-PFF--SQLSWKRL 621
            +DLL  +L  DP +R+     +  + +K H PF   S   W +L
Sbjct: 289 PRDLLRKILVPDPNKRVNMQYIHRHEWLKPHRPFLAVSTSQWDKL 333

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score =  135 bits (339), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 79/251 (31%), Positives = 135/251 (53%), Gaps = 10/251 (3%)

Query: 357 DFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENP 416
           D+   K +G G+FG V Q R    N+  A+K + K  +   +E+     E ++L ++++P
Sbjct: 55  DYIFGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRAL-KGNELQMLYDELSILQKLDHP 113

Query: 417 FIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLD 476
            IV  K  F+S +K YIV     GGELF  + ++G+F+ + A     ++L A+E +H+ +
Sbjct: 114 NIVKFKDWFESREKFYIVTQLATGGELFDRILKKGKFTETDAVKIVVQMLTAVEYMHSQN 173

Query: 477 VIYRDLKPENIL-LD--HQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGY 533
           V++RDLKPEN+L LD   +  + + DFG+ K         +   G+  Y+APE+L   G+
Sbjct: 174 VVHRDLKPENVLYLDPSDESQLVISDFGIAKQLSSESQLIHRAAGSMGYVAPEVLTTSGH 233

Query: 534 SKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKIL--QEPLRFP----DGFDKDAKDLL 587
            K  D W+LGV+ Y ++ G  P+  E      +++    +P+ F     +   K+AK  +
Sbjct: 234 GKPCDIWSLGVITYTLLCGYSPFIAESTEGFLEEVFSGSDPVTFHSPYWNNISKEAKQFI 293

Query: 588 IGLLSRDPKRR 598
           +  L+  P RR
Sbjct: 294 LRALTLTPARR 304

>Scas_660.28
          Length = 623

 Score =  137 bits (345), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 85/281 (30%), Positives = 147/281 (52%), Gaps = 18/281 (6%)

Query: 355 VDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLA-ERTVLARV 413
           + +++++K +G+GSFGKV       T +  ALK I K  +++KS++   +  E + L  +
Sbjct: 43  IGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKK-VLAKSDMQGRIEREISYLRLL 101

Query: 414 ENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLH 473
            +P I+ L    +S D++ +V+ +  G ELF ++ +  + S   AR +  +++ A+E  H
Sbjct: 102 RHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSEDEARRFFQQIISAVEYCH 160

Query: 474 NLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGY 533
              +++RDLKPEN+LLD   ++ + DFGL  +   G +   T CG+P Y APE++ G+ Y
Sbjct: 161 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDG-NFLKTSCGSPNYAAPEVISGKLY 219

Query: 534 S-KVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGLLS 592
           +   VD W+ GV+LY M+    P+ DE +P ++K I       P    + A  L+  +L 
Sbjct: 220 AGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNINNGVYTIPKFLSQGASTLIKKMLI 279

Query: 593 RDPKRRLGFNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPP 633
            +P  R+               Q   +  W K  +P Y  P
Sbjct: 280 VNPLNRISI-------------QEIMQDEWFKAGLPEYLIP 307

>KLLA0E01584g 149713..150960 highly similar to sp|P39009
           Saccharomyces cerevisiae YDL101c DUN1 protein kinase,
           start by similarity
          Length = 415

 Score =  134 bits (337), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 92/283 (32%), Positives = 133/283 (46%), Gaps = 35/283 (12%)

Query: 362 KVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPFIVPL 421
           K +G G +  V + R K+T +  A+K                  E  +L  +++P IV L
Sbjct: 105 KELGTGHYAIVKEARNKETGETVAVKIFHPQQNDDDKRTKKFTEETKILLSIQHPNIVKL 164

Query: 422 KFTFQSPD-----KLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLD 476
              F  P      + Y+VL  IN GELF  + R+        +    +LL  L+ LH+ +
Sbjct: 165 IDRFVEPVSKTQIQTYLVLEKINDGELFERIVRKNNLREDETKALFRQLLNGLKYLHSRN 224

Query: 477 VIYRDLKPENILLDHQG-------------------HIALCDFGLCKLNMKGQDK-TNTF 516
           +I+RD+KPENILL                        + + DFGL K    G+ K TNT 
Sbjct: 225 IIHRDIKPENILLSISKRRSPEEIALGPWDDDELDIQVKIADFGLAKFT--GEMKFTNTL 282

Query: 517 CGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDV-PKMYKKILQEPLRF 575
           CGTP Y+APE+L+  GY+  VD W+ GVLLY  + G PP+ ++   P M ++ILQ    F
Sbjct: 283 CGTPSYVAPEVLVKTGYTSRVDMWSAGVLLYVCLCGFPPFSEQLAPPSMKEQILQGKFAF 342

Query: 576 P----DGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFS 614
                D  D     L+  LL  +P  R   N A    +HP+F+
Sbjct: 343 YSPYWDNIDDSVLHLISNLLVVNPASRFSVNDA---LTHPWFT 382

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score =  137 bits (344), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 89/290 (30%), Positives = 151/290 (52%), Gaps = 18/290 (6%)

Query: 355 VDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLA-ERTVLARV 413
           +  ++++K +G+GSFGKV       T +  ALK I K  +++KS++   +  E + L  +
Sbjct: 36  IGKYQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKK-VLAKSDMQGRIEREISYLRLL 94

Query: 414 ENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLH 473
            +P I+ L    +S D++ +V+ +  G ELF ++ +  + S + AR +  +++ A+E  H
Sbjct: 95  RHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENEARRFFQQIISAVEYCH 153

Query: 474 NLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGY 533
              +++RDLKPEN+LLD   ++ + DFGL  +   G +   T CG+P Y APE++ G+ Y
Sbjct: 154 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDG-NFLKTSCGSPNYAAPEVISGKLY 212

Query: 534 S-KVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGLLS 592
           +   VD W+ GV+LY M+    P+ DE +P ++K I       P    + A +L+     
Sbjct: 213 AGPEVDVWSSGVILYVMLCRRLPFDDESIPVLFKNISNGVYSIPKFLSQGAANLI----- 267

Query: 593 RDPKRRLGFNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSLDTSN 642
              KR L  N  + I  H           W K  +P Y  PV    D ++
Sbjct: 268 ---KRMLIVNPLNRITIHEIMED-----EWFKVDLPDYLVPVDMKADATS 309

>Kwal_26.8709
          Length = 829

 Score =  138 bits (347), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 92/307 (29%), Positives = 153/307 (49%), Gaps = 29/307 (9%)

Query: 338 KLNLSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTN------KVYALKAIRK 391
           K   S  Y     + ++   + +   +G+G FGKV     K +N      K  A+K IR+
Sbjct: 20  KSRQSTSYSTQKRKHVTFGPYIVGSTLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRR 79

Query: 392 SYIVSKSEV-IHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQRE 450
             I   SE  I    E   L  + +P IV L+   Q+   + IVL + +GGE + ++Q++
Sbjct: 80  DTIPKNSEKEIKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKK 139

Query: 451 GRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQ 510
            R     A    A+L+  +  +H+  +++RDLK EN+LLD   ++ + DFG     +   
Sbjct: 140 RRLKEGPACRLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPEN 199

Query: 511 DKTNTFCGTPEYLAPELLL-GQGY-SKVVDWWTLGVLLYEMMTGLPPYYD-------EDV 561
           +   T CG+P Y APEL++  + Y ++  D W+ GV+LY M+ G  P+ D       +D+
Sbjct: 200 ELMKTSCGSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPDGDDI 259

Query: 562 PKMYKKILQEPLRFPDGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKRL 621
            K+Y+ I + PL+FPD      +DLL  +L  DPKRR+  +              + K  
Sbjct: 260 GKLYRYITRTPLKFPDYIAPVPRDLLREILIPDPKRRITISK-------------TLKHQ 306

Query: 622 WMKGYIP 628
           W++ ++P
Sbjct: 307 WLQPHMP 313

>Kwal_26.8796
          Length = 796

 Score =  137 bits (346), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 88/271 (32%), Positives = 147/271 (54%), Gaps = 30/271 (11%)

Query: 362 KVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLA-ERTVLARVENPFIVP 420
           +V+G+G+F  V +  ++ T K +A+K I K  +V    V+  +A E  VL R+++P IV 
Sbjct: 192 EVVGQGAFATVKKAIERKTGKTHAVKIISKRKVVG---VMDGVARELEVLQRLDHPRIVS 248

Query: 421 LKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLDVIYR 480
           LK  ++  D  Y+V+ F++GG+L   +   G       R  T ++L A++ +H++ + +R
Sbjct: 249 LKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVKYIHSMGISHR 308

Query: 481 DLKPENILLDHQGH--IALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQG------ 532
           DLKP+NIL++      + + DFGL K+   G     TFCGT  Y+APE++ G+       
Sbjct: 309 DLKPDNILIERDDPVLVKITDFGLAKIQGNG-TFMKTFCGTLAYVAPEVISGKNSGEKEG 367

Query: 533 --YSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKIL-----QEPL---RFPDGFDKD 582
             YS +VD W++G L+Y ++TG  P+       +YK+I      + PL   R  D    D
Sbjct: 368 NTYSSLVDMWSIGCLVYVILTGHLPFSGSTQNDLYKQITAGSYHEGPLKDYRISD----D 423

Query: 583 AKDLLIGLLSRDPKRRLGFNGADEIKSHPFF 613
           A+D +   L  DP+ R+    A++   HP+ 
Sbjct: 424 ARDFIESFLQVDPRNRM---TAEQALRHPWI 451

>YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kinase
           required for induction of Rnr3p and DNA repair genes
           after DNA damage [1542 bp, 513 aa]
          Length = 513

 Score =  135 bits (340), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 92/290 (31%), Positives = 140/290 (48%), Gaps = 33/290 (11%)

Query: 356 DDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVEN 415
           D + L K +G G +  V + + K T +  A+K         + +      E  +L RV++
Sbjct: 198 DKYLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQFREETNILMRVQH 257

Query: 416 PFIVPLKFTFQSPD-----KLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALE 470
           P IV L  +F  P      + Y+VL  I+ GELF  + R+       ++    +LL  L+
Sbjct: 258 PNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKALFKQLLTGLK 317

Query: 471 TLHNLDVIYRDLKPENILLDHQG-------------------HIALCDFGLCKLNMKGQD 511
            LH  ++I+RD+KPENILL+                       + + DFGL K   + Q 
Sbjct: 318 YLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFGLAKFTGEMQ- 376

Query: 512 KTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDE-DVPKMYKKILQ 570
            TNT CGTP Y+APE+L  +GY+  VD W+ GV+LY  + G PP+ D+   P + ++ILQ
Sbjct: 377 FTNTLCGTPSYVAPEVLTKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGPPSLKEQILQ 436

Query: 571 EPLRFP----DGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQL 616
               F     D  D     L+  LL  +P  R      DE  +HP+F+ +
Sbjct: 437 AKYAFYSPYWDKIDDSVLHLISNLLVLNPDERYNI---DEALNHPWFNDI 483

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score =  136 bits (343), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 79/250 (31%), Positives = 139/250 (55%), Gaps = 5/250 (2%)

Query: 355 VDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLA-ERTVLARV 413
           + +++++K +G+GSFGKV       T +  ALK I K  +++KS++   +  E + L  +
Sbjct: 52  IGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKK-VLAKSDMQGRIEREISYLRLL 110

Query: 414 ENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLH 473
            +P I+ L    +S D++ +V+ +  G ELF ++ +  + S   AR +  +++ A+E  H
Sbjct: 111 RHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARRFFQQIISAVEYCH 169

Query: 474 NLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGY 533
              +++RDLKPEN+LLD   ++ + DFGL  +   G +   T CG+P Y APE++ G+ Y
Sbjct: 170 RHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDG-NFLKTSCGSPNYAAPEVISGKLY 228

Query: 534 S-KVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGLLS 592
           +   VD W+ GV+LY M+    P+ DE +P ++K I       P      A  L+  +L 
Sbjct: 229 AGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLI 288

Query: 593 RDPKRRLGFN 602
            +P  R+  +
Sbjct: 289 VNPLNRISIH 298

>Kwal_33.13112
          Length = 505

 Score =  134 bits (338), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 89/268 (33%), Positives = 141/268 (52%), Gaps = 14/268 (5%)

Query: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERT-VLARVENP 416
           +++ + +GKGSFG V +   K+T ++ A+K I    +    + I  LA+    L+ +  P
Sbjct: 36  YDIKECVGKGSFGDVYRAIDKETGEMVAVKIIN---LEETQDDIDVLAQEIYFLSELRAP 92

Query: 417 FIVPLKFTFQSPDKLYIVLAFINGG---ELFYHLQREGRFSLSRARLYTAELLCALETLH 473
           F+     T+     ++IV+ F  GG   +L  HL  E R   ++      E+L  LE LH
Sbjct: 93  FVTTYYKTYVEDVSMWIVMEFCGGGSCADLLKHLP-EHRLPENKVAYIIREVLYGLEYLH 151

Query: 474 NLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLL-GQG 532
           +   I+RD+K  NILL  +G + L DFG+    M    K NTF GTP ++APE++    G
Sbjct: 152 SQRKIHRDVKAANILLTDEGEVKLGDFGVSGQIM-ATLKRNTFVGTPYWMAPEIIARDNG 210

Query: 533 YSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKI-LQEPLRFPDGFDKDAKDLLIGLL 591
           Y +  D W+LG+   E++TG PPY   D  K+   I L++P R    F   A+D +   L
Sbjct: 211 YDEKADIWSLGITAMELLTGQPPYAKYDPMKVLMNIPLRKPPRLQGRFTSSARDFIALCL 270

Query: 592 SRDPKRRLGFNGADEIKSHPFFSQLSWK 619
           ++DP  R     A ++ SH F ++ +W+
Sbjct: 271 TKDPALR---PTASDLLSHKFLNRPTWR 295

>ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH]
           complement(344395..346521) [2127 bp, 708 aa]
          Length = 708

 Score =  136 bits (343), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 77/246 (31%), Positives = 134/246 (54%), Gaps = 5/246 (2%)

Query: 357 DFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENP 416
           D+     +G+G F +  Q+ K D+ KV+A K + K  I S+      L+E  +   +++P
Sbjct: 72  DYHRGMFLGEGGFARCFQM-KDDSGKVFAAKTVAKISIKSEKTRKKLLSEIQIHKSMKHP 130

Query: 417 FIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLD 476
            IV     F+    +YI+L     G L   L++  + +    R +T +++ A++ +H+  
Sbjct: 131 NIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPEVRFFTTQIVGAIKYMHSRR 190

Query: 477 VIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQ--GYS 534
           +I+RDLK  NI  D   ++ + DFGL  +    +++  T CGTP Y+APE+L G+  G+S
Sbjct: 191 IIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIAPEVLTGKHTGHS 250

Query: 535 KVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDG--FDKDAKDLLIGLLS 592
             VD W++GV++Y ++ G PP+  ++V  +Y++I      FP       +AK L+  +LS
Sbjct: 251 FEVDIWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDFSFPKDKPISSEAKVLIKDILS 310

Query: 593 RDPKRR 598
            DP  R
Sbjct: 311 LDPLER 316

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score =  136 bits (343), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 86/261 (32%), Positives = 136/261 (52%), Gaps = 13/261 (4%)

Query: 355 VDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVE 414
           V ++ ++K +G+GSFGKV     K T++   LK   KS      EV +         + E
Sbjct: 34  VGNYRIVKQVGEGSFGKVYLATHKLTHQKVVLKTGAKSDPNVVREVFYH-------RQFE 86

Query: 415 NPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHN 474
            PFI  L     +  ++++ L +  G EL+ +L  + R  L   R   A+++ A+   H+
Sbjct: 87  YPFITKLYEVIVTETRVWMALEYCPGNELYDYLLLKQRIPLDETRRLFAQIVSAVFYAHS 146

Query: 475 LDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYS 534
           L  ++RDLK ENILLD  G+  L DFG  +     + +  T CGT  Y+APEL+  + Y 
Sbjct: 147 LQCVHRDLKLENILLDKNGYAMLTDFGFTR-ECATKTQLETVCGTTVYMAPELIKREAYD 205

Query: 535 KV-VDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKIL-QEPLRFPDGFDKDAKDLLIGLLS 592
              VD W+LG++LY M+ G  P+ ++D  +   KI+ +EP    +     AKDL++ LL 
Sbjct: 206 GYKVDTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLDEYTSPQAKDLIVRLLD 265

Query: 593 RDPKRRLGFNGADEIKSHPFF 613
           ++  +R   N   E+  HPF 
Sbjct: 266 KNAAQRPNLN---EVLQHPFL 283

>Scas_693.17
          Length = 1049

 Score =  136 bits (342), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 94/326 (28%), Positives = 155/326 (47%), Gaps = 54/326 (16%)

Query: 354 SVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIR--------KSYIVSKSEVIHTLA 405
           S+ D++ ++ +G GS GKV   + + TN+V A+K +         K Y    +     L+
Sbjct: 67  SLGDWDFVETVGAGSMGKVKLAKNRRTNEVCAIKIVNRATKIFLSKEYAAKHNGYTIPLS 126

Query: 406 ERTVLARVEN-----------------------PFIVPLKFTFQSPDKLYIVLAFINGGE 442
           E+ V+ R +N                       P I  L       +  Y++  +++GG+
Sbjct: 127 EKEVIERQKNLEKEASRDKRTVREASLGQILYHPHICRLYEMHTLSNHFYMLFEYVSGGQ 186

Query: 443 LFYHLQREGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGL 502
           L  ++ + G    SRAR +T ++  AL+ LH+ ++++RDLK ENI++   G+I L DFGL
Sbjct: 187 LLDYIIQHGSLKESRARTFTRQICSALKYLHSHNIVHRDLKIENIMISKDGNIKLIDFGL 246

Query: 503 CKLNMKGQDKTNTFCGTPEYLAPELLLGQGY-SKVVDWWTLGVLLYEMMTGLPPYYDEDV 561
             L  K  +K  T+CG+  + APELL    Y    +D W+ GV+LY ++ G  P+ DE+ 
Sbjct: 247 SNLYDKC-NKLKTYCGSLYFAAPELLKATPYIGPEIDVWSFGVVLYVLVCGKVPFDDENS 305

Query: 562 PKMYKKILQEPLRFPDGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKRL 621
             +++KI Q  + +P     +   LL  +L  DP +R      D++ +H           
Sbjct: 306 NVLHEKIKQGKVFYPQFLSIEVISLLSKMLVVDPFKRATL---DQVMNH----------H 352

Query: 622 WM--------KGYIPPYKPPVMNSLD 639
           WM        K YIP   P  +  LD
Sbjct: 353 WMVRDCDGPPKSYIPDRPPLTIEQLD 378

>Kwal_0.96
          Length = 427

 Score =  132 bits (331), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 81/259 (31%), Positives = 138/259 (53%), Gaps = 10/259 (3%)

Query: 350 NRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTL-AERT 408
           N  ++  D+   K +G GSFG V Q R+  + +  A+K + K  +  K   +  L  E +
Sbjct: 38  NSYVNKSDYIFGKTLGAGSFGVVRQARQVSSGENVAIKILLKKALKGKDVELQMLYDELS 97

Query: 409 VLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCA 468
           +L ++++P IV  K  F+S DK YIV     GGELF  + ++G+F+   A     ++L A
Sbjct: 98  ILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILKQGKFTEEDAVRIVYQILKA 157

Query: 469 LETLHNLDVIYRDLKPENILLDHQG---HIALCDFGLCKLNMKGQDKTNTFCGTPEYLAP 525
           +E LH+ ++++RDLKPEN+L   +     + L DFG+ K      +  +   G+  Y+AP
Sbjct: 158 VEYLHSRNIVHRDLKPENLLYLTEAADSQLVLGDFGIAKELKNDDELIHKAAGSMGYVAP 217

Query: 526 ELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKK--ILQEPLRFPDGF---- 579
           E++   G+ K  D W+LGV+ Y ++ G  P+  E V    ++  I + P+ F   +    
Sbjct: 218 EVVTTSGHGKPCDIWSLGVVTYTLLCGYSPFVAESVEGFLEECTIGRTPVTFHKPYWSNI 277

Query: 580 DKDAKDLLIGLLSRDPKRR 598
             +AKD ++  L+ +P  R
Sbjct: 278 SNEAKDFILRALTVNPHDR 296

>Scas_700.34
          Length = 864

 Score =  135 bits (339), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 90/290 (31%), Positives = 144/290 (49%), Gaps = 26/290 (8%)

Query: 363 VIGKGSFGKVMQVRKK----------DTNKVYALKAIRKSYIVS-KSEVIHTLAERTVLA 411
            +G+G FGKV     K          D  K  A+K IR+  I    S+ I    E   L 
Sbjct: 53  TLGEGEFGKVKLGWPKNSLPSSSSGIDVPKQVAIKLIRRDTISKDSSKEIKIYREINALK 112

Query: 412 RVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALET 471
            + +P IV L+   Q+   + IVL + +GGE + ++QR+ R     A    A+L+  +  
Sbjct: 113 HLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKKRLKEGPACRLFAQLINGVHY 172

Query: 472 LHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQ 531
           +H+  +++RDLK EN+LLD   ++ + DFG         +   T CG+P Y APEL++  
Sbjct: 173 IHSKGLVHRDLKLENLLLDKHENLIITDFGFVSEFYSHGELMKTSCGSPCYAAPELVVST 232

Query: 532 G--YSKVVDWWTLGVLLYEMMTGLPPYYD-------EDVPKMYKKILQEPLRFPDGFDKD 582
               +K  D W+ GV+LY M+ G  P+ D       +D+ ++Y  I Q PL+FPD  +  
Sbjct: 233 KPYEAKKADIWSCGVILYAMLAGYLPWDDDAGNPDGDDISRLYHYITQTPLKFPDYINPI 292

Query: 583 AKDLLIGLLSRDPKRRLGFNGADE---IKSHPFFSQLS---WKRLWMKGY 626
            +DLL  +L  DP+RR+     ++   +K H  F  ++   W  +  K +
Sbjct: 293 PRDLLRRILISDPRRRITIKYIEKHEWLKPHSAFLSITPEEWDTIMHKKF 342

>KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication, start by similarity
          Length = 708

 Score =  134 bits (337), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 77/246 (31%), Positives = 130/246 (52%), Gaps = 5/246 (2%)

Query: 357 DFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENP 416
           D+     +G+G F +  Q+ K D  KV+A K + K  I S+      L+E  +   +++P
Sbjct: 89  DYHRGHFLGEGGFARCFQM-KDDKGKVFAAKTVAKLSIKSEKTRRKLLSEIQIHKSMKHP 147

Query: 417 FIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLD 476
            IV     F+    +YI+L     G +   L++    +    R    +++ A+  +H+  
Sbjct: 148 NIVQFTDCFEDDTNVYILLEICPNGSVMELLRQRKHLTEPEVRFCMIQIIGAIRYMHSRR 207

Query: 477 VIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQ--GYS 534
           VI+RDLK  NI  D + ++ + DFGL  +    +++  T CGTP Y+APE+L G+  G+S
Sbjct: 208 VIHRDLKLGNIFFDKEYNLKIGDFGLAAVLANDKERKYTICGTPNYIAPEVLTGKHTGHS 267

Query: 535 KVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFP--DGFDKDAKDLLIGLLS 592
             VD W++GV+LY ++ G PP+  ++V  +Y++I      FP       DAK+L+  LL 
Sbjct: 268 YEVDIWSIGVMLYALLFGKPPFQAKEVETIYERIKCRDFIFPADKPVSSDAKNLISHLLQ 327

Query: 593 RDPKRR 598
            +P  R
Sbjct: 328 LNPAAR 333

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score =  133 bits (335), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 84/273 (30%), Positives = 147/273 (53%), Gaps = 14/273 (5%)

Query: 331 GLAQGNGKLNLSVDYKPATNRALS--VDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKA 388
           G  QG+ +  L       TN A    +  ++++K +G+GSFGKV       T +  ALK 
Sbjct: 13  GSGQGHHQRQL-------TNHAQGQHIGKYQIIKTLGEGSFGKVKLAYHISTGQKVALKI 65

Query: 389 IRKSYIVSKSEVIHTLA-ERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHL 447
           I K  +++KS++   +  E + L  + +P I+ L    +S D++ +V+ +  G ELF ++
Sbjct: 66  INKK-VLAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYI 123

Query: 448 QREGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNM 507
            +  +     AR +  +++ A++  H   +++RDLKPEN+LLD   ++ + DFGL  +  
Sbjct: 124 VQRDKMPEQEARRFFQQIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMT 183

Query: 508 KGQDKTNTFCGTPEYLAPELLLGQGYS-KVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYK 566
            G +   T CG+P Y APE++ G+ Y+   VD W+ GV+LY M+    P+ DE +P ++K
Sbjct: 184 DG-NFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDESIPVLFK 242

Query: 567 KILQEPLRFPDGFDKDAKDLLIGLLSRDPKRRL 599
            I       P+   + A  L+  +L  +P  R+
Sbjct: 243 NISNGVYTIPNFLSQGAASLIKKMLIVNPVNRI 275

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score =  134 bits (338), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 67/212 (31%), Positives = 124/212 (58%), Gaps = 6/212 (2%)

Query: 406 ERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAEL 465
           E  ++  + +P ++ L   +++  +LY+VL +++GGELF +L  +G+ S   A  Y  ++
Sbjct: 176 EIVIMKLISHPNVMGLLEVWENKSELYLVLEYVDGGELFDYLVSKGKLSEPEAVHYFTQI 235

Query: 466 LCALETLHNLDVIYRDLKPENILLDHQGH-IALCDFGLCKLNMKGQDKTNTFCGTPEYLA 524
           +  +   H+ ++ +RDLKPEN+LLD +   I + DFG+  L +  +    T CG+P Y +
Sbjct: 236 IQGVSYCHSFNICHRDLKPENLLLDKKNKVIKIADFGMAALELPNK-LLETSCGSPHYAS 294

Query: 525 PELLLGQGY-SKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDA 583
           PE+++G+ Y     D W+ G++L+ ++TG  P+ D+++ K+  K+     + P     DA
Sbjct: 295 PEIVMGKPYHGGPSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLPPYLTNDA 354

Query: 584 KDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQ 615
           KDL+  +L  +P++RL  N   EI +HP   +
Sbjct: 355 KDLITRILVTNPEKRLTIN---EILNHPLIKK 383

>CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces
           cerevisiae YDL101c DUN1 protein kinase, start by
           similarity
          Length = 506

 Score =  131 bits (330), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 88/291 (30%), Positives = 143/291 (49%), Gaps = 33/291 (11%)

Query: 356 DDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVEN 415
           D + L K +G G +  V + + K T +  A+K         + +      E T+L ++ +
Sbjct: 191 DKYLLGKDLGSGHYAIVKEAKNKTTGETVAVKIFHPQQNDDQKKNKQFREETTILMKIHH 250

Query: 416 PFIVPLKFTFQSPD-----KLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALE 470
           P IV L  +F  P      + Y+VL  I+ GELF  + ++       ++    ++L  L+
Sbjct: 251 PNIVNLLDSFVEPISKTQIQKYLVLEKIDDGELFDRIVKKTSLPQEESKAIFKQILTGLK 310

Query: 471 TLHNLDVIYRDLKPENILLDHQG-------------------HIALCDFGLCKLNMKGQD 511
            LH+ ++I+RD+KPENILL+ +                     + + DFGL K   + Q 
Sbjct: 311 YLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIADFGLAKFTGEMQ- 369

Query: 512 KTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDE-DVPKMYKKILQ 570
            TNT CGTP Y+APE+L+ +GY+  VD W+ GV+LY  + G PP+ D+   P + ++I+ 
Sbjct: 370 FTNTLCGTPSYVAPEVLVKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGPPSLKEQIMS 429

Query: 571 EPLRFP----DGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLS 617
               F     D  D  A  L+  LL  DP+ R   + A    +HP+   +S
Sbjct: 430 AKYAFYSPYWDEIDDAALHLISNLLVLDPENRYDVDAA---AAHPWLDSVS 477

>Scas_644.15
          Length = 726

 Score =  133 bits (335), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 78/277 (28%), Positives = 141/277 (50%), Gaps = 18/277 (6%)

Query: 357 DFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENP 416
           D+     +G+G F +  Q+ K ++ K++A K + K  I ++      L+E  +   +++P
Sbjct: 91  DYRRGHFLGEGGFARCFQI-KDESGKIFAAKTVAKISIKTEKTKKKLLSEIQIHKSMKHP 149

Query: 417 FIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLD 476
            IV     F+    +YI+L   + G L   +++    +    R +T ++  A++ +H+  
Sbjct: 150 NIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLTEPEVRFFTTQICGAVKYMHSRR 209

Query: 477 VIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQ--GYS 534
           VI+RDLK  NI  D   ++ + DFGL  +    +++  T CGTP Y+APE+L+G+  G+S
Sbjct: 210 VIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKYTVCGTPNYIAPEVLMGKHAGHS 269

Query: 535 KVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDG--FDKDAKDLLIGLLS 592
             VD W++GV++Y ++ G PP+  +DV  +Y +I      +P       +AK L+  +L 
Sbjct: 270 FEVDIWSIGVMIYALLVGKPPFQAKDVNVIYDRIKACQYGYPKDKYVSSEAKTLIADILC 329

Query: 593 RDPKRRLGFNGADEIKSHPFFSQLSWKRLWMKGYIPP 629
            DP  R            P   ++    +W +G  PP
Sbjct: 330 VDPVER------------PSIREI-IDDVWFRGIFPP 353

>CAGL0M02519g complement(290723..292993) highly similar to tr|Q03002
           Saccharomyces cerevisiae YPL141c or sp|Q01919
           Saccharomyces cerevisiae YOR233w KIN4, hypothetical
           start
          Length = 756

 Score =  133 bits (334), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 87/311 (27%), Positives = 156/311 (50%), Gaps = 36/311 (11%)

Query: 347 PATNRALSVDDFELLKVIGKGSFGKV---------MQVRKKDTN-----------KVYAL 386
           P   + ++   + +   +G+G FGKV          Q    + N           K  A+
Sbjct: 37  PKHRKHVTFGPYVIGATLGEGEFGKVKLAWSKSAYQQCDNTEGNAGNKPMTFKVPKQVAI 96

Query: 387 KAIRKSYIVSK-SEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFY 445
           K I++ +I    S+      E   L  + +P IV L+   Q+   + IVL +  GGE + 
Sbjct: 97  KLIKRDFITKDPSKETKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYAAGGEFYK 156

Query: 446 HLQREGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKL 505
            +QR+ R   + A    ++L+ A+  +H+  +++RDLK EN+LLD++ ++ + DFG    
Sbjct: 157 FIQRKRRLKENHACRLFSQLISAVHYIHSKGLVHRDLKLENLLLDNEENLIITDFGFVNE 216

Query: 506 NMKGQDKTNTFCGTPEYLAPELLLG-QGY-SKVVDWWTLGVLLYEMMTGLPPYYDE---- 559
            ++      T CG+P Y APEL++  + Y ++  D W+ G++L+ M+ G  P+ D+    
Sbjct: 217 FLRQNGMMKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLPWDDDPKNP 276

Query: 560 ---DVPKMYKKILQEPLRFPDGFDKDAKDLLIGLLSRDPKRRLGFNGADE---IKSHPFF 613
              D+ ++Y  IL  PL+FP+  +   +DLL  +L  DPK+R+     ++   ++SH  F
Sbjct: 277 DGHDISRLYNYILNTPLKFPEYINPVPRDLLRKILVIDPKKRINIRSIEKHPWLESHSTF 336

Query: 614 SQLS---WKRL 621
             ++   W RL
Sbjct: 337 LSITPDEWDRL 347

>AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W
           (KCC4) - SH] (1721689..1725117) [3429 bp, 1142 aa]
          Length = 1142

 Score =  133 bits (335), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 86/282 (30%), Positives = 150/282 (53%), Gaps = 22/282 (7%)

Query: 351 RALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKS---------EVI 401
           R   +  ++L + +G GS GKV+  +  +T ++ A+K I KS   ++          +V+
Sbjct: 12  RGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVL 71

Query: 402 HTLAER--TVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRAR 459
               ER   ++  + +P ++ L   +++   LY+VL ++  GELF  L + G    + A 
Sbjct: 72  PYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAV 131

Query: 460 LYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDK-TNTFCG 518
            +  +++  +   H L +++RDLKPEN+LLDH+ +I L DFG+  L  K  DK   T CG
Sbjct: 132 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESK--DKLLETSCG 189

Query: 519 TPEYLAPELLLGQGYSKV-VDWWTLGVLLYEMMTGLPPYYDED--VPKMYKKILQEPLRF 575
           +P Y APE++ G  Y     D W+ GV+LY ++TG  P+ +ED  +  +  K+       
Sbjct: 190 SPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEI 249

Query: 576 P--DGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQ 615
           P  D    +A+DL++ +L+ +P++R+      EI  HP   +
Sbjct: 250 PGEDEISPEARDLIVQILTVEPEQRI---KTREILKHPLLQK 288

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score =  132 bits (333), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 89/309 (28%), Positives = 156/309 (50%), Gaps = 43/309 (13%)

Query: 333 AQGNGKLNLSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKS 392
           +  N  +NL+  YK       S++D    +V+G G+F  V +  +++T K +A+K I K 
Sbjct: 172 SNANPNINLTGIYKD-----FSIND----EVVGTGAFATVKKAVERNTGKTFAVKIINKR 222

Query: 393 YIVSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGR 452
            +V   + +    E  VL ++ +P IV LK  ++     Y+V+ FI+GG+L   +   G 
Sbjct: 223 KVVGNMDGVSR--ELEVLQKLNHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGA 280

Query: 453 FSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGH--IALCDFGLCKLNMKGQ 510
                 R  + ++L A++ +H+  + +RDLKP+NIL++      + + DFGL K+   G 
Sbjct: 281 VGEEAGREISRQILEAIQYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNG- 339

Query: 511 DKTNTFCGTPEYLAPELLLG--------------QGYSKVVDWWTLGVLLYEMMTGLPPY 556
               TFCGT  Y+APE++ G                YS +VD W++G L++ ++TG  P+
Sbjct: 340 SIMKTFCGTLAYVAPEVIGGFTGATGEEETEEERIEYSSLVDMWSMGCLVFVILTGHLPF 399

Query: 557 YDEDVPKMYKKILQ--------EPLRFPDGFDKDAKDLLIGLLSRDPKRRLGFNGADEIK 608
                 ++Y++I +        +  R  D    +A+D + GLL  D  +R+     D+  
Sbjct: 400 SGSTQEQLYEQIRKGSYHEGPLKDFRISD----EARDFIDGLLQVDQSKRM---TVDDAL 452

Query: 609 SHPFFSQLS 617
           +HP+  Q S
Sbjct: 453 NHPWIKQCS 461

>KLLA0F11143g complement(1026129..1028570) similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 813

 Score =  132 bits (333), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 82/268 (30%), Positives = 149/268 (55%), Gaps = 25/268 (9%)

Query: 363 VIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPFIVPLK 422
           ++G+G+F  V +  ++ T K +A+K I K  ++ K + +    E  VL ++ +P IV LK
Sbjct: 197 IVGQGAFATVKKAVERSTGKTFAVKIIHKRKVMDKFDGVKR--ELDVLQKLNHPRIVKLK 254

Query: 423 FTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLDVIYRDL 482
             F+  D  Y+++ F++GG+L   +   G       R  T ++L A++ +H+  + +RDL
Sbjct: 255 DFFEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAGREITRQVLEAVKYMHDQGISHRDL 314

Query: 483 KPENILLDHQGH--IALCDFGLCKLNMKGQDK-TNTFCGTPEYLAPELLLGQG------- 532
           KP+NI+++      I + DFGL K+  + Q+   NTFCGT  Y+APE++ G+        
Sbjct: 315 KPDNIMIEQDDPVLIKITDFGLAKV--QNQNTFLNTFCGTLAYVAPEVIDGKNAEDKTNR 372

Query: 533 --YSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKIL-----QEPLRFPDGFDKDAKD 585
             YS +VD W++G L+Y ++TG  P+  +   +++K+I      + PL+      ++A++
Sbjct: 373 DLYSSLVDMWSIGCLVYVILTGHLPFSGQSQNELFKQIKRGSYHEGPLK-DYRISEEARN 431

Query: 586 LLIGLLSRDPKRRLGFNGADEIKSHPFF 613
            +  LL+ DPK R+    A +   HP+ 
Sbjct: 432 FIDCLLNVDPKERM---NAGKALQHPWM 456

>CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, hypothetical start
          Length = 442

 Score =  129 bits (324), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 80/256 (31%), Positives = 132/256 (51%), Gaps = 10/256 (3%)

Query: 353 LSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTL-AERTVLA 411
           +S  ++   K +G G+FG V Q R   TN+  A+K + K  +      +  L  E ++L 
Sbjct: 40  VSKSNYVFGKTLGAGTFGVVRQARYSPTNEDVAVKILLKKALKGNDVQLQMLYDELSILQ 99

Query: 412 RVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALET 471
            +++P IV  K  F+S DK YIV     GGELF  +  +G+F+   A   T ++L A++ 
Sbjct: 100 MLKHPNIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKGKFTERDAVSITMQILSAVDY 159

Query: 472 LHNLDVIYRDLKPENILL---DHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELL 528
           +H+ +V++RDLKPEN+L         + + DFG+ K      D      G+  Y+APE+L
Sbjct: 160 MHSKNVVHRDLKPENVLYIDKSDDSQLVIADFGIAKQLQDNDDLIFKAAGSLGYVAPEVL 219

Query: 529 LGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQE--PLRFP----DGFDKD 582
              G+ K  D W++GV++Y ++ G   +  E V    ++  Q   P+ F     D    +
Sbjct: 220 TNNGHGKPCDIWSIGVIVYTLLCGYSAFVAETVDGFLEECTQNKYPVTFHKPYWDNISDE 279

Query: 583 AKDLLIGLLSRDPKRR 598
           AK+ ++  L+ DP  R
Sbjct: 280 AKNFILRALTLDPAER 295

>Scas_700.54
          Length = 698

 Score =  131 bits (329), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 93/326 (28%), Positives = 161/326 (49%), Gaps = 38/326 (11%)

Query: 362 KVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPFIVPL 421
           +V+G+G+F  V +  ++ T K +A+K I K  ++   E +    E  VL ++++P IV L
Sbjct: 227 EVVGQGAFATVKKAVERSTGKTFAVKIISKRKVMGNMEGVSR--ELEVLQQLDHPRIVRL 284

Query: 422 KFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLDVIYRD 481
           K  ++  D  Y+V+ F++GG+L   +   G       +  + ++L A++ +H+  + +RD
Sbjct: 285 KGFYEDKDSYYMVMEFVSGGDLMDFVAAHGAVGEEAGKEISRQILEAVKYIHSKGISHRD 344

Query: 482 LKPENILLDHQG--HIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQG------- 532
           LKP+NIL++      + + DFGL K+   G     TFCGT  Y+APE++ G+G       
Sbjct: 345 LKPDNILIEQDDPVLVKITDFGLAKVQGNG-SFMKTFCGTLAYVAPEVIGGKGETNEERN 403

Query: 533 -YSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQ--------EPLRFPDGFDKDA 583
            YS +VD W++G L+Y ++TG  P+      ++YK+I +        +  R  D    +A
Sbjct: 404 EYSSLVDMWSMGCLVYVILTGHLPFSGSTQEQLYKQISRGSYHEGPLKDFRISD----EA 459

Query: 584 KDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNSLDTSNF 643
           +  +  LL  +P  RL    A E   HP+          M  Y   +K     SL  S  
Sbjct: 460 RSFIDSLLQVNPGNRLTAARALE---HPWIK--------MAQYSQSFKEASQISLTESLS 508

Query: 644 DQEFTKELPVDSVVNDFLSESVQQQF 669
            Q+  + +  D    +F+    +QQ 
Sbjct: 509 QQKLLESM--DDAQYEFVKAQRKQQL 532

>YDR507C (GIN4) [1321] chr4 complement(1462346..1465774)
           Serine/threonine-protein kinase required for septin
           organization at the bud neck, has similarity to Ycl024p
           [3429 bp, 1142 aa]
          Length = 1142

 Score =  130 bits (326), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 83/283 (29%), Positives = 148/283 (52%), Gaps = 27/283 (9%)

Query: 354 SVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYI----VSKSEVIHTLA---- 405
           ++  ++L + +G GS GKV   R   T +  A+K I K+      VS + ++ +      
Sbjct: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDAL 74

Query: 406 ------ERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRAR 459
                 E  ++  + +P ++ L   +++   LY+VL +   GELF  L   G      A 
Sbjct: 75  PYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAI 134

Query: 460 LYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGT 519
            +  +++  +   H L +++RDLKPEN+LLDH+ +I + DFG+  L  +G+    T CG+
Sbjct: 135 RFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGK-LLETSCGS 193

Query: 520 PEYLAPELLLG---QGYSKVVDWWTLGVLLYEMMTGLPPYYDED--VPKMYKKILQEPLR 574
           P Y APE++ G   QG++   D W+ GV+L+ ++TG  P+ +ED  +  +  K+ +    
Sbjct: 194 PHYAAPEIVSGIPYQGFAS--DVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFE 251

Query: 575 FP--DGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQ 615
            P  D   ++A+DL+  +L+ DP+RR+      +I  HP   +
Sbjct: 252 MPSDDEISREAQDLIRKILTVDPERRI---KTRDILKHPLLQK 291

>Kwal_56.22476
          Length = 697

 Score =  129 bits (323), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 84/269 (31%), Positives = 139/269 (51%), Gaps = 8/269 (2%)

Query: 357 DFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENP 416
           D+     +G+G F +  Q+ K D  K++A K + K  I S+      L+E  +   + + 
Sbjct: 78  DYHRGHFLGEGGFARCFQI-KDDGGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMRHT 136

Query: 417 FIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLD 476
            IV     F+    +YI+L     G L   L+R    +    R +T +++ A++ +H+  
Sbjct: 137 NIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPEVRFFTTQIVGAVKYMHSRR 196

Query: 477 VIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQ--GYS 534
           VI+RDLK  NI  D   ++ + DFGL  +    +++  T CGTP Y+APE+L G+  G+S
Sbjct: 197 VIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKYTVCGTPNYIAPEVLTGKHTGHS 256

Query: 535 KVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFP-DGF-DKDAKDLLIGLLS 592
             VD W+ GV++Y ++ G PP+  ++V  +Y++I      FP D F   +A  L+  +LS
Sbjct: 257 YEVDIWSCGVMIYALLIGKPPFQAKEVNIIYERIKCGDFVFPKDKFISPEALVLIKDILS 316

Query: 593 RDPKRRLGFNGADEIKSHPFFSQLSWKRL 621
            DP  R      DEI  + +F  L   R+
Sbjct: 317 IDPLERPSL---DEIIDYVWFRGLFPSRI 342

>AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH]
           (1769897..1771219) [1323 bp, 440 aa]
          Length = 440

 Score =  125 bits (315), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 82/265 (30%), Positives = 138/265 (52%), Gaps = 13/265 (4%)

Query: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTV-LARVENP 416
           +E+L+ IG+G+FG V + R   +N++ A+K +    +    E I  LA+    L+ + +P
Sbjct: 20  YEILQCIGRGNFGDVYKARDLTSNEIVAIKVVN---LEDTDEPIDLLAQEIFFLSELRSP 76

Query: 417 FIVPLKFTFQSPDKLYIVLAFINGGELFYHLQR--EGRFSLSRARLYTAELLCALETLHN 474
           +I   K  F     ++IV+ +  GG     L+   E + +  +     +E+L  L+ LH+
Sbjct: 77  YITNYKTAFLVDVSMWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVLIGLDYLHS 136

Query: 475 LDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELL--LGQG 532
              I+RD+K  NILL   GH+ L DFG+    M    K +TF GTP ++APE++    QG
Sbjct: 137 QRKIHRDIKSANILLTDNGHVKLGDFGVSG-QMMVTRKRDTFVGTPFWMAPEVIDRNKQG 195

Query: 533 YSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKI-LQEPLRFPDGFDKDAKDLLIGLL 591
           Y+++ D W+LG+ + E++ G PP    D  K    I  ++P +    F   A+D +   L
Sbjct: 196 YNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKRDPPKLDKRFSSHARDFVAQCL 255

Query: 592 SRDPKRRLGFNGADEIKSHPFFSQL 616
            +DP +R     A E+  H F  ++
Sbjct: 256 IKDPSQR---PTAAELLKHRFVKRV 277

>CAGL0K05709g complement(555903..559214) similar to sp|Q12263
           Saccharomyces cerevisiae YDR507c GIN4, start by
           similarity
          Length = 1103

 Score =  129 bits (324), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 86/277 (31%), Positives = 146/277 (52%), Gaps = 26/277 (9%)

Query: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIV------SKSEVIHTL-----AE 406
           ++L + +G GS GKV+    + T +  A+K I K+         S  +  + L      E
Sbjct: 20  WKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPYNIEQE 79

Query: 407 RTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELL 466
             ++  + +P ++ L   +++   LY+VL +   GELF  L   G    + A     +++
Sbjct: 80  IIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQII 139

Query: 467 CALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDK-TNTFCGTPEYLAP 525
             +   H+L V++RDLKPEN+LLD++ +I + DFG+  L  + +DK   T CG+P Y AP
Sbjct: 140 IGISYCHSLGVVHRDLKPENLLLDNKLNIKIADFGMAAL--ESEDKLLETSCGSPHYAAP 197

Query: 526 ELLLG---QGYSKVVDWWTLGVLLYEMMTGLPPYYDED--VPKMYKKILQEPLRFPDG-- 578
           E++ G   +G+S   D W+ GV+L+ ++TG  P+ +ED  +  +  K+ +     PD   
Sbjct: 198 EIISGLPYEGFSS--DVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDE 255

Query: 579 FDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQ 615
             K+A+DLL  LL+ DP +R+      EI  HP   +
Sbjct: 256 ITKEAQDLLARLLTVDPSKRITIR---EILKHPLLQK 289

>ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH]
           complement(597519..600032) [2514 bp, 837 aa]
          Length = 837

 Score =  128 bits (322), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 84/273 (30%), Positives = 143/273 (52%), Gaps = 32/273 (11%)

Query: 362 KVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPFIVPL 421
           +V+G+G+F  V +  +++T K +A+K I K  ++   + +    E  VL R+ +P IV L
Sbjct: 221 EVVGQGAFATVKKAVERNTGKTFAVKIINKRKVMGNVDGV--TRELEVLRRLNHPRIVSL 278

Query: 422 KFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLDVIYRD 481
           K  ++  +  Y+++ F++GG+L   +   G       R  T ++L A+  +H   + +RD
Sbjct: 279 KGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVRYIHEQGISHRD 338

Query: 482 LKPENILLDHQGH--IALCDFGLCKLNMKGQDKTN---TFCGTPEYLAPELLLGQG---- 532
           LKP+NIL++      + + DFGL K+    QD T    TFCGT  Y+APE++ G+     
Sbjct: 339 LKPDNILIEQDDPVLVKITDFGLAKI----QDNTTFMKTFCGTLAYVAPEVIGGKNPEGN 394

Query: 533 ------YSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKD---- 582
                 YS +VD W++G L+Y ++TG  P+      ++YK+I      + +G  KD    
Sbjct: 395 GANGNLYSSLVDMWSIGCLVYVILTGHLPFSGSTQEQLYKQIANGS--YHEGPLKDYWIS 452

Query: 583 --AKDLLIGLLSRDPKRRLGFNGADEIKSHPFF 613
             A+D +  LL  +P  RL    A+    HP+ 
Sbjct: 453 DEARDFIDSLLQINPVDRL---TAERALQHPWL 482

>KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, start by similarity
          Length = 427

 Score =  125 bits (313), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 77/252 (30%), Positives = 130/252 (51%), Gaps = 10/252 (3%)

Query: 357 DFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLA-ERTVLARVEN 415
           D+   K +G G+FG V Q R   + +  A+K + K  +  +S  +  L  E ++L ++ +
Sbjct: 45  DYIFGKTLGAGTFGVVRQARCISSGENVAVKILLKKALKGQSVQLQMLYDELSILQQLNH 104

Query: 416 PFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNL 475
           P IV  K  F+S +K YIV     GGELF  +  +G+F    A     ++L  ++ LH  
Sbjct: 105 PNIVRFKDWFESKEKFYIVTQLATGGELFDRILEKGKFCEVDAVFIVKQILQGVQYLHQR 164

Query: 476 DVIYRDLKPENILLDHQGH---IALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQG 532
           ++++RDLKPENIL  ++     + + DFG+ K      +  +   G+  Y+APE+L   G
Sbjct: 165 NIVHRDLKPENILYLNKSDDSPLVIGDFGIAKELKDDNELIHKAAGSMGYVAPEVLTSSG 224

Query: 533 YSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKIL--QEPLRFP----DGFDKDAKDL 586
           + K  D W++GV+ Y ++ G  P+  E      ++    Q P+ F     +   K AK+ 
Sbjct: 225 HGKPCDIWSIGVITYTLLCGYSPFLAESADGFIEECTSGQYPVVFHKPYWNNVSKTAKEF 284

Query: 587 LIGLLSRDPKRR 598
           ++  L+  PKRR
Sbjct: 285 ILWALTVSPKRR 296

>Scas_564.7
          Length = 1210

 Score =  127 bits (320), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 92/335 (27%), Positives = 155/335 (46%), Gaps = 47/335 (14%)

Query: 327 HQWIGLAQGNGKLNLSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYAL 386
           H   G A  N   N +   +P      S+ D++ L+ +G GS GKV   R   T ++ A+
Sbjct: 134 HPTTGNANNNATSNQN---EPKQFHRKSLGDWDFLETVGAGSMGKVKLARHHQTKEICAI 190

Query: 387 KAIR---KSYIVSKSEVIHTLAERTVLARVE-----------------------NPFIVP 420
           K +    K+++  +  +     E+ VL R +                       +P I  
Sbjct: 191 KIVNRAMKAFLHKEQSMPPPRTEQEVLERQKKLEKEISRDKRTIREASLGQVLYHPHICR 250

Query: 421 LKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLDVIYR 480
           L       +  Y++  +++GG+L  ++ + G      AR +   +  ALE +H  ++++R
Sbjct: 251 LFEMCTMSNHFYMLFEYVSGGQLLDYIIQHGSLREHHARKFARGIASALEYIHANNIVHR 310

Query: 481 DLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYS-KVVDW 539
           DLK ENI++   G I + DFGL  +    + + +TFCG+  + APELL    Y+   VD 
Sbjct: 311 DLKIENIMISTSGEIKIIDFGLSNV-FDRKKQLHTFCGSLYFAAPELLKAHPYTGPEVDV 369

Query: 540 WTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGLLSRDPKRRL 599
           W+ GV+LY ++ G  P+ DE+   +++KI Q  + +P+    +   LL  +L  DP RR 
Sbjct: 370 WSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVDYPNHLSIEVISLLSKMLVVDPLRRA 429

Query: 600 GFNGADEIKSHPFFSQLSWKRLWM-KGYIPPYKPP 633
                 ++  HP          WM +GY   Y PP
Sbjct: 430 SL---KQVVEHP----------WMTRGYD--YPPP 449

>YFR014C (CMK1) [1695] chr6 complement(172529..173869)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) type I [1341 bp, 446 aa]
          Length = 446

 Score =  124 bits (310), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 75/247 (30%), Positives = 130/247 (52%), Gaps = 10/247 (4%)

Query: 362 KVIGKGSFGKVMQVRKKDTNKVYALKA-IRKSYIVSKSEVIHTLAERTVLARVENPFIVP 420
           K +G G+FG V Q +  +T +  A+K  I+K+   +K ++     E  +L R+ +P IV 
Sbjct: 41  KTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHHPNIVA 100

Query: 421 LKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLDVIYR 480
            K  F+S DK YI+     GGELF  + ++G+F+   A     E+L A++ +H+ ++++R
Sbjct: 101 FKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILVEILSAVKYMHSQNIVHR 160

Query: 481 DLKPENILL---DHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVV 537
           DLKPEN+L      +  + + DFG+ K     ++      G+  Y+APE+L   G+ K  
Sbjct: 161 DLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGYVAPEVLTQDGHGKPC 220

Query: 538 DWWTLGVLLYEMMTGLPPYYDEDVPKMYKKIL--QEPLRFP----DGFDKDAKDLLIGLL 591
           D W++GV+ Y ++ G   +  E V     +    + P++F     D     AK  ++  L
Sbjct: 221 DIWSIGVITYTLLCGYSAFRAERVQDFLDECTTGEYPVKFHRPYWDSVSNKAKQFILKAL 280

Query: 592 SRDPKRR 598
           + DP +R
Sbjct: 281 NLDPSKR 287

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score =  126 bits (316), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 130/246 (52%), Gaps = 7/246 (2%)

Query: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVEN-P 416
           F+  +VIG+G FG V +     T +VYA+K +  +   S+ EV     E   LA ++  P
Sbjct: 16  FKRTEVIGRGKFGIVYKGYHVKTKQVYAIKVL--NLDSSEDEVEDVQREIQFLASLKQIP 73

Query: 417 FIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLD 476
            I     ++     L+I++ +  GG L   L R G+       +   ELL AL+ +H  +
Sbjct: 74  NITRYYGSYLRGTSLWIIMEYCAGGSL-RSLLRPGKIDEKYIGVIMRELLVALKVIHKDN 132

Query: 477 VIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLL-GQGYSK 535
           VI+RD+K  N+L+ ++G + LCDFG+     +   +  T  GTP ++APE+++ G  Y  
Sbjct: 133 VIHRDIKAANVLITNEGQVKLCDFGVAAQLNQTSLRRQTMAGTPYWMAPEVIMEGVYYDT 192

Query: 536 VVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQ-EPLRFPD-GFDKDAKDLLIGLLSR 593
            VD W+LG+  YE+ TG PPY D +  +  + I++ +P R  +  +    K+ +   L  
Sbjct: 193 KVDIWSLGITAYEIATGNPPYCDVEALRAMQLIIKSKPPRLEERNYTPQLKEFIALCLDE 252

Query: 594 DPKRRL 599
           DP+ RL
Sbjct: 253 DPQERL 258

>KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces
           cerevisiae YDR507c GIN4 ser/thr protein kinase, start by
           similarity
          Length = 1112

 Score =  125 bits (315), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 89/298 (29%), Positives = 149/298 (50%), Gaps = 31/298 (10%)

Query: 335 GNGKLNLSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYI 394
           GNG   L  D         ++  ++L   +G GS GKV+    +   +  A+K I KS  
Sbjct: 3   GNGITTLKGD---------TIGPWKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKSIF 53

Query: 395 VSKS---------EVIHTLAERTV--LARVENPFIVPLKFTFQSPDKLYIVLAFINGGEL 443
            ++          +V+    ER +  +  + +P ++ L   +++   LY+VL ++  GEL
Sbjct: 54  NAQGSTMIGGNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETSKDLYMVLEYVEKGEL 113

Query: 444 FYHLQREGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLC 503
           F  L   G    + A  +  +++  +   H L +++RDLKPEN+LLDH+ ++ L DFG+ 
Sbjct: 114 FNLLVERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNVKLADFGMA 173

Query: 504 KLNMKGQDK-TNTFCGTPEYLAPELLLGQGYSKV-VDWWTLGVLLYEMMTGLPPYYDED- 560
            L  K  DK   T CG+P Y APE++ G  Y     D W+ GV+LY ++TG  P+ +ED 
Sbjct: 174 ALESK--DKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDG 231

Query: 561 -VPKMYKKILQEPLRFP--DGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQ 615
            +  +  K+       P  D    +A+DL+  +L+ DP++R+      EI  HP   +
Sbjct: 232 NIRNLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRI---KTREILKHPLLRK 286

>AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W
           (KIN1) - SH] complement(823632..826847) [3216 bp, 1071
           aa]
          Length = 1071

 Score =  125 bits (313), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 97/360 (26%), Positives = 165/360 (45%), Gaps = 51/360 (14%)

Query: 313 TLDFDTASSFRLYNHQWIGLAQGN----GKLNLSVDYKPATNRALSVDDFELLKVIGKGS 368
           T D+   S FR+       +A       GK        P      S+ D++ L+ +G GS
Sbjct: 5   TQDYHVNSQFRMGGSPQAAVAPATPRMMGKAGEEERRMPKPFHRKSLGDWDFLETVGAGS 64

Query: 369 FGKVMQVRKKDTNKVYALKAIR---KSYI-----------VSKSEVI------------- 401
            GKV   + + TN++ A+K +    KS++            ++ E++             
Sbjct: 65  MGKVKLAKHRYTNELCAIKIVNRATKSFMHKQQLQGLPPPATEEELLERRKKLEKEVSRD 124

Query: 402 -HTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARL 460
             T+ E ++   + +P I  L       +  Y++  +++GG+L  ++ + G      AR 
Sbjct: 125 KRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYIIQHGSLRERHARK 184

Query: 461 YTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTP 520
           +   +  AL+ LH  ++++RDLK ENI++   G I + DFGL  +    + + +TFCG+ 
Sbjct: 185 FARGIASALQYLHLNNIVHRDLKIENIMISSSGEIRIIDFGLSNM-YDPKKQLHTFCGSL 243

Query: 521 EYLAPELLLGQGYS-KVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGF 579
            + APELL    Y+   VD W+ GV+LY ++ G  P+ DE+   +++KI Q  + +P   
Sbjct: 244 YFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENASVLHEKIKQGKVEYPQHL 303

Query: 580 DKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKRLWM-KGY-IPP--YKPPVM 635
             D   LL  +L  DP +R       ++  H           WM KGY  PP  Y PP +
Sbjct: 304 SIDVISLLSKMLVVDPYKRATLK---QVVHH----------QWMQKGYDFPPPSYLPPCV 350

>Scas_493.2
          Length = 1117

 Score =  124 bits (312), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 85/282 (30%), Positives = 145/282 (51%), Gaps = 25/282 (8%)

Query: 354 SVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSK------SEVIHT---- 403
           ++  ++L + +G GS GKV     + TN+  A+K I KS   +K      S V +T    
Sbjct: 18  TIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDSL 77

Query: 404 ----LAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRAR 459
                 E  ++  + +  ++ L   +++   LY++L +   GELF  L  +G      A 
Sbjct: 78  PYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAV 137

Query: 460 LYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDK-TNTFCG 518
            +  +++  +   H L +++RDLKPEN+LLDH+ +I + DFG+  L  + +DK   T CG
Sbjct: 138 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL--ETEDKLLETSCG 195

Query: 519 TPEYLAPELLLGQGYSKV-VDWWTLGVLLYEMMTGLPPYYDED--VPKMYKKILQEPLRF 575
           +P Y APE++ G  Y     D W+ GV+L+ ++TG  P+ +ED  +  +  K+       
Sbjct: 196 SPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEM 255

Query: 576 PDG--FDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQ 615
           PD     +DA+DL+  +L+ DP +R+      EI  HP   +
Sbjct: 256 PDDDEMSRDAQDLISRILTVDPTKRI---KTREILKHPLLQK 294

>Scas_201.1*
          Length = 274

 Score =  117 bits (293), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 72/218 (33%), Positives = 120/218 (55%), Gaps = 6/218 (2%)

Query: 368 SFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLA-ERTVLARVENPFIVPLKFTFQ 426
           +FG V Q R+  + +  A+K + K+ +      +  L  E ++L R+ +P IV  K  F+
Sbjct: 45  TFGVVRQARQFFSQEAVAVKILLKNALKGNDVQLQMLYDELSILQRLHHPNIVAFKDWFE 104

Query: 427 SPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPEN 486
           S DK YIV     GGELF  + ++G+F+   A     +LL A++ +H+ ++++RDLKPEN
Sbjct: 105 SRDKFYIVTQLATGGELFDRIIKKGKFTEVDAVNIMVQLLDAVKYIHSQNIVHRDLKPEN 164

Query: 487 IL-LD--HQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLG 543
           +L LD   +  + + DFG+ K      D      G+  Y+APE+L  +G+ K  D W+LG
Sbjct: 165 VLYLDPSDESQLVIADFGIAKELKSNDDLIFKGAGSLGYVAPEVLTKEGHGKPCDIWSLG 224

Query: 544 VLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDK 581
           V+ Y +++G  P+  E V    ++  +   R+P  F K
Sbjct: 225 VITYTLLSGYSPFIAESVEGFLEECTRS--RYPVQFHK 260

>ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -
           SH] complement(560761..563556) [2796 bp, 931 aa]
          Length = 931

 Score =  124 bits (310), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 86/274 (31%), Positives = 139/274 (50%), Gaps = 18/274 (6%)

Query: 363 VIGKGSFGKVM----QVRKKDTNKVYALKAIRKSYIVSKSEV-IHTLAERTVLARVENPF 417
            +G+G FGKV     + R    ++  A+K IR+  +   SE  I    E   L  + +P 
Sbjct: 50  TLGEGEFGKVKLGWSKARLDGDSRNVAIKLIRRDTVPKNSEKEIKIYRELNALKLLSHPN 109

Query: 418 IVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLDV 477
           IV L+   Q+   + IVL + +GGE + ++Q++ R     A    A+L+  +  +H   +
Sbjct: 110 IVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPPACRLFAQLISGVHYIHYKGL 169

Query: 478 IYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLL-GQGYS-K 535
            +RDLK EN+LLD   ++ + DFG      K  D   T CG+P Y APEL++  + YS +
Sbjct: 170 AHRDLKLENLLLDEHENLIITDFGFVNEFHK-NDLMRTSCGSPCYAAPELVVSSKPYSAQ 228

Query: 536 VVDWWTLGVLLYEMMTGLPPYYD-------EDVPKMYKKILQEPLRFPDGFDKDAKDLLI 588
             D W+ GV+LY M+ G  P+ D       ED+ K+Y+ I    L+FP+      +DLL 
Sbjct: 229 KADVWSCGVILYAMLAGYLPWDDDPENPEGEDIAKLYQYITHTSLKFPEYIKPIPRDLLK 288

Query: 589 GLLSRDPKRRLGFNGADEIKSHPFFSQLSWKRLW 622
            +L  +P+ RL      +I+ H +    +   +W
Sbjct: 289 RILVSNPEVRLTV---ADIEQHAWLQPHAQFLMW 319

>KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062
           Saccharomyces cerevisiae YPL141c, start by similarity
          Length = 909

 Score =  123 bits (309), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 79/262 (30%), Positives = 133/262 (50%), Gaps = 13/262 (4%)

Query: 351 RALSVDDFELLKVIGKGSFGKVM---QVRKKDTNKVYALKAIRKSYIVSKSEV-IHTLAE 406
           R ++   + +   +G+G FGKV         D +K  A+K IR+  I   SE  +    E
Sbjct: 49  RQVTFGPYIIGPTLGEGEFGKVKLGWSKSNSDESKNVAIKLIRRDTIPKNSEKEVKIYRE 108

Query: 407 RTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELL 466
              L  + +P IV L+   Q+   + IVL + +GGE + ++Q++ R     A    A+L+
Sbjct: 109 INALKHLAHPNIVTLEEVLQNSKYIGIVLHYASGGEFYKYIQKKRRLKEPAACRLFAQLI 168

Query: 467 CALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPE 526
             +  +H+  + +RDLK EN+LLD   ++ + DFG         D   T CG+P Y APE
Sbjct: 169 SGVHYMHHKGLAHRDLKLENLLLDEHENLIITDFGFVNEFSSRNDLMKTSCGSPCYAAPE 228

Query: 527 LLL-GQGY-SKVVDWWTLGVLLYEMMTG-------LPPYYDEDVPKMYKKILQEPLRFPD 577
           L++  + Y ++  D W+ GV+LY M+ G             +D+ K+Y  I +  L+FP+
Sbjct: 229 LVVTTKAYEARKADVWSCGVILYAMLAGYLPWDDDPDNPDGDDIAKLYNYITKTSLKFPE 288

Query: 578 GFDKDAKDLLIGLLSRDPKRRL 599
             +   +D+L  +L  DP +R+
Sbjct: 289 YINPIPRDILRRILVSDPSKRI 310

>Kwal_23.3590
          Length = 499

 Score =  121 bits (303), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 98/334 (29%), Positives = 150/334 (44%), Gaps = 42/334 (12%)

Query: 346 KPATNRALSV-DDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTL 404
           +P  NR  S  D +   K +G G +  V +   KD+  V A+K     +   + +     
Sbjct: 173 RPLANRRPSFFDRYIAGKELGSGHYAIVKEAIDKDSGDVVAVKIFHAQHNDDQKKTKQFR 232

Query: 405 AERTVLARVENPFIVPLKFTFQSPD-----KLYIVLAFINGGELFYHLQREGRFSLSRAR 459
            E  +L  +++  IV L   F  P      + ++VL  ++ GELF  + R+ R       
Sbjct: 233 EETKILMSIQHKNIVKLIDRFVEPVSKAQIQTFLVLEKVSDGELFDRIVRKTRLREDETN 292

Query: 460 LYTAELLCALETLHNLDVIYRDLKPENILL--------DHQG-----------HIALCDF 500
               ++L  L  LH  ++I+RD+KPENILL        D Q             I + DF
Sbjct: 293 AIFKQILNGLRYLHAKNIIHRDIKPENILLSIRKRRHSDEQQLGPWDDDEIDITIKIADF 352

Query: 501 GLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDED 560
           GL K   + Q  TNT CGTP Y+APE+L   GY+  VD W+ GVLLY  + G PP+ ++ 
Sbjct: 353 GLAKFIGEMQ-FTNTLCGTPSYVAPEVLTKTGYTSRVDMWSAGVLLYVCLCGFPPFSEQL 411

Query: 561 V-PKMYKKILQEPLRFP----DGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQ 615
             P M ++IL     F     D  D     L+  LL  +P  R       +  +HP+FS 
Sbjct: 412 APPSMKEQILNGKFAFYSPYWDDIDDSCLHLISNLLVVNPAYRF---DVQKTINHPWFSN 468

Query: 616 LSWKRLWMKGYIPPYKPPVMNSLDTSNFDQEFTK 649
              +        P  K P+ +S+D     + +++
Sbjct: 469 TIPE--------PDTKIPLRHSVDVQRVPRTYSE 494

>Scas_700.28
          Length = 896

 Score =  123 bits (308), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 83/261 (31%), Positives = 133/261 (50%), Gaps = 13/261 (4%)

Query: 355 VDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVE 414
           V ++++L  IG+GSFGKV   + + T+    LK+  K+      EV +         + +
Sbjct: 35  VGNYKILDQIGEGSFGKVYLAQHRPTHTKVVLKSSDKNDPNIVREVFYH-------RQFD 87

Query: 415 NPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHN 474
            P+I  L     +  K+++ L +  G EL+  +    R          A+++  +   H+
Sbjct: 88  YPYITKLYEVIITETKVWMALEYCPGKELYDRVLSMHRVPTDECVQLFAQIVGGVHYAHS 147

Query: 475 LDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYS 534
           L+ ++RDLK ENILLD  G   L DFG  +  M  +    T CGT  Y+APEL+  + Y 
Sbjct: 148 LNCVHRDLKLENILLDKSGDAKLTDFGFTRECM-TKTTLETICGTTVYMAPELIERKSYD 206

Query: 535 KV-VDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKIL-QEPLRFPDGFDKDAKDLLIGLLS 592
              +D W+LGV+LY M+ G  P+ ++D  K   KI+ Q P    +    DAKDL++ LL+
Sbjct: 207 GFKIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQLNENIVTADAKDLILRLLA 266

Query: 593 RDPKRRLGFNGADEIKSHPFF 613
           ++P  R      ++I  HPF 
Sbjct: 267 KNPNDRP---TVEQILKHPFL 284

>Scas_640.14*
          Length = 728

 Score =  122 bits (306), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 82/272 (30%), Positives = 138/272 (50%), Gaps = 23/272 (8%)

Query: 363 VIGKGSFGKV---------MQVRKKDTNKVYALKAIRKSYIVSKSEV-IHTLAERTVLAR 412
            +G+G FGKV            +  + +K  A+K IR+ +I   SE  +    E   L  
Sbjct: 43  TLGEGEFGKVKMGWSTTSSSSGKITEDSKQVAIKLIRRDFIKKGSEKEMKIFREINSLKH 102

Query: 413 VENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETL 472
           + +P IV L+   Q+   + IVL + +GGE + ++QR+ R   + A    A+L+  +  +
Sbjct: 103 LTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRKRRLKEATACRLFAQLISGVSYM 162

Query: 473 HNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLL-GQ 531
           H+  +++RDLK EN+LLD   ++ + DFG         +   T CG+P Y APEL++  +
Sbjct: 163 HSKGIVHRDLKLENLLLDKHENLIITDFGFVNEFYADNELMKTSCGSPCYAAPELVITTE 222

Query: 532 GY-SKVVDWWTLGVLLYEMMTGLPPYYD-------EDVPKMYKKILQEPLRFPD-GFDKD 582
            Y ++  D W+ G++LY M+ G  P+ D       ED+ ++Y  I + PL+FP   +   
Sbjct: 223 PYKARKADIWSCGIILYGMLAGYLPWDDDKQNPNGEDIVRLYHYITKTPLKFPRIHYTTF 282

Query: 583 AKDLLIGLLSRDPKRRLGFNGADEIKSHPFFS 614
               L  +L  +P RR+    +  IK H + S
Sbjct: 283 LGICLRHILVSNPVRRM---SSRHIKKHEWLS 311

>CAGL0K10604g complement(1029226..1030566) similar to sp|P27466
           Saccharomyces cerevisiae YFR014c CMK1
           Ca2+/calmodulin-dependent ser/thr protein kinase type I,
           hypothetical start
          Length = 446

 Score =  120 bits (300), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 129/246 (52%), Gaps = 9/246 (3%)

Query: 362 KVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPFIVPL 421
           + +G GSFG V + ++  +++  A+K + K  +     +     E  ++  +++P IV  
Sbjct: 69  RTLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKNGGLEPIYDELNIIQHLDHPNIVKF 128

Query: 422 KFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLDVIYRD 481
           K  F++  K YIV    +GGELF  +  +G+++   A     ++L A+E LH+ ++I+RD
Sbjct: 129 KDWFETESKFYIVTQLASGGELFDRIMHDGKYTEEDAVNIVVQILKAVEYLHSQNIIHRD 188

Query: 482 LKPENIL-LDHQ--GHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVD 538
           LKPEN+L LD      I L DFG+ +      D      G+  Y+APE+    G+ K  D
Sbjct: 189 LKPENLLYLDKSKDSRIVLADFGIARQLENDDDVIYRPAGSLGYVAPEVFTSDGHGKPSD 248

Query: 539 WWTLGVLLYEMMTGLPPYYDEDVPKMYKKIL--QEPLRFP----DGFDKDAKDLLIGLLS 592
            W++GV+ Y ++ G  P+  E V     ++   + P++F     DG  + AK+ ++ +L 
Sbjct: 249 IWSVGVITYTLLCGYSPFKAESVDGFLDEVTSDENPVKFQRPYWDGISELAKNFILRILD 308

Query: 593 RDPKRR 598
            DP  R
Sbjct: 309 LDPACR 314

>KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase, start by
           similarity
          Length = 1104

 Score =  123 bits (308), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 89/337 (26%), Positives = 156/337 (46%), Gaps = 44/337 (13%)

Query: 354 SVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIR---KSYIVSKSEVIHTLAERTVL 410
           S+ D++ L+ +G GS GKV   + + TN+V A+K +    KSY+  ++++     E  ++
Sbjct: 94  SLGDWDFLETVGAGSMGKVKLAKHRLTNEVCAIKIVNRAAKSYMHKQNQLPPPKTEEELM 153

Query: 411 ARVE-----------------------NPFIVPLKFTFQSPDKLYIVLAFINGGELFYHL 447
            R +                       +P I  L       +  Y++  +++GG+L  ++
Sbjct: 154 ERKKKLEKELSRDRRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 213

Query: 448 QREGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNM 507
            + G      AR +   +  AL+ LH  ++++RDLK ENI++   G I + DFGL  L  
Sbjct: 214 IQHGSLRERHARKFVRGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDFGLSNL-Y 272

Query: 508 KGQDKTNTFCGTPEYLAPELLLGQGY-SKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYK 566
             + + +TFCG+  + APELL    Y    VD W+ GV++Y ++ G  P+ DE+   +++
Sbjct: 273 DNKKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVIYVLVCGKVPFDDENASVLHE 332

Query: 567 KILQEPLRFPDGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKRLWMK-- 624
           KI +  + +P     +   LL  +L  DP +R       ++ +H           WM+  
Sbjct: 333 KIKKGKVEYPQHLSIECISLLSKMLVVDPLKRASLK---QVCNH----------QWMQRG 379

Query: 625 -GYIPPYKPPVMNSLDTSNFDQEFTKELPVDSVVNDF 660
             + PP   P    L     D    KE+    +VND 
Sbjct: 380 FDFPPPSYIPHRVPLTVEMLDVNVIKEMHRLELVNDV 416

>CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces
           cerevisiae YDR122w KIN1 or sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2, hypothetical start
          Length = 944

 Score =  122 bits (305), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 85/301 (28%), Positives = 144/301 (47%), Gaps = 30/301 (9%)

Query: 326 NHQWIGLAQGNGKLNLSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYA 385
           N +  G      +   S   +P      S+  ++ ++ +G GS GKV   + K++N+V A
Sbjct: 35  NTEQTGAQIDTAREKHSKSSQPRVFHRKSLSGWDFMETVGAGSMGKVKLAKNKNSNEVCA 94

Query: 386 LKAIR---KSYIVSKSEV-----------------------IHTLAERTVLARVENPFIV 419
           +K +    K+Y+    ++                         T+ E ++   + +P + 
Sbjct: 95  IKIVHRATKAYMHKAQQLPPPADENEAKERQKRLNKEISRDKRTVREASLGQILFHPNVC 154

Query: 420 PLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLDVIY 479
            L       +  Y+   FI+GG+L  ++ + G    + AR  +  +L AL+ LH  ++++
Sbjct: 155 KLYEMQTLSNHYYMFFEFISGGQLLDYIIQHGSLKENHARKVSRGILSALQYLHANNIVH 214

Query: 480 RDLKPENILLDHQGHIALCDFGLCKLNMKGQDKT-NTFCGTPEYLAPELLLGQGY-SKVV 537
           RDLK ENI+L   G I L DFGL   NM    K+  TFCG+  + APELL    Y    V
Sbjct: 215 RDLKIENIMLSKTGEIKLIDFGLS--NMYDPRKSLQTFCGSLYFAAPELLKAHPYLGPEV 272

Query: 538 DWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGLLSRDPKR 597
           D W+ GV+LY ++ G  P+ DE+   +++KI +  + +P     D   LL  +L  DP++
Sbjct: 273 DVWSFGVVLYVLVCGKVPFDDENSSALHEKIKKGKVTYPQFLSIDVISLLSKILVVDPQK 332

Query: 598 R 598
           R
Sbjct: 333 R 333

>Scas_613.5
          Length = 517

 Score =  120 bits (300), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 88/288 (30%), Positives = 137/288 (47%), Gaps = 33/288 (11%)

Query: 356 DDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVEN 415
           D + L K +G G +  V +   K T +  A+K         + +      E  +L R+ +
Sbjct: 202 DKYVLGKDLGSGHYATVKEGINKVTGQTVAVKIFHPQQNDDEKKSKQFREETNILMRIHH 261

Query: 416 PFIVPLKFTFQSPD-----KLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALE 470
           P IV L   F  P      + Y+VL  I+ GELF  + ++        +    ++L  L+
Sbjct: 262 PNIVNLLDFFIEPVSKSQIQKYLVLDKIDDGELFERIVKKTCLRQDETKAIFNQILMGLK 321

Query: 471 TLHNLDVIYRDLKPENILLDHQG-------------------HIALCDFGLCKLNMKGQD 511
            LH  ++I+RD+KPENILL+                       + + DFGL K   + Q 
Sbjct: 322 HLHQQNIIHRDIKPENILLNITRRTNPEQKQLGPWDEDEIDIQVKIADFGLAKFTGEMQ- 380

Query: 512 KTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDE-DVPKMYKKILQ 570
            TNT CGTP Y+APE+L  +GY+  VD W+ GV+LY  + G PP+ ++   P + ++ILQ
Sbjct: 381 FTNTLCGTPSYVAPEVLTKKGYTSKVDMWSAGVILYVCLCGFPPFSEQLGPPSLKEQILQ 440

Query: 571 EPLRFP----DGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFS 614
               F     D  D +   L+  LL  D   R  ++  D I +HP+F+
Sbjct: 441 AKFAFYTPYWDNIDDNVLHLISHLLVLDADAR--YSVEDTI-NHPWFN 485

>CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase,
           hypothetical start
          Length = 1192

 Score =  121 bits (304), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 85/310 (27%), Positives = 145/310 (46%), Gaps = 45/310 (14%)

Query: 354 SVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSY------------------IV 395
           S+ D++ L+ +G GS GKV   + + T +V A+K + ++                   I+
Sbjct: 104 SLGDWDFLETVGAGSMGKVKLAKHRRTGEVCAIKIVNRATKAFLHKEQNSPPPVNNQEIM 163

Query: 396 SKSEVIHTLAERTVLARVE--------NPFIVPLKFTFQSPDKLYIVLAFINGGELFYHL 447
            + + +     R   A  E        +P I  L       +  Y++  ++ GG+L  ++
Sbjct: 164 ERQKKLEKEISRDKRAIREASLGQIFYHPHICRLFEMCTMSNHFYMLFEYVAGGQLLDYI 223

Query: 448 QREGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNM 507
            + G      AR +   +  AL+ LH  ++++RDLK ENI++ + G I + DFGL  +  
Sbjct: 224 IQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLSNV-Y 282

Query: 508 KGQDKTNTFCGTPEYLAPELLLGQGYS-KVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYK 566
             + + +TFCG+  + APELL    Y+   VD W+ GV+LY ++ G  P+ DE+   +++
Sbjct: 283 DTRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSVLHE 342

Query: 567 KILQEPLRFPDGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKRLWM-KG 625
           KI +  + +P     +   LL  +L  DP RR       ++  HP          WM KG
Sbjct: 343 KIKRGKVEYPQHLSIEVMSLLSKMLVVDPSRRASLK---QVVEHP----------WMTKG 389

Query: 626 Y---IPPYKP 632
           Y    P Y P
Sbjct: 390 YDTPAPSYVP 399

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score =  121 bits (303), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 87/268 (32%), Positives = 138/268 (51%), Gaps = 27/268 (10%)

Query: 355 VDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVE 414
           V ++++ K IG+GSFGKV     + T +   LK   KS      EV +         + +
Sbjct: 39  VGNYKIQKQIGEGSFGKVYLATHRPTKQKVVLKTGDKSDPNVVREVFYH-------RQFD 91

Query: 415 NPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRF-SLSRARLYTAELLCALETLH 473
            P+I  L     +  K+++ L +  G EL+ HL  + R  +L  A L+ A++  A+   H
Sbjct: 92  YPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSKSRLPTLECAELF-AQITGAVHYAH 150

Query: 474 NLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGY 533
            L+ ++RDLK EN+LLD  G+  L DFG  + +M  +    T CGT  Y+APE++  + Y
Sbjct: 151 TLNCVHRDLKLENVLLDKNGNAKLTDFGFTRESMT-KAVLETVCGTTVYMAPEMIQHKPY 209

Query: 534 SKV-VDWWTLGVLLYEMMTGLPPYYDEDVPKMYKK-------ILQEPLRFPDGFDKDAKD 585
               VD W+LGV+LY ++ G  P +DED   + K+       ++ E +  P     +A++
Sbjct: 210 DGFKVDIWSLGVILYTLLCGCLP-FDEDDDLLTKQKIINDTPVIDERITIP-----EAQN 263

Query: 586 LLIGLLSRDPKRRLGFNGADEIKSHPFF 613
           L+  LLS+DP  R   +    I  HPF 
Sbjct: 264 LIEQLLSKDPTERPNTSA---ILLHPFL 288

>ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH]
           (157357..160200) [2844 bp, 947 aa]
          Length = 947

 Score =  120 bits (302), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 77/245 (31%), Positives = 126/245 (51%), Gaps = 7/245 (2%)

Query: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVEN-P 416
           F+  +VIG+G FG V +     T +VYA+K +  +    + EV     E   LA ++  P
Sbjct: 25  FKRTEVIGRGKFGVVYKAYHAKTKQVYAVKVL--NLDCPEDEVEDVQKEIQFLASLKQVP 82

Query: 417 FIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLD 476
            I     ++    KL++++ +  GG L   L R G+       +   +LL AL  +H  +
Sbjct: 83  NITRYYGSYLYDTKLWVIMEYCAGGSLRT-LLRPGKIDEKYLGVIVRKLLIALVYIHKDN 141

Query: 477 VIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLL-GQGYSK 535
           VI+RD+K  N+L+ ++GH+ LCDFG+         K  T  GTP ++APE+++ G  Y+ 
Sbjct: 142 VIHRDIKAANVLITNEGHVKLCDFGVAAQLTAANHKRQTMAGTPYWMAPEVIMEGVYYNT 201

Query: 536 VVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQ-EPLRFPD-GFDKDAKDLLIGLLSR 593
             D W+LG+  YE+ TG PPY D +  +  + I + +P R     +    K+ +   L  
Sbjct: 202 KADIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRNYSPLLKEFIALCLDE 261

Query: 594 DPKRR 598
           DP+ R
Sbjct: 262 DPEER 266

>Kwal_26.8751
          Length = 848

 Score =  120 bits (301), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 86/295 (29%), Positives = 140/295 (47%), Gaps = 18/295 (6%)

Query: 334 QGNGKLNLSVDYKP-----ATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKA 388
           Q   K N+S  Y       + N    V ++++LK++G+GSFGKV       T++   LK 
Sbjct: 8   QNQLKANISASYNKLYGQFSLNELQEVGNYKILKIVGEGSFGKVYLASHCLTHQKVVLKM 67

Query: 389 IRKSYIVSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQ 448
             K+      EV +         + +   I  L     + + +++ L +  G EL+ +L 
Sbjct: 68  GSKNDPNVVREVFYH-------RQFDYSHITKLYEVIVTENYVWMALEYCPGKELYEYLL 120

Query: 449 REGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMK 508
            +    L       ++++ A+   H++  ++RDLK ENILLD +GH  L DFG  +    
Sbjct: 121 AKKHIPLEECSELFSQIVGAVYYAHSMKCVHRDLKLENILLDKKGHAKLTDFGFTR-ECA 179

Query: 509 GQDKTNTFCGTPEYLAPELLLGQGYSKV-VDWWTLGVLLYEMMTGLPPYYDED-VPKMYK 566
            +    T CGT  Y+APEL+  + Y    +D W+LG++LY M+ G  P+ + D V   YK
Sbjct: 180 TKGILETICGTTVYMAPELIERKPYEGYKIDTWSLGIILYTMIHGTMPFDEVDEVKTKYK 239

Query: 567 KILQEPLRFPDGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKRL 621
            +   P    D  D + K+L+  LL +DP +R       ++  HPF      K L
Sbjct: 240 IVHYNPTYDNDYIDSNGKELISQLLEKDPNQRPSLT---QVLQHPFLQPYGLKIL 291

>YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine protein
           kinase, related to Kin2p and S. pombe KIN1 [3195 bp,
           1064 aa]
          Length = 1064

 Score =  120 bits (301), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 81/290 (27%), Positives = 140/290 (48%), Gaps = 41/290 (14%)

Query: 354 SVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIR---KSYIVSKSEVIHTLAERTVL 410
           S+ D+E ++ +G GS GKV   + + TN+V A+K +    K+++  +  +     E+ VL
Sbjct: 116 SLGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVL 175

Query: 411 ARVE-----------------------NPFIVPLKFTFQSPDKLYIVLAFINGGELFYHL 447
            R +                       +P I  L       +  Y++  +++GG+L  ++
Sbjct: 176 ERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYI 235

Query: 448 QREGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNM 507
            + G     +AR +   +  AL  LH  ++++RDLK ENI++     I + DFGL  +  
Sbjct: 236 IQHGSIREHQARKFARGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNI-Y 294

Query: 508 KGQDKTNTFCGTPEYLAPELLLGQGYS-KVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYK 566
             + + +TFCG+  + APELL    Y+   VD W+ GV+L+ ++ G  P+ DE+   +++
Sbjct: 295 DSRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSVLHE 354

Query: 567 KILQEPLRFPDGFDKDAKDLLIGLLSRDPKRRL-------------GFNG 603
           KI Q  + +P     +   LL  +L  DPKRR              GFNG
Sbjct: 355 KIKQGKVEYPQHLSIEVISLLSKMLVVDPKRRATLKQVVEHHWMVRGFNG 404

>Scas_707.36
          Length = 915

 Score =  120 bits (300), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 92/328 (28%), Positives = 153/328 (46%), Gaps = 62/328 (18%)

Query: 341 LSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAI----RKSYIV- 395
           +S+ Y P +   + ++ +E++K +G G  GKV   +    N++ A+K +    +K+Y   
Sbjct: 77  ISLSYDPVSKTQI-LNHYEIVKELGNGQHGKVKLAKDIRANQLVAIKMVNRYEKKTYFAG 135

Query: 396 -SKSEVIHTLAERTVLARVENPFIVPLKFTFQ--SPDKLYIVLAFINGGELFY----HLQ 448
             +++      E  ++ +  N  +V L       S  K+Y+VL +   G + +     L+
Sbjct: 136 PKRNDPNKIKKEIAIMKKCNNKHVVKLIEILDDLSSRKIYLVLEYCEKGPILWCPRDQLE 195

Query: 449 REGR----FSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCK 504
            + R     S  RAR    +++  LE LH+  +I+RD+KP N+L+D  G + + DFG+  
Sbjct: 196 IDSRGPPQLSFQRAREIFRDVILGLEYLHSQGIIHRDIKPANLLMDKNGVVKISDFGVS- 254

Query: 505 LNMKGQDKTN-------TFCGTPEYLAPELLLGQG-----------------YSKVVDWW 540
           L   G   TN          GTP + APE+ LG                    S  +D W
Sbjct: 255 LAANGNIDTNDDELELTKTVGTPVFYAPEICLGAAAMERFNLDKDELFNGSCISFKIDIW 314

Query: 541 TLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDK----------------DAK 584
            LG+ LY ++ G+ P+  E   K+++KI+ E LRFP  F+                  AK
Sbjct: 315 ALGITLYCLLFGMLPFVSEFELKLFEKIVNEKLRFP-TFETLQDNHISEISHIREFVHAK 373

Query: 585 DLLIGLLSRDPKRRLGFNGADEIKSHPF 612
           DLL  LL ++P +R+      +IK HPF
Sbjct: 374 DLLNKLLEKNPAKRISI---PDIKVHPF 398

>CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 1682

 Score =  119 bits (298), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 98/152 (64%), Gaps = 1/152 (0%)

Query: 354 SVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVL-AR 412
           S+ D++++K I KG++G V   RKK T   +A+K +RKS +++K++V +  +ER ++  +
Sbjct: 778 SIKDYDIIKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMVQ 837

Query: 413 VENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETL 472
            + P++  L  TFQ+ D L++V+ ++ GG+L   L+  G       + Y +E++  +E +
Sbjct: 838 SDKPYVARLYATFQNKDNLFLVMEYLPGGDLATLLKMMGCLPDEWVKQYLSEIIIGVEDM 897

Query: 473 HNLDVIYRDLKPENILLDHQGHIALCDFGLCK 504
           HN  +I+ DLKPEN+L+D  GH+ L DFGL +
Sbjct: 898 HNNGIIHHDLKPENLLIDVSGHLKLTDFGLSR 929

 Score =  110 bits (275), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 86/146 (58%), Gaps = 17/146 (11%)

Query: 510  QDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKIL 569
            QDK   F GTP+YLAPE + G G     DWW++G +L+EM+ G PP++ E   ++++ IL
Sbjct: 1099 QDKR--FFGTPDYLAPETIEGTGEDNQCDWWSVGCILFEMVFGYPPFHAETPDQVFRNIL 1156

Query: 570  QEPLRFP--DGFDK-------DAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKR 620
            +  + +P  D  ++       +AKDL++  L  DP +RLG+NG +EIK+HP+F  + W  
Sbjct: 1157 EGKIDWPIFDSIEEEREYISPEAKDLIMKFLITDPHKRLGYNGTEEIKNHPYFKDVKWDH 1216

Query: 621  LW--MKGYIPPYKPPVMNSLDTSNFD 644
            ++     Y+P  + P     DT  FD
Sbjct: 1217 VYDETASYVPNIEDPE----DTDYFD 1238

>AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH]
           (1044971..1047679) [2709 bp, 902 aa]
          Length = 902

 Score =  118 bits (296), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 71/216 (32%), Positives = 120/216 (55%), Gaps = 7/216 (3%)

Query: 343 VDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIH 402
           V+  PA         + L +VIGKG++G V +   + T++V A+KAI         E + 
Sbjct: 4   VNVTPAQRHTGQRKHYALKQVIGKGAYGVVYKAVNRATDQVIAIKAIEYENEEELHEHML 63

Query: 403 TLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYT 462
            +    +L  +++  IV      QS  +LYI+L +   G L   +++E   S ++A+ Y 
Sbjct: 64  EI---DLLKNLKHENIVKYHGFIQSSHELYILLEYCIRGSLRDLIKKEA-LSEAKAKTYV 119

Query: 463 AELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEY 522
            + L  L+ LH+  VI+RD+K  N+LL   G + L DFG+   + +  +   T+ G+P +
Sbjct: 120 RQTLRGLQYLHDQGVIHRDIKAANLLLTENGVVKLADFGV---STRVNNMAMTYAGSPNW 176

Query: 523 LAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYD 558
           +APE++LG+G S V D W+LG  + E++TG PP+Y+
Sbjct: 177 MAPEVMLGKGASTVSDIWSLGATVVELLTGNPPFYN 212

>AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..90211)
           [1419 bp, 472 aa]
          Length = 472

 Score =  115 bits (289), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 88/289 (30%), Positives = 134/289 (46%), Gaps = 39/289 (13%)

Query: 350 NRALSV-DDFELLKVIGKGSFGKVMQVRKKDTNKVYALK---------AIRKSYIVSKSE 399
           NR +S  D +   K +G G +  V +   K T +  A+K         A +      +++
Sbjct: 146 NRGVSFFDRYIPGKELGSGHYAIVKEAINKITGQSVAVKIFHPQKNDDAKKTRQFREETK 205

Query: 400 VIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRAR 459
           ++  L    ++  +E  F+ PL    +S  + Y+VL  I  GELF  + R+ +      R
Sbjct: 206 ILMGLNHENIVKLLER-FVEPLS---KSQVQTYLVLEKIQDGELFDKIVRKTKLHQDETR 261

Query: 460 LYTAELLCALETLHNLDVIYRDLKPENILLDHQGH-------------------IALCDF 500
               ++L  L+ LH+ ++I+RD+KPENILL  +                     + + DF
Sbjct: 262 ALFKQILAGLKYLHDRNIIHRDIKPENILLSIRRRTSPDQVQLGPWDEDELDITVKIADF 321

Query: 501 GLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDED 560
           GL K   + Q  T T CGTP Y+A E+L   GY+  VD W+ GVLLY  + G PP+ D+ 
Sbjct: 322 GLAKFTGEMQ-FTTTLCGTPSYVAAEVLTKTGYTSKVDLWSAGVLLYVCLCGFPPFSDQL 380

Query: 561 V-PKMYKKILQEPLRFP----DGFDKDAKDLLIGLLSRDPKRRLGFNGA 604
             P M ++ILQ    F     D  D     L+  LL  DP +R     A
Sbjct: 381 APPSMKEQILQGKFAFYSPYWDEIDDSVLHLISNLLVVDPAKRYSVRDA 429

>YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protein
           kinase involved in septin organization and cell cycle
           control [3114 bp, 1037 aa]
          Length = 1037

 Score =  117 bits (294), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 81/281 (28%), Positives = 142/281 (50%), Gaps = 17/281 (6%)

Query: 348 ATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYI------VSKSEVI 401
           A   + ++  ++L + +G GS GKV   + + T    A+K I KS         +   V+
Sbjct: 11  AAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVL 70

Query: 402 HTLAER--TVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRAR 459
               ER   ++  + +P ++ L   +++ + LY++L +   GELF  L   G      A 
Sbjct: 71  PYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAI 130

Query: 460 LYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGT 519
               +++  +   H L +++RDLKPEN+LLD   +I + DFG+  L     D   T CG+
Sbjct: 131 NCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDA-DLLETSCGS 189

Query: 520 PEYLAPELLLGQGYSKVV-DWWTLGVLLYEMMTGLPPYYDE--DVPKMYKKILQEPLRFP 576
           P Y APE++ G  Y     D W+ GV+L+ ++TG  P+ +E  +V  +  K+ +     P
Sbjct: 190 PHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP 249

Query: 577 DGFD--KDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQ 615
           +  +  +DA+DL+  +L  DP++R+      +I SHP   +
Sbjct: 250 NDTEISRDAQDLIGKILVVDPRQRIKIR---DILSHPLLKK 287

>Scas_580.6
          Length = 1015

 Score =  117 bits (293), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 79/260 (30%), Positives = 131/260 (50%), Gaps = 10/260 (3%)

Query: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVEN-P 416
           F   +VIG+G FG V +     T ++YA+K +  +    + EV     E   L+ ++  P
Sbjct: 37  FRRTEVIGRGKFGIVYKGYHVRTKQIYAIKVL--NLDSDEDEVEDVQREVQFLSSLKQIP 94

Query: 417 FIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLD 476
            I     ++     L+I++ +  GG L   L R G+       +   ELL AL+ +H  +
Sbjct: 95  NITRYYGSYLKDTSLWIIMEYCAGGSL-RSLLRPGKIDEKYIGVIMRELLVALKYIHKDN 153

Query: 477 VIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLL-GQGYSK 535
           VI+RD+K  N+L+ ++G + LCDFG+     +   +  T  GTP ++APE+++ G  Y  
Sbjct: 154 VIHRDIKAANVLITNEGSVKLCDFGVAAQLNQSTLRRQTMAGTPYWMAPEVIMEGVYYDT 213

Query: 536 VVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQ-EPLRFPD-GFDKDAKDLLIGLLSR 593
            VD W+LG+  YE+ TG PPY + +  +  + I + +P R     +    K+ +   L  
Sbjct: 214 KVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLESRSYTPLLKEFIALCLDE 273

Query: 594 DPKRRLGFNGADEIKSHPFF 613
           DPK RL    A+E+    F 
Sbjct: 274 DPKERL---SAEELSKTKFI 290

>Kwal_55.21545
          Length = 865

 Score =  116 bits (291), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 78/245 (31%), Positives = 127/245 (51%), Gaps = 7/245 (2%)

Query: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVEN-P 416
           F+  +VIG+G FG V +     T +V A+K +  +   +  EV     E   L+ ++  P
Sbjct: 19  FKRTEVIGRGKFGVVYKGYYTKTKQVCAIKVL--NLDSADDEVEDVQKEIQFLSSLKQVP 76

Query: 417 FIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLD 476
            I     ++ +  KL++++ +  GG L   L R G+       +   ELL AL  +H   
Sbjct: 77  NITHYYGSYLNDTKLWVIMEYCAGGSL-RTLLRPGKIGEQYIGVIMRELLTALMHIHKDG 135

Query: 477 VIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLL-GQGYSK 535
           VI+RD+K  N+L+ + GHI LCDFG+     + + +  T  GTP ++APE+++ G  Y  
Sbjct: 136 VIHRDIKAANVLITNDGHIKLCDFGVAAQLSQTKIRRQTMAGTPYWMAPEVIMEGVYYDT 195

Query: 536 VVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQ-EPLRFPDGFDKDA-KDLLIGLLSR 593
            VD W+LG+  YE+ TG PPY + +  +  + I + +P R        A K+++   L  
Sbjct: 196 KVDIWSLGITAYEIATGNPPYCEVEALRAMQLITKSKPPRLEGRQHSSALKEIIALCLDE 255

Query: 594 DPKRR 598
           DPK R
Sbjct: 256 DPKER 260

>YFL033C (RIM15) [1651] chr6 complement(69113..74425)
           Serine/threonine protein kinase, positive regulator of
           IME2 expression and of sporulation [5313 bp, 1770 aa]
          Length = 1770

 Score =  117 bits (292), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 56/166 (33%), Positives = 103/166 (62%), Gaps = 6/166 (3%)

Query: 348 ATNRAL-----SVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIH 402
           ATN+ +     S+ D+++LK I KG++G V   RKK T   +A+K +RKS +++K++V +
Sbjct: 779 ATNQTVKSPTPSIKDYDILKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTN 838

Query: 403 TLAERTVL-ARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLY 461
             +ER ++  + + P++  L  +FQ+ D L++V+ ++ GG+L   ++  G      A+ Y
Sbjct: 839 VKSERAIMMVQSDKPYVARLFASFQNKDNLFLVMEYLPGGDLATLIKMMGYLPDQWAKQY 898

Query: 462 TAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNM 507
             E++  +  +H   +I+ DLKPEN+L+D+ GH+ L DFGL +  +
Sbjct: 899 LTEIVVGVNDMHQNGIIHHDLKPENLLIDNAGHVKLTDFGLSRAGL 944

 Score = 99.8 bits (247), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 79/139 (56%), Gaps = 12/139 (8%)

Query: 516  FCGTPEYLAPELLLGQGY-SKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLR 574
            F GTP+YLAPE + G+G  +K  DWW++G + +E++ G PP++ E    ++KKIL   ++
Sbjct: 1147 FFGTPDYLAPETIEGKGEDNKQCDWWSVGCIFFELLLGYPPFHAETPDAVFKKILSGVIQ 1206

Query: 575  FPDG---------FDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKRLWMKG 625
            +P+             +AKDL+  LL  DP +RLG  G  EIK HP+F  + W  ++ + 
Sbjct: 1207 WPEFKNEEEEREFLTPEAKDLIEKLLVVDPAKRLGAKGIQEIKDHPYFKNVDWDHVYDEE 1266

Query: 626  YIPPYKPPVMNSLDTSNFD 644
                + P + N  DT  FD
Sbjct: 1267 A--SFVPTIDNPEDTDYFD 1283

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score =  116 bits (290), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 81/256 (31%), Positives = 130/256 (50%), Gaps = 11/256 (4%)

Query: 348 ATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAER 407
            TN   S+  F+  ++IG+G FG V +     T +VYA+K +      ++ EV     E 
Sbjct: 8   GTNNVTSL--FKRKEIIGRGKFGVVYKAFHVKTQQVYAIKVLNLDN--TEDEVEDIRKEI 63

Query: 408 TVLARV-ENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELL 466
             L+ + + P I     ++    KL++++ +  GG L   L R G        +   E+L
Sbjct: 64  QFLSSLKQTPNITHYYGSYLIDTKLWVIMEYCAGGSLRT-LLRPGIIEEKYIGVIMREIL 122

Query: 467 CALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPE 526
            AL ++H  +VI+RD+K  NIL+ + G + LCDFG+     +   K  T  GTP ++APE
Sbjct: 123 VALISIHRDNVIHRDIKAANILIANNGSVKLCDFGVAAQLSQSMLKRQTMAGTPYWMAPE 182

Query: 527 LLL-GQGYSKVVDWWTLGVLLYEMMTGLPPY-YDEDVPKMYKKILQEPLRFPDG--FDKD 582
           +++ G  Y   VD W+LG+  YE+ TG PPY + E +  M      +P R  +G  + + 
Sbjct: 183 VIMEGVYYDTKVDIWSLGITAYEIATGNPPYCHMEAIRAMQMITKSKPPRL-EGREYSQP 241

Query: 583 AKDLLIGLLSRDPKRR 598
            K+ +   L  DPK R
Sbjct: 242 LKEFIALCLDEDPKER 257

>Kwal_47.17252
          Length = 872

 Score =  115 bits (289), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 80/299 (26%), Positives = 144/299 (48%), Gaps = 53/299 (17%)

Query: 356 DDFELLKVIGKGSFGKVMQVR---KKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLAR 412
           D + + + IGKGSF  V + R    +D N   A+KA+ +S + +K  + +   E  +L +
Sbjct: 18  DKYLVQQEIGKGSFATVYKGRIASNRDLNDFIAIKAVSRSKLKNKKLLENLEIEIAILKK 77

Query: 413 VENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREG----RFSLSRARL-------- 460
           +++P IV L    ++    ++++ +   G+L + +++ G    +  L R           
Sbjct: 78  IKHPHIVGLMDCERTGADFFLIMEYCALGDLTFLIKKRGGLIEKHPLVRTMFEKYPPPSE 137

Query: 461 ------------YTAELLCALETLHNLDVIYRDLKPENILLD-------------HQGHI 495
                       Y  +L  AL  L + ++++RD+KP+N+LL                G +
Sbjct: 138 SHNGLNRVVVVSYLQQLSSALMFLRSKNLVHRDIKPQNLLLSTPLVNYSDRETFHKMGFV 197

Query: 496 AL--------CDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLY 547
            +         DFG  +  +       T CG+P Y+APE+L  Q Y+   D W++G +LY
Sbjct: 198 GIYNLPILKIADFGFARF-LPNTSLAETLCGSPLYMAPEILDYQKYNAKADLWSVGTVLY 256

Query: 548 EMMTGLPPYYDEDVPKMYKKILQ--EPLRFPD--GFDKDAKDLLIGLLSRDPKRRLGFN 602
           EM  G PP+   +  +++KKI +  + + FP     D   ++L+ GLL+ DP +R+GFN
Sbjct: 257 EMCCGRPPFKASNHLELFKKIKRANDVISFPTHCKVDPQMRELICGLLTFDPSQRMGFN 315

>ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH]
           complement(731433..736142) [4710 bp, 1569 aa]
          Length = 1569

 Score =  115 bits (289), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 107/170 (62%), Gaps = 5/170 (2%)

Query: 348 ATNRAL----SVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHT 403
           ATN+A     S+ D++++K I KG++G V    K+ T + +A+K +RKS +++K++V + 
Sbjct: 668 ATNQAKAPTPSIKDYDIIKPISKGAYGSVYLAYKRITGEYFAIKVLRKSDMIAKNQVTNV 727

Query: 404 LAERTVL-ARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYT 462
            +ER ++  + E P++  L  TFQ+ + L++V+ +++GG+L   ++  G      A+ Y 
Sbjct: 728 KSERVIMMVQSEKPYVAKLYATFQNKENLFLVMEYLSGGDLATLIKMMGNLPDKWAKQYI 787

Query: 463 AELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDK 512
            E++  ++ +H   +I+ DLKP+N+L+D  GH+ L DFGL ++ +  + K
Sbjct: 788 TEVIIGVDDMHMSGIIHHDLKPDNLLIDSNGHVKLTDFGLSRIGLIQRHK 837

 Score =  112 bits (279), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 85/144 (59%), Gaps = 11/144 (7%)

Query: 510  QDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKIL 569
            +D +  F GTP+YL+PE +LG G S   DWW++G +L+E + G PP++   V  ++K IL
Sbjct: 995  EDGSRRFFGTPDYLSPETILGTGESGASDWWSVGCILFEFLLGYPPFHASTVEDVFKNIL 1054

Query: 570  QEPLRFPDGFDK---------DAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKR 620
               + +P   +K         +AKDL++ LL  +P+ RLG NGA EIK HP+F  ++W +
Sbjct: 1055 SGQIDWPSFPNKETELEYLSPEAKDLILKLLESNPEERLGANGAQEIKEHPYFKGINWSK 1114

Query: 621  LWMKGYIPPYKPPVMNSLDTSNFD 644
            ++ +     + P V N  DT  FD
Sbjct: 1115 VYDEEA--SFVPTVDNPEDTDYFD 1136

>Scas_685.24
          Length = 515

 Score =  113 bits (283), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 74/266 (27%), Positives = 138/266 (51%), Gaps = 13/266 (4%)

Query: 339 LNLSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKS 398
           L++  +Y P  ++A    ++ + + +G+G+FG V +   + TNKV A+K +    + + +
Sbjct: 6   LSIRREYTPRISKA---HNYIVKECVGRGNFGDVYRAIDRTTNKVVAIKVVD---LENTN 59

Query: 399 EVIHTLAERTV-LARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSR 457
           E +  LA+    LA +++P+I+    T      ++IV+ +  GG     L+      L  
Sbjct: 60  ERLEVLAQEIFFLAELKSPYIINYITTLLEDASMWIVMEYCGGGSCSDLLKYYFNNGLPE 119

Query: 458 ARL--YTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNT 515
            ++   T E+L  L+ LH    I+RD+K  NILL  +GH+ L DFG+    +K   +  T
Sbjct: 120 KKVAYITREILKGLQYLHEQKKIHRDIKAANILLTEEGHVKLGDFGVSG-QLKSTLRRGT 178

Query: 516 FCGTPEYLAPELLLG--QGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPL 573
             GTP ++APE+     +GY + +D W+LG+ ++E++ G+PP    D  ++   + ++  
Sbjct: 179 IVGTPYWMAPEVASQNIEGYDEKIDIWSLGITVFELLKGVPPLVKLDPIRVLANLSRKSA 238

Query: 574 -RFPDGFDKDAKDLLIGLLSRDPKRR 598
            R    +   AK  +   L ++P  R
Sbjct: 239 PRLQGAYSDAAKSFVALCLIKNPNER 264

>KLLA0F09020g 836287..839073 weakly similar to sp|P43565
           Saccharomyces cerevisiae YFL033c RIM15 protein kinase
           involved in expression of meiotic genes, start by
           similarity
          Length = 928

 Score =  115 bits (287), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 106/164 (64%), Gaps = 3/164 (1%)

Query: 347 PATNRAL--SVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTL 404
           P T +++  S+ D++++K I KG++G V   +K+ T + +A+K ++KS +++K++V +  
Sbjct: 689 PTTGKSIIPSIRDYDVIKPISKGAYGSVYLAKKRVTGEYFAIKVLKKSDMIAKNQVTNVK 748

Query: 405 AERTVL-ARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTA 463
           +ER ++  + + P++  L  TFQ+ + L++V+ +++GG++   ++  G      A+ Y  
Sbjct: 749 SERAIMMVQSDKPYVARLYATFQNKENLFLVMQYLSGGDMATLIKMMGNLPEKWAKQYIC 808

Query: 464 ELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNM 507
           E++  ++ +H   +I+ DLKP+N+L+D  GHI L DFGL ++ +
Sbjct: 809 EVISGVDDMHQNGIIHHDLKPDNLLIDSLGHIKLTDFGLSRMGL 852

>YDR523C (SPS1) [1335] chr4 complement(1485554..1487026)
           Serine/threonine protein kinase involved in middle/late
           stage of meiosis [1473 bp, 490 aa]
          Length = 490

 Score =  112 bits (281), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 74/247 (29%), Positives = 125/247 (50%), Gaps = 10/247 (4%)

Query: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTV-LARVENP 416
           + +   IG+G+FG V +   + T ++ A+K +   +     E I  LA+    LA +++P
Sbjct: 18  YSIQSCIGRGNFGDVYKAVDRVTQEIVAIKVVNLEH---SDEDIELLAQEIFFLAELKSP 74

Query: 417 FIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSL--SRARLYTAELLCALETLHN 474
            I     T      ++IV+ +  GG     L+R     L   +      E+   L+ LH 
Sbjct: 75  LITNYIATMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTLGLKYLHE 134

Query: 475 LDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQ--G 532
              I+RD+K  NILL+ +G + L DFG+   +++   K +TF GTP ++APE++  +  G
Sbjct: 135 QRKIHRDIKAANILLNEEGMVKLGDFGVSG-HIRSTLKRDTFVGTPYWMAPEVVCCEVDG 193

Query: 533 YSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKI-LQEPLRFPDGFDKDAKDLLIGLL 591
           Y++  D W+LG+  YE++ GLPP    D  K+   +  ++P +    F   AKD + G L
Sbjct: 194 YNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGPFSDAAKDFVAGCL 253

Query: 592 SRDPKRR 598
            + P  R
Sbjct: 254 VKTPADR 260

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score =  114 bits (285), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 129/259 (49%), Gaps = 10/259 (3%)

Query: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPF 417
           + L +VIG+G++G V +  K+ TNK  A+K I       +SE+   + E  +L  + +  
Sbjct: 10  YALKQVIGRGAYGVVYRAVKRGTNKPCAIKQIE---FEDESELNEHMLEIDLLKNLRHQN 66

Query: 418 IVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLDV 477
           IV  +   Q   +LYI+L +   G L   + + G         Y  + L  L+ LH   V
Sbjct: 67  IVEYRGFIQKAHELYIILEYCARGSL-RDILKHGPLLEDDTVNYVTQTLYGLQYLHEQGV 125

Query: 478 IYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVV 537
           I+RD+K  N+LL  +G + L DFG+   + +      T+ G+P ++APE++ GQG S V 
Sbjct: 126 IHRDIKAANLLLTEEGIVKLADFGV---STRINRMAMTYAGSPNWMAPEVMTGQGASTVS 182

Query: 538 DWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGLLSRDPKR 597
           D W+LG  + E++TG PP+++         I+ E    P     + KD L     ++  +
Sbjct: 183 DIWSLGATVVELLTGNPPFHNLVNESACYAIVNEEYIPPLTLSAECKDFLSRCFQKNMFK 242

Query: 598 RLGFNGADEIKSHPFFSQL 616
           R     A E+ +H +  ++
Sbjct: 243 R---ATAQELLAHIWLKKI 258

>Scas_713.7
          Length = 983

 Score =  114 bits (286), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 80/269 (29%), Positives = 135/269 (50%), Gaps = 15/269 (5%)

Query: 347 PATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAE 406
           P  N+++    ++L +VIGKGS+G V +   K T ++ A+K +      +  E+I  + E
Sbjct: 18  PNKNKSVQ---YQLKQVIGKGSYGVVYKAVNKKTLQIVAIKEVNYD---NDDELIEIMTE 71

Query: 407 RTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQ--REGRFSLSRARLYTAE 464
             +L  + +  IV      Q    LYI+L F + G L   L   ++G   L  A++Y  +
Sbjct: 72  IDLLKNLNHVNIVKYHGFIQKSSNLYIILEFCSKGSLKNLLTGYKDGIPELD-AKVYIRQ 130

Query: 465 LLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLA 524
            L  L  LH   VI+RD+K  N+LLD    + L DFG+   + K  +   T  G+  +++
Sbjct: 131 TLNGLVYLHEQGVIHRDIKAANLLLDSNDVVKLADFGV---STKVSNTAMTLAGSLHWMS 187

Query: 525 PELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAK 584
           PE++  +G S + D W+LG  + E++TG PP+Y      +Y  I  +P   P+    +AK
Sbjct: 188 PEIIGNRGASTLSDIWSLGATVVELVTGNPPFYKLVDVNIYYAIENDPFIPPEFLSNEAK 247

Query: 585 DLLIGLLSRDPKRRLGFNGADEIKSHPFF 613
           D L     ++  +R     A ++  HP+ 
Sbjct: 248 DFLKKCFQKNMYKR---PTAKKLLKHPWL 273

>Scas_673.20*
          Length = 758

 Score =  113 bits (283), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 80/255 (31%), Positives = 127/255 (49%), Gaps = 25/255 (9%)

Query: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPF 417
           +  LK IG+G+ G V    +  T+   A+K I    I  + ++I T  E  VL   ++P 
Sbjct: 481 YRKLKRIGEGASGIVYTAYEIGTDISVAIKQIDLK-IQPRLQMIWT--EMLVLKEYQHPN 537

Query: 418 IVPLKFTFQSPDKLYIVLAFINGGEL-----FYHLQREGRFSLSRARLYTAELLCALETL 472
           I+    ++   D L+IV+ +++GG L     F+    E   ++ R  L+       L  L
Sbjct: 538 IINFINSYLLHDTLWIVMEYMDGGSLADIVSFFTPTEEQMATICRETLF------GLNFL 591

Query: 473 HNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQG 532
           H+  +++RD+K +NILL   G I + DFG C    +   K  T  GTP ++APE++  + 
Sbjct: 592 HSRGIVHRDIKSDNILLSMNGDIKITDFGFCGQLTESNTKRTTMVGTPYWMAPEVIASKE 651

Query: 533 YSKVVDWWTLGVLLYEMMTGLPPYYDED-VPKMY------KKILQEPLRFPDGFDKDAKD 585
           Y   VD W+LG+++ EM+ G PPY  E  V  +Y      K IL+EP +         K+
Sbjct: 652 YGPKVDVWSLGIMIIEMIEGEPPYLHETPVRALYLITTNGKPILKEPEKVGPVL----KN 707

Query: 586 LLIGLLSRDPKRRLG 600
            +   L  DP+ RL 
Sbjct: 708 FMDECLRVDPEARLS 722

>Kwal_14.1159
          Length = 1521

 Score =  114 bits (284), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 52/165 (31%), Positives = 105/165 (63%), Gaps = 5/165 (3%)

Query: 348 ATNRAL----SVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHT 403
           ATN+A     S+ D++++K I KG++G V   +++ T + +A+K ++KS +++K++V + 
Sbjct: 663 ATNQAKPSTPSIKDYDVIKPISKGAYGSVFLAKRRITGEYFAIKVLKKSDMIAKNQVTNV 722

Query: 404 LAERTVLARVEN-PFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYT 462
            +ER ++    N P++  L  TFQ+   L++V+ +++GG+L   ++  G       + Y 
Sbjct: 723 KSERAIMMVQSNKPYVAKLYATFQNRGNLFLVMEYLSGGDLGTLIKMMGSLPDQWVKQYI 782

Query: 463 AELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNM 507
           +E++  +E +H   +I+ DLKP+N+L+D +GH+ L DFGL ++ +
Sbjct: 783 SEVIYGVEDMHQSGIIHHDLKPDNLLIDQRGHLKLTDFGLSRMGL 827

 Score = 98.2 bits (243), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 71/120 (59%), Gaps = 9/120 (7%)

Query: 512  KTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQE 571
            K   F GTP+YLAPE + G G +   DWW++G +L+E + G PP++   V +++  IL  
Sbjct: 954  KNKKFFGTPDYLAPETIEGTGETDSSDWWSVGCMLFEFVFGYPPFHASTVEEVFSNILAG 1013

Query: 572  PLRFPDGFDK---------DAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKRLW 622
             + +P   D+         +A+DL+  LL  DP +RLG NGA+EI  HP+F  + W+ L+
Sbjct: 1014 NIDWPAFPDEATEREYISPEARDLIEKLLVVDPDKRLGANGAEEIFEHPYFQDVDWENLY 1073

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score =  113 bits (283), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 119/241 (49%), Gaps = 6/241 (2%)

Query: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPF 417
           ++L ++IG+GS+G V +   K T +  A+K +         E++  ++E  +L  + +  
Sbjct: 22  YQLRQIIGRGSYGVVYKATNKKTAQEVAIKEVNYQ---DDDELVDIMSEIDLLKNLNHIN 78

Query: 418 IVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLDV 477
           IV      Q    LYI+L +   G L   + R    S   A+ Y  + L  L  LH   V
Sbjct: 79  IVKYHGFIQKQHNLYIILEYCAKGSLKNLISRNRPMSEHEAKPYVRQTLNGLNYLHEQGV 138

Query: 478 IYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVV 537
           I+RD+K  NILLD +  + L DFG   ++ K  +   T  G+  ++APE++  +G S + 
Sbjct: 139 IHRDIKAANILLDSENVVKLADFG---VSTKVNNTAMTLAGSLNWMAPEIIGNRGASTLS 195

Query: 538 DWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGLLSRDPKR 597
           D W+LG  + E++TG PP+++     +Y  I  +    P      AKD L    +++  +
Sbjct: 196 DIWSLGATVVELLTGNPPFHNLIDMNIYYAIENDSYFPPSSLSSGAKDFLQQCFAKNMYK 255

Query: 598 R 598
           R
Sbjct: 256 R 256

>YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine
           protein kinase with similarity to Cmk1p, Cmk2p, and
           Cmk3p [1539 bp, 512 aa]
          Length = 512

 Score =  111 bits (278), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 86/305 (28%), Positives = 139/305 (45%), Gaps = 48/305 (15%)

Query: 340 NLSVDYKPATNR---ALSVDDFELLKVIGKGSFGKVMQVR--KKDTNKVYALKAIRKSYI 394
           N S DY  + ++    L + +++LL  IG+G+F +V +      D     A+KAI K  I
Sbjct: 100 NKSTDYSSSNHQYPEQLELHNYKLLNKIGEGAFSRVFKAVGINTDDQAPVAIKAIIKKGI 159

Query: 395 VSKS-----EVIHTLAERTVLARV--------ENPFIVPLKFTFQSPDKLYIVLAFINGG 441
            S +     + I   + + VL  V         NP         +S +  Y+V   + GG
Sbjct: 160 SSDAILKGNDRIQGSSRKKVLNEVAIHKLVSKNNPHCTKFIAFQESANYYYLVTELVTGG 219

Query: 442 ELFYHLQREGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILL----------DH 491
           E+F  + +   FS   AR    ++  A++ +H + +++RD+KPEN+L           D 
Sbjct: 220 EIFDRIVQLTCFSEDLARHVITQVAIAIKHMHYMGIVHRDVKPENLLFEPIPFYGLDGDM 279

Query: 492 QGH--------------IALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVV 537
           Q                + L DFGL K       KT   CGT EY+A E+   + YS  V
Sbjct: 280 QKEDEFTLGVGGGGIGLVKLMDFGLAKKLRNNTAKTP--CGTIEYVASEVFTSKRYSMKV 337

Query: 538 DWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFP----DGFDKDAKDLLIGLLSR 593
           D W++G +L+ ++ G PP+Y+++   + KKI +    F     D     AK+ +  LL  
Sbjct: 338 DMWSIGCVLFTLLCGYPPFYEKNEKTLLKKISRGDYEFLAPWWDNISSGAKNAVTHLLEV 397

Query: 594 DPKRR 598
           DP +R
Sbjct: 398 DPNKR 402

>Scas_582.1
          Length = 638

 Score =  112 bits (280), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 88/309 (28%), Positives = 152/309 (49%), Gaps = 25/309 (8%)

Query: 337 GKLNLS---VDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSY 393
           GKL+LS   +D+   ++  +++ + E ++ +G G++G V +V  K TN + A+K ++   
Sbjct: 306 GKLSLSSKGIDFSNGSSSRITLAELEFIEELGHGNYGNVSKVLHKPTNVIMAMKEVKLEL 365

Query: 394 IVSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGEL--FYHLQRE- 450
             +K   I  L E  VL + ++P+IV     F     +Y+ + +++GG L   Y    E 
Sbjct: 366 DEAKFRQI--LMELEVLHKCKSPYIVDFYGAFFIEGAVYMCMEYMDGGSLDKIYDQDPEI 423

Query: 451 GRFSLSRARLYTAELLCALETLHNL-DVIYRDLKPENILLD-HQGHIALCDFGLCKLNMK 508
           G     +  +    ++  L+ L ++  +I+RD+KP NIL    QG I LCDFG+    + 
Sbjct: 424 GGIDEPQLAVIATAVIRGLKVLKDVHHIIHRDVKPTNILCSAKQGTIKLCDFGVSGNLVA 483

Query: 509 GQDKTNTFCGTPEYLAPELLLG-----QGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPK 563
              KTN  C +  Y+APE +         Y+   D W+LG+ + EM  G  PY  E    
Sbjct: 484 SMAKTNIGCQS--YMAPERIKSLNPDIATYTVQSDIWSLGLSILEMALGRYPYPPETFDN 541

Query: 564 MYKKILQ----EPLRFPDG-FDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSW 618
           ++ ++       P + P G F K+A+D +   L + P+RRL +    E   HP+  +   
Sbjct: 542 IFSQLSAIVDGPPPKLPAGKFSKEAQDFVSLCLQKVPERRLNYTALLE---HPWLVKYRD 598

Query: 619 KRLWMKGYI 627
             + M  Y+
Sbjct: 599 VDVGMSEYL 607

>KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 483

 Score =  110 bits (274), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 83/268 (30%), Positives = 120/268 (44%), Gaps = 27/268 (10%)

Query: 353 LSVDDFELLKVIGKGSFGKVMQVR-----------KKDTNKVYALKAIRKSYIVSKSEVI 401
           LS+  F+LL+ +GKG+FG V               K   N   A+K I   +  S   + 
Sbjct: 2   LSLQQFQLLECVGKGNFGDVYLAHYLGSNQEPTDPKIPKNVPLAIKCINLEH--SNEPID 59

Query: 402 HTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLY 461
             L E   L+ +  P+I     TF     LYIV+ + + G L   L+   R +       
Sbjct: 60  LLLKEIYFLSTLHCPYITHYYGTFTGDCNLYIVMEYCSNGSLLNLLRYYSRLTEQTTCFI 119

Query: 462 TAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLC---KLN--MKGQDKTNTF 516
             ++  ALE LH   +I+RDLK  NILL+  G + L D G+    K N    G    NTF
Sbjct: 120 ILQVCHALEYLHEKRLIHRDLKAANILLNDDGEVRLADLGVTGQLKFNSTRHGGKNLNTF 179

Query: 517 CGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFP 576
            GTP ++APE++  Q Y    D W+LG+   E++ G PP    D  K   +I   P    
Sbjct: 180 VGTPFWMAPEIIKNQSYDGKCDIWSLGITTLELLNGKPPMSHLDSMKALMRI---PKLNA 236

Query: 577 DGFDKD------AKDLLIGLLSRDPKRR 598
           D   ++       KD +   L +DP +R
Sbjct: 237 DSILRNMDISPLGKDFIRSCLQQDPNQR 264

>Kwal_0.155
          Length = 587

 Score =  110 bits (276), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 86/320 (26%), Positives = 146/320 (45%), Gaps = 65/320 (20%)

Query: 353 LSVDDFELLKVIGKGSFGKVMQ-VRKKDTNKVY--------ALKAIRKSYI--------- 394
           L + D++L+  IG+G+F KV + V ++ ++K +        A+K I K ++         
Sbjct: 152 LELQDYKLIAKIGEGAFSKVYRGVPQEHSSKSFLSRAFKQVAVKVISKKHLSSTHKDAKS 211

Query: 395 --VSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGR 452
              S+ +V+  +A    ++  EN  +V      +S +  +IV   + GGE+F  + R   
Sbjct: 212 KATSREQVLKEVAIHRTVSASEN--VVSFVDFQESHNYYFIVQELLAGGEIFGEIVRLTY 269

Query: 453 FSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGH------------------ 494
           FS   +R    +L  A++ +H + +++RD+KPEN+L +H  +                  
Sbjct: 270 FSEDLSRHVIRQLALAVKHMHAMGIVHRDIKPENLLFEHVDYEPSPSPVLRKSDDPKAKQ 329

Query: 495 ----------------IALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVD 538
                           + L DFGL K        T T CGT  Y APE++  + YS  VD
Sbjct: 330 DEGIFRPGIGGGGIGTVKLADFGLSKQIYSTN--TKTPCGTVGYTAPEVVKDERYSMQVD 387

Query: 539 WWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFP----DGFDKDAKDLLIGLLSRD 594
            W +G +LY ++ G PP+YDE +  + +KI +    F     D     AK+ +  LL  D
Sbjct: 388 MWGIGCVLYTVLCGFPPFYDEKIDVLTEKISRGEFTFLRPWWDEISDGAKNAVRRLLEVD 447

Query: 595 PKRRLGFNGADEIKSHPFFS 614
           P +R      DE  + P+ +
Sbjct: 448 PSKRYTI---DEFLADPWLN 464

>CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces
           cerevisiae YJL128c PBS2, hypothetical start
          Length = 677

 Score =  111 bits (277), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 90/309 (29%), Positives = 149/309 (48%), Gaps = 25/309 (8%)

Query: 337 GKLNLS---VDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSY 393
           GKL+LS   +D+   ++  +++D+ + ++ +G G++G V +V  K  N + A+K +R   
Sbjct: 345 GKLSLSSRGIDFSNGSSSRITLDELQFIEELGHGNYGTVSKVLHKPNNVLMAMKEVRLEL 404

Query: 394 IVSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGEL--FYHLQRE- 450
             SK   I  L E  VL +  +PFIV     F     +Y+ + +++GG L   Y    E 
Sbjct: 405 DESKFRQI--LMELEVLHKCNSPFIVDFYGAFFIEGAVYMCMEYMDGGSLDKIYDENPEM 462

Query: 451 GRFSLSRARLYTAELLCALETLHNL-DVIYRDLKPENILLD-HQGHIALCDFGLCKLNMK 508
           G     +    T  ++  L  L  + +VI+RD+KP NIL    QG + LCDFG+    + 
Sbjct: 463 GGIDEPQLAFITNAVIQGLRELKEVHNVIHRDVKPTNILCSAKQGTVKLCDFGVSGNLVA 522

Query: 509 GQDKTNTFCGTPEYLAPELLLG-----QGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPK 563
              KTN  C +  Y+APE +         Y+   D W+LG+ + EM  G  PY  E    
Sbjct: 523 SLAKTNIGCQS--YMAPERIKSLNPDRGTYTVQSDIWSLGLSILEMALGRYPYPPETFDN 580

Query: 564 MYKKILQ----EPLRFP-DGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSW 618
           ++ ++       P + P D F  +A+D +   L + P RR  ++   E   HP+ ++   
Sbjct: 581 IFSQLSAIVDGPPPKLPADKFSDEAQDFVSLCLQKIPDRRPNYSNLYE---HPWLAKYRS 637

Query: 619 KRLWMKGYI 627
             + M  YI
Sbjct: 638 IDVQMGPYI 646

>CAGL0K02167g complement(191468..194956) similar to sp|P38990
           Saccharomyces cerevisiae YER129w
           Serine/threonine-protein kinase, start by similarity
          Length = 1162

 Score =  111 bits (278), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 92/335 (27%), Positives = 156/335 (46%), Gaps = 67/335 (20%)

Query: 341 LSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAI-------RKSY 393
           +S+ Y P + R + ++ +E++K +G G  GKV   R   T ++ A+K +       RK +
Sbjct: 125 ISLTYDPVSKRKV-LNTYEIIKELGHGQHGKVKLGRDLVTKRLVAIKIVDRHEKKERKFF 183

Query: 394 IV---SKSEVIHTLAERTVLARVENPFIVPLKFTFQ--SPDKLYIVLAFINGGELFYH-- 446
                 K+E      E  ++ +  +  +V L          K+Y+VL + + GE+ +   
Sbjct: 184 SFKKPGKTENDKIKREIAIMKKCHHKHVVKLIEVLDDLKSRKIYLVLEYCSRGEVKWCPP 243

Query: 447 --LQREGRFSLSRARLYTAELL----CALETLHNLDVIYRDLKPENILLDHQGHIALCDF 500
             L+ E +     +  +T E+L      LE LH   +I+RD+KP N+LL   G + + DF
Sbjct: 244 DCLETEAKGPSPLSFQFTREILRGVVLGLEYLHYQGIIHRDIKPANLLLSETGIVKISDF 303

Query: 501 GLC----KLNMKGQDKT------NTFCGTPEYLAPELLLGQ-GYSKV------------- 536
           G+       N+ G D+T          GTP + APE+ LG+  + K              
Sbjct: 304 GVSLAASSSNVDGSDETIDELELAKTAGTPAFFAPEICLGEDAFEKYQLDREELFKGSCI 363

Query: 537 ---VDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFD------------- 580
              +D W LGV LY ++ G+ P+      ++++KI+ +P++FP   D             
Sbjct: 364 SFKIDIWALGVTLYCLVFGMLPFVSSFELELFEKIVNDPVKFPKYSDMLKNNQVLQMTEE 423

Query: 581 ---KDAKDLLIGLLSRDPKRRLGFNGADEIKSHPF 612
              + AKDLL  LL ++P +R+     +EIK HPF
Sbjct: 424 AEYEAAKDLLTRLLEKNPIKRINI---EEIKRHPF 455

>AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..32840)
           [2076 bp, 691 aa]
          Length = 691

 Score =  110 bits (275), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 96/308 (31%), Positives = 152/308 (49%), Gaps = 24/308 (7%)

Query: 337 GKLNLS---VDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSY 393
           GKL+LS   VD+   ++  +++D+ E L+ +G G++G V +V  K TN + A+K +R   
Sbjct: 353 GKLSLSSQGVDFSNGSSFRITLDELEFLEELGHGNYGTVSKVLHKPTNIMMAMKEVRLEL 412

Query: 394 IVSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGEL--FYHLQREG 451
             SK   I  L E  VL + ++P+IV     F     +Y+ + F++GG L   Y     G
Sbjct: 413 DESKFRQI--LMELEVLHKCQSPYIVDFYGAFFIEGAVYMCMEFMDGGSLDKSYDPHEIG 470

Query: 452 RFSLSRARLYTAELLCALETLHNL-DVIYRDLKPENILLDH-QGHIALCDFGLCKLNMKG 509
                +  L T  ++  L+ L ++ ++I+RD+KP NIL    QG + LCDFG+    +  
Sbjct: 471 GIEEPQLALITESVIRGLKELKDVHNIIHRDVKPTNILCSATQGTVKLCDFGVSGNLVAS 530

Query: 510 QDKTNTFCGTPEYLAPELLLG-----QGYSKVVDWWTLGVLLYEMMTGLPPY----YDED 560
             +TN  C +  Y+APE +         YS   D W+LG+ + EM  G  PY    YD  
Sbjct: 531 LARTNIGCQS--YMAPERIKSLNPDKATYSVQSDIWSLGLSIVEMALGAYPYPPETYDNI 588

Query: 561 VPKMYKKILQEPLRFP-DGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWK 619
             ++   +   P R P D F  DA+D +   L + P+RR  +    E   HP+  +    
Sbjct: 589 FSQLSAIVDGPPPRLPKDTFSSDAQDFVRLCLQKIPERRPTYASLLE---HPWLKKYRGL 645

Query: 620 RLWMKGYI 627
            + M  YI
Sbjct: 646 DVHMSEYI 653

>KLLA0F09031g 839103..841004 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 633

 Score =  110 bits (274), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 87/149 (58%), Gaps = 11/149 (7%)

Query: 505 LNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKM 564
           L++   +++  F GTP+YLAPE + G G S   DWW++G + +E + G PP++   V ++
Sbjct: 52  LSLFNPNESKNFFGTPDYLAPETIKGTGESDTCDWWSVGCIFFEFLFGYPPFHGTTVDEV 111

Query: 565 YKKILQEPLRFPDGFDK---------DAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQ 615
           ++ I+   +R+P+  D          DAKDL+I LL  DP +RLG +G+ EIK HP+F  
Sbjct: 112 FENIIGGVIRWPEFPDAETEMEYISPDAKDLVIKLLVLDPNKRLGASGSQEIKEHPYFKD 171

Query: 616 LSWKRLWMKGYIPPYKPPVMNSLDTSNFD 644
           + W  ++ +   P + P V +  DT  FD
Sbjct: 172 VDWDHVYDEQ--PSFVPRVEHPEDTEYFD 198

>CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces
           cerevisiae YBR274w CHK1 regulats inhibitory Cdk
           phosphorylation of PDS1, start by similarity
          Length = 528

 Score =  109 bits (272), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 85/284 (29%), Positives = 145/284 (51%), Gaps = 33/284 (11%)

Query: 355 VDDFELLKVIGKGSFGKVMQVRKK-DTNKVYALKAIRKSYI---------VSKSEVIHT- 403
           + D EL   IG+GSFG V   R K D++ V A+K +              VS+  V+H+ 
Sbjct: 11  IKDVELGGTIGEGSFGCVRSARLKFDSSVVVAVKFVHLPTCAESGLSQKDVSREVVLHSK 70

Query: 404 LAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTA 463
            ++   + RV +  +          + L+I+L   +GG+LF  ++ +       A+ Y  
Sbjct: 71  CSKHANVLRVIDCNV--------GGEYLWIMLEMADGGDLFDKIEPDVGVDPDVAQFYFQ 122

Query: 464 ELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFC----GT 519
           +L+ AL  LH++ V +RD+KPENILLD +G++ L DFGL     + +D T        G+
Sbjct: 123 QLIRALNYLHDVGVAHRDIKPENILLDKKGNLKLADFGLAS-QFRRKDGTLRVSTDQRGS 181

Query: 520 PEYLAPELLLGQG-YSKVVDWWTLGVLLYEMMTG-----LPPYYDEDVPKMYKKILQEPL 573
           P Y+APE+L  QG Y+ + D W+ GVLL+ ++TG     +P   D++         +  L
Sbjct: 182 PPYMAPEILSSQGYYANITDIWSAGVLLFVLLTGEIPWSIPAKEDDNYEWFVNNEGKVSL 241

Query: 574 RFPDGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLS 617
              +  +    +LL  +L  DP++R+     ++++ HP+ +  S
Sbjct: 242 GPWERVELRQMNLLRKILQPDPRKRVSL---EKLRHHPWLTSRS 282

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score =  110 bits (275), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 88/273 (32%), Positives = 123/273 (45%), Gaps = 24/273 (8%)

Query: 364  IGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERT-VLARVENPFIVPLK 422
            IG GSFG V      DT  + A+K I+     S  ++  +L E   V+  + +P IV   
Sbjct: 1265 IGSGSFGTVYSAVNLDTGDILAVKEIKIQDAKSMKQIFPSLKEEMRVMEILNHPNIVQYY 1324

Query: 423  FTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRA-RLYTAELLCALETLHNLDVIYRD 481
                  DK+ I + F  G  L   L+  GR       ++YT +LL  L  LH   V++RD
Sbjct: 1325 GVEVHRDKVNIFMEFCEGSSLASLLEH-GRIEDEMVTQVYTLQLLEGLACLHQSGVVHRD 1383

Query: 482  LKPENILLDHQGHIALCDFGLCKLNMKGQDKT------------NTFCGTPEYLAPELLL 529
            +KPENILLD  G I   DFG  KL  K   K                 GTP Y+APE + 
Sbjct: 1384 IKPENILLDRNGVIKYVDFGAAKLIAKNGSKRISLDANNKSTGGKDMIGTPMYMAPETVT 1443

Query: 530  GQGYSKVV--DWWTLGVLLYEMMTGLPPY--YDEDVPKMYKKILQEPLRFP--DGFDKDA 583
            GQG+ K    D W+LG ++ EM+TG  P+   D +   MY        +FP         
Sbjct: 1444 GQGHGKFGSDDIWSLGCVVLEMVTGRRPWANLDNEWAIMYHVAAGHLPQFPTKSEISSAG 1503

Query: 584  KDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQL 616
            +  +   L +D  +R     A E+   P+ SQ+
Sbjct: 1504 RKFISRCLIQDANKRA---TAMELLLDPWISQI 1533

>Kwal_27.9763
          Length = 868

 Score =  110 bits (274), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 71/222 (31%), Positives = 122/222 (54%), Gaps = 10/222 (4%)

Query: 338 KLNLSVDYK-PATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVS 396
           K+NL+   K P+T    +   + L +V+GKG++G V +   + T+K  A+K I       
Sbjct: 4   KVNLTPAQKVPSTGS--NTHHYALKQVVGKGAYGIVYRAINRQTHKQVAIKVIEYD--EE 59

Query: 397 KSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLS 456
           +    H L E  +L  +++  IV      Q   +L+I+L + + G L   L + G     
Sbjct: 60  EELNEHML-EIDLLKNLKHENIVKYHGFIQKSHQLFILLEYCSQGSL-RDLIKRGPVEEQ 117

Query: 457 RARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTF 516
           + + Y  + L  L+ LH+  VI+RD+K  N+LLD Q  + L DFG+   + +  +   T+
Sbjct: 118 QCKTYIRQTLHGLKYLHDQGVIHRDIKAANLLLDAQNVVKLADFGV---STRVNNLAMTY 174

Query: 517 CGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYD 558
            G+P ++APE+++GQG S V D W+LG  + E++TG PP+++
Sbjct: 175 AGSPNWMAPEVMMGQGASTVSDIWSLGATVVEILTGNPPFHN 216

>Scas_707.3
          Length = 1598

 Score =  110 bits (275), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/157 (37%), Positives = 87/157 (55%), Gaps = 15/157 (9%)

Query: 498  CDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYY 557
             D  L   +   QDK   F GTP+YLAPE + G G     DWW++G +++E++ G PP++
Sbjct: 989  SDLALFHPDDSKQDKK--FFGTPDYLAPETIEGTGEGDQCDWWSVGCIMFELLFGYPPFH 1046

Query: 558  DEDVPKMYKKILQEPLRFPDGFDK----------DAKDLLIGLLSRDPKRRLGFNGADEI 607
                  +++KIL   + +P  FD           +AKDL++ LL  DP +RLG NGADEI
Sbjct: 1047 TNTPEGVFRKILSGKIEWPQ-FDSIEEEREILSPEAKDLIMKLLVVDPSKRLGANGADEI 1105

Query: 608  KSHPFFSQLSWKRLWMKGYIPPYKPPVMNSLDTSNFD 644
            K HP+F  ++W  ++ +     + P V N  DT  FD
Sbjct: 1106 KQHPYFKDVNWDHVYDEEA--SFVPTVENPEDTDYFD 1140

 Score =  109 bits (272), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 98/159 (61%), Gaps = 1/159 (0%)

Query: 350 NRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTV 409
           N   ++ D+ +LK I KG++G V   RKK T   +A+K ++KS +++K++V +  +ER +
Sbjct: 691 NLTPTIKDYTILKPISKGAYGSVYLARKKITGDYFAIKVLKKSDMIAKNQVTNVKSERAI 750

Query: 410 L-ARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCA 468
           +  + + P++  L  TFQ+ + L++V+ ++ GG+L   ++  G       + Y  E++  
Sbjct: 751 MMVQSDKPYVARLFATFQNKENLFLVMEYLPGGDLATLIKMMGYLPDQWVKQYLTEIIVG 810

Query: 469 LETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNM 507
           ++ +H   +I+ DLKP+N+L+D+ GH+ L DFGL +  +
Sbjct: 811 VDDMHRNWIIHHDLKPDNLLIDNLGHVKLTDFGLSRAGL 849

>CAGL0L06006g complement(670707..673535) similar to sp|P53104
           Saccharomyces cerevisiae YGL180w APG1 essential for
           autophagocytosis, hypothetical start
          Length = 942

 Score =  109 bits (272), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 78/290 (26%), Positives = 143/290 (49%), Gaps = 51/290 (17%)

Query: 362 KVIGKGSFGKVMQVR-KKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPFIVP 420
           K IGKGSF  V +     D     A+KA+ +S + +K  + +   E  +L ++++P IV 
Sbjct: 15  KEIGKGSFATVYRGHVTTDPKSHIAVKAVARSKLKNKKLLENLEIEIAILKKIKHPHIVG 74

Query: 421 LKFTFQSPDKLYIVLAFINGGELFYHLQREGRFS----------------------LSRA 458
           L    ++    Y+V+ +   G+L + +++                           L+RA
Sbjct: 75  LIDCERTTTDFYLVMDYCALGDLTFLIKKRKELENNHPLLQTVFNKYPPPSKEHNGLNRA 134

Query: 459 RL--YTAELLCALETLHNLDVIYRDLKPENILLD------------HQ-GHIAL------ 497
            +  Y  +L  AL+ L + ++++RD+KP+N+LL             H+ G++ +      
Sbjct: 135 FVVCYLQQLASALKFLRSKNLVHRDIKPQNLLLATPLTNYRDSKTFHELGYVGIYNLPIL 194

Query: 498 --CDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPP 555
              DFG  +  +       T CG+P Y+APE+L  Q Y+   D W++G +L+EM  G+PP
Sbjct: 195 KIADFGFARF-LPSTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLFEMCCGVPP 253

Query: 556 YYDEDVPKMYKKI--LQEPLRFPDGFDKD--AKDLLIGLLSRDPKRRLGF 601
           +   +  +++KKI    + + FP+  + +   K+L+  LL+ DP +R+GF
Sbjct: 254 FTASNHLELFKKIKRAHDEINFPEVCEVEDGLKELICSLLTFDPAKRIGF 303

>YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine
           protein kinase involved in induction of autophagy after
           nutrient limitation [2694 bp, 897 aa]
          Length = 897

 Score =  109 bits (272), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 80/310 (25%), Positives = 148/310 (47%), Gaps = 53/310 (17%)

Query: 344 DYKPATNRAL--SVDDFELLKVIGKGSFGKVMQVR-KKDTNKVYALKAIRKSYIVSKSEV 400
           D+  + N  L  S  ++   K IGKGSF  V +     D ++  A+K + ++ + +K  +
Sbjct: 8   DHTTSVNHNLMASAGNYTAEKEIGKGSFATVYRGHLTSDKSQHVAIKEVSRAKLKNKKLL 67

Query: 401 IHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQR----------- 449
            +   E  +L ++++P IV L    ++    Y+++ +   G+L + L+R           
Sbjct: 68  ENLEIEIAILKKIKHPHIVGLIDCERTSTDFYLIMEYCALGDLTFLLKRRKELMENHPLL 127

Query: 450 -----------EGRFSLSRARL--YTAELLCALETLHNLDVIYRDLKPENILLD------ 490
                      E    L RA +  Y  +L  AL+ L + ++++RD+KP+N+LL       
Sbjct: 128 RTVFEKYPPPSENHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGY 187

Query: 491 HQGH---------------IALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSK 535
           H                  + + DFG  +  +       T CG+P Y+APE+L  Q Y+ 
Sbjct: 188 HDSKSFHELGFVGIYNLPILKIADFGFARF-LPNTSLAETLCGSPLYMAPEILNYQKYNA 246

Query: 536 VVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQ--EPLRFPD--GFDKDAKDLLIGLL 591
             D W++G +++EM  G PP+   +  +++KKI +  + + FP     + + K+L+  LL
Sbjct: 247 KADLWSVGTVVFEMCCGTPPFRASNHLELFKKIKRANDVITFPSYCNIEPELKELICSLL 306

Query: 592 SRDPKRRLGF 601
           + DP +R+GF
Sbjct: 307 TFDPAQRIGF 316

>Kwal_56.23717
          Length = 858

 Score =  108 bits (270), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 120/239 (50%), Gaps = 26/239 (10%)

Query: 429 DKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENIL 488
           +  Y++  +++GG+L  ++ + G      AR +   +  AL+ LH  ++++RDLK ENI+
Sbjct: 6   NHFYMLFEYVSGGQLLDYIIQHGSLRERSARKFARGIASALQYLHMNNIVHRDLKIENIM 65

Query: 489 LDHQGHIALCDFGLCKL-NMKGQDKTNTFCGTPEYLAPELLLGQGYS-KVVDWWTLGVLL 546
           +   G I + DFGL  + N K Q   +TFCG+  + APELL    Y+   VD W+ GV+L
Sbjct: 66  ISTSGEIKIIDFGLSNMYNPKKQ--LHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVL 123

Query: 547 YEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGLLSRDPKRRLGFNGADE 606
           + ++ G  P+ DE+   +++KI Q  + +P     +   LL  +L  DP +R       +
Sbjct: 124 FVLVCGKVPFDDENSSVLHEKIKQGKVEYPQHLSIEVISLLSKMLVVDPTKRASLK---Q 180

Query: 607 IKSHPFFSQLSWKRLWMK--------GYIPPYKPPVMNSLDTSNFDQEFTKELPVDSVV 657
           + +H           WM+         YIP   P   ++LD +   + +  E  +D VV
Sbjct: 181 VVNH----------QWMQRGYDFPAPSYIPHRVPLTADALDATVIKEMYRLEF-IDDVV 228

>YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase
           kinase kinase essential for late nuclear division [2925
           bp, 974 aa]
          Length = 974

 Score =  108 bits (270), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 74/254 (29%), Positives = 124/254 (48%), Gaps = 10/254 (3%)

Query: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPF 417
           + L +VIG+GS+G V +   K T++V A+K +      +  E+   +AE ++L  + +  
Sbjct: 25  YHLKQVIGRGSYGVVYKAINKHTDQVVAIKEVVYE---NDEELNDIMAEISLLKNLNHNN 81

Query: 418 IVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGR-FSLSRARLYTAELLCALETLHNLD 476
           IV      +   +LYI+L +   G L   + R     S + ++ Y  + L  L+ LH   
Sbjct: 82  IVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEG 141

Query: 477 VIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKV 536
           VI+RD+K  NILL     + L DFG+  +         T  GT  ++APE+L  +G S +
Sbjct: 142 VIHRDIKAANILLSADNTVKLADFGVSTI---VNSSALTLAGTLNWMAPEILGNRGASTL 198

Query: 537 VDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAKDLLIGLLSRDPK 596
            D W+LG  + EM+T  PPY++     +Y  +  +    P  F +  KD L     ++  
Sbjct: 199 SDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSEPLKDFLSKCFVKNMY 258

Query: 597 RRLGFNGADEIKSH 610
           +R     AD++  H
Sbjct: 259 KR---PTADQLLKH 269

>CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomyces
           cerevisiae YHR030c SLT2, hypothetical start
          Length = 488

 Score =  105 bits (262), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 85/313 (27%), Positives = 148/313 (47%), Gaps = 55/313 (17%)

Query: 350 NRALSVDD-FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVI-HTLAER 407
           N+  ++D  FEL+K IG G++G V   R  + ++   +   + + I SK+ +   +L E 
Sbjct: 12  NQDFTIDKRFELIKEIGHGAYGIVCSARFTEASEETTVAIKKVTNIFSKTLLCKRSLREL 71

Query: 408 TVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRA--------- 458
            +L        +   +     D ++     ING  L+  L       + ++         
Sbjct: 72  KLLRHFRGHKNITCLYDM---DIVFYPDGSINGLYLYEELMECDMHQIIKSGQALTDAHY 128

Query: 459 RLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTF-- 516
           + +T ++LC L+ +H+ DV++RDLKP N+L++    + +CDFGL +   +  ++ N F  
Sbjct: 129 QSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPEENNQFLT 188

Query: 517 --CGTPEYLAPELLLG-QGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQ--- 570
               T  Y APE++L  QGY+K +D W+ G +L E + G P +  +D      +ILQ   
Sbjct: 189 EYVATRWYRAPEIMLSYQGYTKAIDIWSTGCILAEFLGGKPLFKGKDYVDQLNRILQVLG 248

Query: 571 ----EPLR-------------------------FPDGFDKDAKDLLIGLLSRDPKRRLGF 601
               E LR                         FP+  ++DA DLL G+L+ DP++R+  
Sbjct: 249 TPPDETLRRVGSKNVQDYIHQLGYIQKIPFSELFPNA-NEDALDLLEGMLAFDPQKRITV 307

Query: 602 NGADEIKSHPFFS 614
           + A E   HP+ +
Sbjct: 308 DKALE---HPYLT 317

>CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent or
           sp|P38622 Saccharomyces cerevisiae YGL158w RCK1,
           hypothetical start
          Length = 514

 Score =  105 bits (262), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 87/324 (26%), Positives = 146/324 (45%), Gaps = 67/324 (20%)

Query: 355 VDDFELLKVIGKGSFGKVMQVRKKDTN----KVYALKAIRKS----YIVSKSEVIHTLAE 406
           ++++ ++  IG+G+F +V +      N    K  A+K + K     + + K+  + TL E
Sbjct: 64  LNNYRIISKIGEGAFSRVFKAVPLHNNLALPKFVAIKVVPKEDFHDHNLKKTSKLQTLNE 123

Query: 407 RTV---LARVENPFIVPLKFTFQSPDKLY-IVLAFINGGELFYHLQREGRFSLSRARLYT 462
             +   L +   P +V L   FQ   K Y  +  +I GGE+F  + +   FS    R   
Sbjct: 124 LNIHLKLTKANVPNVVKL-LEFQVSKKYYYFIQEYIEGGEIFNQIVKYTYFSEDLTRHVI 182

Query: 463 AELLCALETLHNLDVIYRDLKPENILLD--------HQ---------------------- 492
            ++  A++ LH  ++I+RD+KPEN++ +        H+                      
Sbjct: 183 RQVATAVKGLHENNIIHRDIKPENLIFEPIIKEQTIHRYQKLRKSDDPKTKLDEGKFIPG 242

Query: 493 ------GHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELL---------LGQGYSKVV 537
                 G + L DFGL +L    +    T CGT  YLAPE+L             YS  V
Sbjct: 243 IGGGGIGKVRLVDFGLSRLMDPAESGARTPCGTFGYLAPEVLNQYKVDPRTSNTSYSYKV 302

Query: 538 DWWTLGVLLYEMMTGLPPYYDEDVPK--MYKKILQEPLRFP----DGFDKDAKDLLIGLL 591
           D W +G +LY M+ G PP+Y+++  K  +  KI +   +F     D    +A+DL+  LL
Sbjct: 303 DIWAIGCILYTMLCGFPPFYEDEFSKESLGDKISRGNYKFLAPWWDEISIEAQDLIRNLL 362

Query: 592 SRDPKRRLGFNGADEIKSHPFFSQ 615
             DP +R      D++ +HP+ + 
Sbjct: 363 QVDPAKRYDI---DQLLAHPWLNH 383

>ACL054W [995] [Homologous to ScYGL180W (APG1) - SH]
           complement(269703..272621) [2919 bp, 972 aa]
          Length = 972

 Score =  107 bits (266), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 76/300 (25%), Positives = 147/300 (49%), Gaps = 51/300 (17%)

Query: 352 ALSVDDFELLKVIGKGSFGKVMQVRKKDTNK-VYALKAIRKSYIVSKSEVIHTLAERTVL 410
           A+  + + + K IG+GSF  V +    D++    A+KA+ +S + +K  + +   E  +L
Sbjct: 12  AIVAERYVVEKEIGRGSFAVVYKGHLADSSAGNVAIKAVSRSKLRNKKLLENLEIEIAIL 71

Query: 411 ARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQR--------------------- 449
            ++++P IV L    ++    Y+++ +   G+L + +++                     
Sbjct: 72  KKIKHPHIVGLLECERTGTDFYLMMEYCALGDLTFFIKKRRSLMDKHPLVRTLFEKYPPP 131

Query: 450 -EGRFSLSRARL--YTAELLCALETLHNLDVIYRDLKPENILLD-------------HQG 493
            E    L+R  +  Y  +L  AL+ L + ++++RD+KP+N+LL               +G
Sbjct: 132 SEHHNGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLSTPLVDYNDPAEFHARG 191

Query: 494 HIAL--------CDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVL 545
            + +         DFG  +  +       T CG+P Y+APE+L  Q Y+   D W++G +
Sbjct: 192 FVGIYNLPILKIADFGFARF-LPNTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTV 250

Query: 546 LYEMMTGLPPYYDEDVPKMYKKILQ--EPLRFPD--GFDKDAKDLLIGLLSRDPKRRLGF 601
           LYEM  G PP+   +  ++++KI +  + ++FP     +    DL+ GLL+ +P +R+GF
Sbjct: 251 LYEMCCGKPPFKASNHLELFQKIKKANDVIQFPKHAALESAMVDLICGLLTFEPAKRMGF 310

>Kwal_23.6325
          Length = 1542

 Score =  106 bits (265), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 80/275 (29%), Positives = 130/275 (47%), Gaps = 24/275 (8%)

Query: 362  KVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAER-TVLARVENPFIVP 420
            + +G G+FG V      DT ++ A+K I+     S  +V   + E  +VL  + +P +V 
Sbjct: 1253 QFVGGGAFGTVFSAVNLDTGEILAVKEIKIQDRKSMKQVFPAIKEEMSVLEMLNHPNVVQ 1312

Query: 421  LKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRA-RLYTAELLCALETLHNLDVIY 479
                    DK+ + + +  GG L   L   GR       ++Y  ++L  L  LH   V++
Sbjct: 1313 YYGVEVHRDKVNLFMEYCEGGSL-AQLLEHGRIEDEMVTQIYALQMLEGLAYLHQSSVVH 1371

Query: 480  RDLKPENILLDHQGHIALCDFGLCK-----------LNMKGQ-DKTNTFCGTPEYLAPEL 527
            RD+KPENILLD  G I   DFG  +           +  +G+ D  N+  GTP Y++PE 
Sbjct: 1372 RDIKPENILLDFNGVIKYVDFGAARSLAANGTKAPNVGAEGKADGVNSMMGTPMYMSPES 1431

Query: 528  LLG--QGYSKVVDWWTLGVLLYEMMTGLPPYY--DEDVPKMYKKILQEPLRFP--DGFDK 581
            + G  +G     D W+LG ++ EM+TG  P++  D +   MY        + P  +    
Sbjct: 1432 ITGAKKGKFGSGDIWSLGCVILEMVTGRRPWFNLDNEWAIMYHVAAGHVPQLPTKEELSP 1491

Query: 582  DAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQL 616
               D L+  L +DP +R   + A E+  HP+  ++
Sbjct: 1492 QGIDFLLRCLKQDPNKR---STAMELLLHPWMIEI 1523

>Scas_573.10
          Length = 569

 Score =  104 bits (260), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 92/315 (29%), Positives = 139/315 (44%), Gaps = 72/315 (22%)

Query: 353 LSVDDFELLKVIGKGSFGKVMQV---RKKDTN------KVYALKAIRKSYIVS---KSEV 400
           + +  + L++ +G+G+F KV +    R   T+      K  A+K I+K+ +V    K++ 
Sbjct: 114 VELQGYTLIEKVGEGAFSKVFRAVPQRNGPTSFLCENYKEVAIKIIKKTALVGDDPKAD- 172

Query: 401 IH-----------TLAERTVLARVE--------NPFIVPLKFTFQSPDKLYIVLAFINGG 441
           IH           T ++  VL  V          P IV      +S    YIV   I+GG
Sbjct: 173 IHVAESHNRKHSKTSSKEQVLKEVSLHKAVSSGCPQIVQFIDFQESKTYYYIVQELIHGG 232

Query: 442 ELFYHLQREGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHI------ 495
           E+F  + +   FS   +R    +L  A++ LH+L V++RD+KPEN+L +    I      
Sbjct: 233 EIFGEIVKYTYFSEDLSRHVIKQLALAVQHLHSLGVVHRDIKPENLLFEPIEFIPSKEPK 292

Query: 496 ----------------------------ALCDFGLCKLNMKGQDKTNTFCGTPEYLAPEL 527
                                        L DFGL K        T T CGT  Y APE+
Sbjct: 293 LRKSDDPSTKSDEGLFVPGVGGGGIGVVKLADFGLSKQIFATN--TKTPCGTVGYTAPEV 350

Query: 528 LLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFP----DGFDKDA 583
           +  + YS  VD W +G +LY M+ G PP+YDE +  + +KI +    F     D     A
Sbjct: 351 VKDEHYSMKVDMWGVGCVLYTMLCGFPPFYDEKIDVLTEKISRGEYTFLRPWWDEISAGA 410

Query: 584 KDLLIGLLSRDPKRR 598
           K+ +I LL  DP +R
Sbjct: 411 KNAVIRLLEVDPNKR 425

>CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 521

 Score =  104 bits (259), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 72/249 (28%), Positives = 122/249 (48%), Gaps = 14/249 (5%)

Query: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTV-LARVENP 416
           F +   IG+G+FG V + +    N+V A+K +    + +  E +  LA+    LA +++P
Sbjct: 5   FVIENCIGRGNFGDVYKAKDTWLNEVVAVKVVN---LENSEEEVELLAQEIFFLAELKSP 61

Query: 417 FIVPLKFTFQSPDKLYIVLAFINGGE----LFYHLQREGRFSLSRARLYTAELLCALETL 472
           ++     T      ++I + +  GG     L YH          + R  T E+L  L  L
Sbjct: 62  YVTNYIATVVEDVSMWIAMEYCGGGSVGDLLKYHYT--SGLPEHKTRFITREILKGLSYL 119

Query: 473 HNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLL--G 530
           H+   I+RD+K  NILL  +G + L DFG+    +    + +TF GTP ++APE++    
Sbjct: 120 HSQRKIHRDIKAANILLTDEGKVKLSDFGVSG-KLLSSFRRDTFVGTPYWMAPEIVAHDS 178

Query: 531 QGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKI-LQEPLRFPDGFDKDAKDLLIG 589
           +GY +  D W+LG+ + EM+ G PP    D  K+   +  ++P +    F  DAK  +  
Sbjct: 179 EGYDERADIWSLGITVIEMLRGSPPLSKYDPMKVIANLPKRKPPKLHGDFSDDAKHFVAL 238

Query: 590 LLSRDPKRR 598
            L ++   R
Sbjct: 239 CLIKESAIR 247

>KLLA0E15378g 1362851..1365025 some similarities with sp|P08018
           Saccharomyces cerevisiae YJL128c PBS2 tyrosine protein
           kinase of the MAP kinase kinase family, hypothetical
           start
          Length = 724

 Score =  105 bits (262), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 92/308 (29%), Positives = 153/308 (49%), Gaps = 24/308 (7%)

Query: 337 GKLNLS---VDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSY 393
           GKL+LS   VD+   ++  + +D+ E L+ +G G++G V +V  K T+ + A+K +R   
Sbjct: 394 GKLSLSSKGVDFSNGSSFRIKLDELEFLEELGHGNYGNVSKVLHKPTHIIMAMKEVRLEL 453

Query: 394 IVSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGEL--FYHLQREG 451
             SK   I  L E  VL   ++P+IV     F     +Y+ + +++GG L   Y  ++ G
Sbjct: 454 DESKFRQI--LMELEVLHNCQSPYIVDFYGAFFIEGAVYMCMEYMDGGSLDKTYDDEQIG 511

Query: 452 RFSLSRARLYTAELLCALETLHNL-DVIYRDLKPENILLD-HQGHIALCDFGLCKLNMKG 509
                +    T+ ++  L+ L ++ ++I+RD+KP NIL    QG I LCDFG+    +  
Sbjct: 512 GIDEPQLARITSSVIQGLKELKDVHNIIHRDVKPTNILCSASQGTIKLCDFGVSGNLVAS 571

Query: 510 QDKTNTFCGTPEYLAPELLLG-----QGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKM 564
             KTN  C +  Y+APE +         YS   D W+LG+ + EM  G  PY  E    +
Sbjct: 572 LAKTNIGCQS--YMAPERIKSLNPDKSTYSVQSDIWSLGLSILEMALGAYPYPPETFDNI 629

Query: 565 YKKILQ----EPLRFPDG-FDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWK 619
           + ++       P + P+G F  DA++ +   L + P+RR  +    E   HP+  +    
Sbjct: 630 FSQLSAIVDGPPPKLPEGKFSADAQNFVSMCLQKIPERRPTYAALLE---HPWLKKYENV 686

Query: 620 RLWMKGYI 627
            + M  YI
Sbjct: 687 DVRMSEYI 694

>KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces
           cerevisiae YGL180w APG1 essential for autophagocytosis,
           start by similarity
          Length = 831

 Score =  105 bits (261), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 141/298 (47%), Gaps = 50/298 (16%)

Query: 353 LSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLAR 412
           L  +++ + K IGKGSF  V +       +  A+KA+ +S + +K  + +   E  +L +
Sbjct: 16  LPTENYSVEKEIGKGSFAVVYKGLSLRDGRNIAIKAVSRSKLKNKKLLENLEVEIAILKK 75

Query: 413 VENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARL------------ 460
           +++P IV L    ++    Y+++ +   G+L + +++     L    +            
Sbjct: 76  IKHPHIVGLIDCERTSSDFYLIMEYCALGDLTFFIKKRKNLVLKHPLIKTVFEHYPPPST 135

Query: 461 ------------YTAELLCALETLHNLDVIYRDLKPENILLD------------HQ-GHI 495
                       Y  +L  AL+ L + ++++RD+KP+N+LL             H+ G +
Sbjct: 136 EHNGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLCTPLLDYNDPKTFHELGFV 195

Query: 496 AL--------CDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLY 547
            +         DFG  +  +       T CG+P Y+APE+L  Q Y+   D W++G +LY
Sbjct: 196 GIYNLPILKIADFGFARF-LPNTSLAETLCGSPLYMAPEILNYQKYNAKADLWSVGTVLY 254

Query: 548 EMMTGLPPYYDEDVPKMYKKILQ--EPLRFPDGFDKDAK--DLLIGLLSRDPKRRLGF 601
           EM  G PP+   +  ++++KI +  + +  P     + K  +L+ GLL+ DP  R+GF
Sbjct: 255 EMCCGRPPFKASNHLELFQKIKKANDEITVPSNCYIEPKLFNLIRGLLTFDPDSRMGF 312

>Scas_711.25
          Length = 1515

 Score =  105 bits (261), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 81/265 (30%), Positives = 131/265 (49%), Gaps = 18/265 (6%)

Query: 362  KVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAER-----TVLARVENP 416
            ++IGKGSFG V       T ++ A+K +      S+ E I +  E      + L  +++ 
Sbjct: 1218 EMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQDEAIISTVEALRSEVSTLKDLDHL 1277

Query: 417  FIVPLKFTFQSPDKLY-IVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNL 475
             IV     F++ D +Y + L ++ GG +   ++  GRF     R    ++L  L  LH+ 
Sbjct: 1278 NIVQY-LGFENKDNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIRHLNTQVLRGLAYLHSR 1336

Query: 476  DVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTN-TFCGTPEYLAPELL-LGQGY 533
             +++RD+K +N+LLD  G   + DFG+ + +      ++ T  GT  ++APE++   QGY
Sbjct: 1337 GILHRDMKADNLLLDQDGVCKISDFGISRKSKDIYSNSDMTMRGTVFWMAPEMVDTKQGY 1396

Query: 534  SKVVDWWTLGVLLYEMMTGLPPYYD-EDVPKMYK--KILQEPLRFPDGF---DKDAKDLL 587
            S  VD W+LG ++ EM  G  P+ + E V  M+K  K    P   PD      ++ +D L
Sbjct: 1397 SAKVDIWSLGCIVLEMFAGKRPWSNYEVVAAMFKIGKSKSAPPIPPDTLPLISQNGRDFL 1456

Query: 588  IGLLSRDPKRRLGFNGADEIKSHPF 612
                  DP  R     AD + SHPF
Sbjct: 1457 DACFEIDPDNRP---TADNLLSHPF 1478

>Scas_618.15
          Length = 620

 Score =  103 bits (258), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 93/355 (26%), Positives = 147/355 (41%), Gaps = 87/355 (24%)

Query: 358 FELLKVIGKGSFGKVMQVR-----------KKDTNKVYALKAIRK--------------S 392
           ++LL  IGKG+F  V +             K+  N+V A+K I+K              S
Sbjct: 156 YKLLNKIGKGAFAVVYRAIPDPQNGKSSYFKEVCNEV-AIKIIKKVDLSEDLKDHERDTS 214

Query: 393 YIVSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGR 452
           ++ S+ +V+       V A  E   +V      ++    YIV  +++GGE++  + R   
Sbjct: 215 HVSSREQVLKEACLHKV-ASSECSEVVGFIDFVETKSYYYIVQEYLHGGEIYDQIVRLTY 273

Query: 453 FSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHI----------------- 495
           FS    R    +L  A++ LH++ +I+RD+KPEN+L +   HI                 
Sbjct: 274 FSEDLTRHVIRQLAHAVKHLHSMGIIHRDIKPENLLFEPIQHIPSTHVKLRKTDNPFTKV 333

Query: 496 -----------------ALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVD 538
                             L DFGL K      + TNT CGT  Y APEL+    Y   +D
Sbjct: 334 DEGMFRPAIGGGGIGAVKLTDFGLSK--QLSTETTNTPCGTISYAAPELIRNHQYDNKID 391

Query: 539 WWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFP----DGFDKDAKDLLIGLLSRD 594
            W +G +LY ++ G PP+Y +    + +KI      F     D     AK+ +  LL  D
Sbjct: 392 LWGIGCVLYTLLCGFPPFYADQHKSVTRKIRHGEYHFLSPWWDEISSGAKNCVKHLLEVD 451

Query: 595 PKRRLGFNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVM-------NSLDTSN 642
             +R      D++ + P          W+     P  PP+        +++DTSN
Sbjct: 452 VSKRYNI---DDLLADP----------WLNMNSSPVNPPIKSIFSHTNDNIDTSN 493

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score =  103 bits (257), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 77/270 (28%), Positives = 132/270 (48%), Gaps = 19/270 (7%)

Query: 356 DDFELLKVIGKGSFGKV-MQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVE 414
           D FE    IG+G+ G V +   + D ++  A+K +       K  +++   E  V++  +
Sbjct: 564 DKFETYLKIGQGASGGVYLSHSRSDKSQCVAIKQMNLEKQPKKELIVN---EIMVMSSSK 620

Query: 415 NPFIVPLKFTFQSPDKLYIVLAFINGGELF----YHLQREGRFSLSRARLYTAELLCALE 470
           +  IV    ++ S   L++V+ ++ GG L     Y +  EG+           E+L  LE
Sbjct: 621 HQNIVNYIDSYLSGLDLWVVMEYMEGGCLTDVVTYCVLTEGQIGA-----VCREVLQGLE 675

Query: 471 TLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLG 530
            LH+  V++RD+K +N+LL   G I L DFG C        K  T  GTP ++APE++  
Sbjct: 676 FLHSKGVLHRDIKSDNVLLSMNGDIKLTDFGFCAQVNDTVIKRTTMVGTPYWMAPEIVSR 735

Query: 531 QGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKIL---QEPLRFPDGFDKDAKDLL 587
           + Y   VD W+LG+++ EM+ G PPY +E   +    I    +  ++ PD   KD K+ +
Sbjct: 736 KEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGRPEVQEPDRLSKDFKEFI 795

Query: 588 IGLLSRDPKRRLGFNGADEIKSHPFFSQLS 617
              L+     R     + E+  H F ++++
Sbjct: 796 DKCLAVTVSERA---ESSELLQHKFITEVA 822

>ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH]
           (1386601..1388079) [1479 bp, 492 aa]
          Length = 492

 Score =  101 bits (251), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 88/307 (28%), Positives = 146/307 (47%), Gaps = 50/307 (16%)

Query: 355 VDDFELL-KVIGKGSFGKVMQVRKKDTNKV-----YALKAIR---------KSYIVSKSE 399
           V ++E+  +V+G G+FG+V+   +K  +       YA+K IR          S +V  + 
Sbjct: 139 VGEWEITPQVVGSGTFGQVLVAERKSAHSKHRPLNYAVKVIRMKREALAKEASILVRLNH 198

Query: 400 V--IHTLAERTVLARVENPFIVPLKFTF-QSPDKLYIVLAFINGGELFYHLQRE---GRF 453
           V  I T  E  VL R + P ++ +  TF    D +YI    + GG+LF +L ++      
Sbjct: 199 VSGIETTGEEHVLTRGQ-PNVIKVHDTFVDENDNIYIFEDLVAGGDLFSYLAKKDCLAPI 257

Query: 454 SLSRARLYTAELLCALETLHNLDVIYRDLKPENILL---DHQGHIALCDFGLCKLNMKGQ 510
           S + A +   ++L AL+ LH+  +++RDLK +NILL   +    I L DFG+ K     +
Sbjct: 258 SETEALVIVYQILQALKFLHSKGIVHRDLKLDNILLCTPEPCSRIVLADFGIAKDLPSTR 317

Query: 511 DKTNTFCGTPEYLAPEL-----------------LLGQGYSKVVDWWTLGVLLYEMMTGL 553
            + +T  GTPEY APE+                 +  QGY    D W+LGV+ + M+TG+
Sbjct: 318 VRMHTIVGTPEYCAPEVGFRVDRNSYRNFSRTASMEQQGYDFKCDLWSLGVMTHIMLTGI 377

Query: 554 PPYY-DEDVPKMYKKILQEPLRFPD----GFDKDAKDLLIGLLSRDPKRRLGFNGADEIK 608
            P+Y D     + + +    L F      G    AK  +  LL  + ++R+      +  
Sbjct: 378 SPFYGDGTEASIIRNVKIGKLNFGTKQWVGVSDTAKSFVRQLLEVNAEKRMSVQ---DCF 434

Query: 609 SHPFFSQ 615
            HP+ ++
Sbjct: 435 KHPWIAK 441

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score =  102 bits (254), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 80/265 (30%), Positives = 126/265 (47%), Gaps = 26/265 (9%)

Query: 364 IGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPFIVPLKF 423
           IG+G+ G V      ++    A+K +       K E+I  L E  V+   ++  IV    
Sbjct: 626 IGQGASGGVYIAHDTESEDSVAIKQMNLEK-QPKKELI--LNEILVMRESKHSNIVNFID 682

Query: 424 TFQSPDKLYIVLAFINGGELF----YHLQREGRFSLSRARLYTAELLCALETLHNLDVIY 479
           ++ +   L+IV+ ++ GG L     + L  EG+           E L  L+ LH+  V++
Sbjct: 683 SYLAKGDLWIVMEYMEGGSLTDVVTHCLLSEGQIGA-----VCRETLKGLQFLHSKGVLH 737

Query: 480 RDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVDW 539
           RD+K +NILL  +G+I L DFG C    +   K  T  GTP ++APE++  + Y   VD 
Sbjct: 738 RDIKSDNILLSLKGNIKLTDFGFCAQINENNLKRTTMVGTPYWMAPEVVSRKEYGPKVDI 797

Query: 540 WTLGVLLYEMMTGLPPYYDEDVPKMYKKI-------LQEPLRFPDGFDKDAKDLLIGLLS 592
           W+LG+++ EM+ G PPY +E   +    I       L+EP    D   K     L   L 
Sbjct: 798 WSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPEALSDTLTK----FLDWCLK 853

Query: 593 RDPKRRLGFNGADEIKSHPFFSQLS 617
            DP  R     A E+   PF ++++
Sbjct: 854 VDPSERA---TATELLDDPFITEIA 875

>Kwal_47.17263
          Length = 1127

 Score =  102 bits (254), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 84/330 (25%), Positives = 150/330 (45%), Gaps = 62/330 (18%)

Query: 341 LSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAI--------RKS 392
           +S++Y P + R + ++ +E++  +G+G  GKV   R   T ++ A+K +        R S
Sbjct: 89  ISLEYDPISKRKV-LNTYEIIGELGQGQHGKVKLARDLVTKQLVAIKIVDRNGGKSNRFS 147

Query: 393 YIVSKSEVIHTLAERTVLARVENPFIVPLKFTF--QSPDKLYIVLAFINGGELFY----H 446
           +  + +       E  ++ +  +  +V L       +  K+Y+VL + + GE+ +     
Sbjct: 148 FKKNTNGSDKIKREIAIMKKCHHEHVVKLVEVLDDSTSRKIYLVLEYCSKGEVKWCPGDQ 207

Query: 447 LQREGR----FSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGL 502
           L+ E R     +  RAR     ++  LE LH   +I+RD+KP N+L+   G + + DFG+
Sbjct: 208 LETEARGPPLLTFQRAREIFRGVVLGLEYLHYQGIIHRDIKPANLLISESGTVKISDFGV 267

Query: 503 CKLNMKGQDKTNTF--------CGTPEYLAPELLLGQGYSKV-----------------V 537
                K      +          GTP + APE+ LG   S+                  +
Sbjct: 268 SFAASKSGAGYGSLDELELAKTAGTPAFFAPEICLGHEASERFAPDRPSSDHGSIISYNI 327

Query: 538 DWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRF-------PDGFDK--------D 582
           D W +GV L+ ++ G+ P++ E   +++ KI+ + L          +G  K         
Sbjct: 328 DIWAIGVTLHCLLFGMLPFFSEFELELFDKIINQELVLKTYEEMASNGISKISNQEEYEA 387

Query: 583 AKDLLIGLLSRDPKRRLGFNGADEIKSHPF 612
           AKDLL  LL+++P +R+      EIK HPF
Sbjct: 388 AKDLLGRLLTKNPFKRIKIA---EIKKHPF 414

>Kwal_33.14081
          Length = 580

 Score =  101 bits (251), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 95/339 (28%), Positives = 158/339 (46%), Gaps = 35/339 (10%)

Query: 337 GKLNLS---VDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSY 393
           GKL+LS   VD+   ++  +++D+ E L+ +G G++G V +V  K TN + A+K +R   
Sbjct: 250 GKLSLSSQGVDFSNGSSFRITLDELEFLEELGHGNYGNVSKVLHKPTNVIMAMKEVR--L 307

Query: 394 IVSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRF 453
            + +S+    L E  VL + ++P+IV     F     +Y+ + +++GG L      +   
Sbjct: 308 ELDESKFTQILMELEVLHKCQSPYIVDFYGAFFIEGAVYMCMEYMDGGSLDKSYDSDVLG 367

Query: 454 SLSRARL-YTA----ELLCALETLHNLDVIYRDLKPENILLD-HQGHIALCDFGLCKLNM 507
            +    L Y A    + L  L+ +HN  +I+RD+KP N+L    QG + LCDFG+    +
Sbjct: 368 GIDEPELAYIANAIIQGLKELKDVHN--IIHRDVKPTNVLCSAAQGTVKLCDFGVSGNLV 425

Query: 508 KGQDKTNTFCGTPEYLAPELLLG-----QGYSKVVDWWTLGVLLYEMMTGLPPY----YD 558
               KTN  C +  Y+APE +         Y+   D W+LG+ + EM  G  PY    +D
Sbjct: 426 ASLAKTNIGCQS--YMAPERIKSFNPDKATYTVQSDIWSLGLSILEMAIGTYPYPVETFD 483

Query: 559 EDVPKMYKKILQEPLRFPDG-FDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLS 617
               ++   +   P + P G F   A+D +   L + P+RR  +    E   HP+     
Sbjct: 484 NIFSQLSAIVDSPPPQLPKGRFSPMAQDFVNMCLQKIPERRRNYAALLE---HPWLKTHH 540

Query: 618 WKRLWMKGYIPPYKPPVMNSLDTSNFDQEFTKELPVDSV 656
              + M  YI        N L+      E +   P  S+
Sbjct: 541 LSEVNMSEYI-------ANRLERKRVATEESGSQPTKSI 572

>Kwal_27.9773
          Length = 406

 Score = 99.8 bits (247), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 79/285 (27%), Positives = 135/285 (47%), Gaps = 45/285 (15%)

Query: 356 DDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVEN 415
           +++++L+ IG+GSFG V +V    TN+V   K I+  ++ SK E    ++E  +L+++++
Sbjct: 17  NEYQVLEEIGRGSFGSVRKVVHVPTNRVLVRKEIKYGHMNSK-ERQQLISECAILSQLKH 75

Query: 416 PFIVPLKFTFQSPDKLYIVLAFINGGEL---FYHLQREGRFSLSRA-------------R 459
             IV         D LY  + + + G+L     H ++E ++   R              R
Sbjct: 76  ENIVEFYEWDSDVDVLYFYMEYCSNGDLSQMISHFKKERKYIPERLVWSVMVQVLVALYR 135

Query: 460 LYTAELLCALETLHNL---------DVIYRDLKPENILLDHQG----------------H 494
            +    L  LET+++           VI+RDLKP NI L  +                  
Sbjct: 136 CHYGSDLAPLETIYDRMKPPVKGSNVVIHRDLKPGNIFLSTERVPDARVALQAFDYSKIS 195

Query: 495 IALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLP 554
           + L DFGL K      +   T+ GTP Y++PE+L+ Q YS + D W+LG ++YEM T  P
Sbjct: 196 VKLGDFGLAKSLGASVEFATTYVGTPYYMSPEVLMDQPYSPLSDIWSLGCVIYEMCTLRP 255

Query: 555 PYYDEDVPKMYKKILQEPL-RFPDGFDKDAKDLLIGLLSRDPKRR 598
           P+  +   ++ ++I      R PD +  + + L+   +  DP  R
Sbjct: 256 PFQAKTYTELQRRIKTAKFDRIPDYYSDELQMLIESCI--DPNLR 298

>Kwal_26.7861
          Length = 955

 Score =  102 bits (253), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 79/259 (30%), Positives = 124/259 (47%), Gaps = 20/259 (7%)

Query: 364 IGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPFIVPLKF 423
           IG+G+ G V    +  TN   A+K +       K  +I+   E  V+   ++  IV    
Sbjct: 673 IGQGASGGVYTAYEVGTNASVAIKQMNLEKQPKKELIIN---EILVMKASKHANIVNFID 729

Query: 424 TFQSPDKLYIVLAFINGGELF----YHLQREGRF-SLSRARLYTAELLCALETLHNLDVI 478
           ++     L++V+ ++ GG L     + +  EG+  ++SR      E L  L+ LH+  VI
Sbjct: 730 SYLLRGDLWVVMEYMEGGSLTDVVTHCILTEGQIGAVSR------ETLKGLQFLHSKGVI 783

Query: 479 YRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVD 538
           +RD+K +N+LL   G I L DFG C    +   K  T  GTP ++APE++  + Y   VD
Sbjct: 784 HRDIKSDNVLLSMSGEIKLTDFGFCAQINEINLKRTTMVGTPYWMAPEVVSRKEYGPKVD 843

Query: 539 WWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQE---PLRFPDGFDKDAKDLLIGLLSRDP 595
            W+LG+++ EM+ G PPY +E   +    I       L+  D    D K  L   L  +P
Sbjct: 844 IWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELKDADSLSDDLKSFLGWCLHVNP 903

Query: 596 KRRLGFNGADEIKSHPFFS 614
             R     A ++ S PF S
Sbjct: 904 DERA---TASQLLSDPFIS 919

>KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent ser/thr
           protein kinase, start by similarity
          Length = 546

 Score =  100 bits (249), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 85/308 (27%), Positives = 135/308 (43%), Gaps = 71/308 (23%)

Query: 357 DFELLKVIGKGSFGKVMQVRKKDTN-------------KVYALKAIRKSYI--------- 394
           D+ L++ IG+G+F KV +     +N             K  A+K I K  +         
Sbjct: 119 DYTLIQKIGEGAFSKVYRGIPSTSNCSNGASSVIAQQYKEVAIKVIIKQQLPNTNKKGDE 178

Query: 395 -----VSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLY-IVLAFINGGELFYHLQ 448
                 +  +V+  +A   +++  EN  IV     FQ  +K Y I+   + GGE+F  + 
Sbjct: 179 KNGKTSTAEQVLKEIAIHKIVSSGEN--IVSF-IDFQESEKYYYIIQELLAGGEIFGEIV 235

Query: 449 REGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLD------------------ 490
           +   FS   +R    +L  A++ +H L +++RD+KPEN+L +                  
Sbjct: 236 KYTYFSEDLSRHVIRQLANAVKYMHQLGIVHRDIKPENLLFEPIDFIPNPKPKLRSSDDP 295

Query: 491 ----------------HQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYS 534
                             G + L DFGL K     Q  T T CGT  Y APE++  + YS
Sbjct: 296 STKLDEGVFRPGIGGGGIGVVKLADFGLSKQIY--QTNTKTPCGTVGYTAPEVVKDERYS 353

Query: 535 KVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRF--P--DGFDKDAKDLLIGL 590
             VD W +G +LY ++ G PP++DE +  + +KI +    F  P  D     AK+ +  L
Sbjct: 354 MQVDMWGVGCVLYTVLCGFPPFFDEKIDVLTEKISRGEYTFLRPWWDQISDGAKNCVRKL 413

Query: 591 LSRDPKRR 598
           L  DP +R
Sbjct: 414 LEVDPAKR 421

>CAGL0M11748g 1167306..1168649 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1, start by
           similarity
          Length = 447

 Score = 99.8 bits (247), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 95/338 (28%), Positives = 152/338 (44%), Gaps = 75/338 (22%)

Query: 361 LKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERT-----VLARVEN 415
           L  +G G+FG V       TN+  A+K I K +  +       LA+RT     +L  + +
Sbjct: 26  LNPVGMGAFGLVCSATDTLTNQQVAIKKIMKPFATA------VLAKRTYRELKLLKHLRH 79

Query: 416 PFIVPLKFTFQSP-DKLYIVLAFINGGELFYHLQR---EGRFSLSRARLYTAELLCALET 471
             ++ L+  F SP + +Y V   + G +L   LQ    E +F     + +  ++L  L+ 
Sbjct: 80  ENLICLQDIFLSPLEDIYFVTE-LQGTDLHRLLQTRPLEKQF----VQYFHYQILRGLKY 134

Query: 472 LHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNT-FCGTPEYLAPELLLG 530
           +H+  V++RDLKP NIL++    + +CDFGL ++    QD   T +  T  Y APE++L 
Sbjct: 135 VHSAGVVHRDLKPSNILINENCDLKICDFGLARI----QDPQMTGYVSTRYYRAPEIMLT 190

Query: 531 -QGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKIL-------------------- 569
            Q Y   VD W+ G +  EM+ G P +  +D    +  I                     
Sbjct: 191 WQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPSDVIDTICSENTL 250

Query: 570 --------QEPLRFPDGF---DKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSW 618
                   ++P+ F + F   + DA DLL  +L  DPK+R+    AD + +HP       
Sbjct: 251 KFVTSLPHRDPIPFSERFKTVEPDAVDLLEKMLVFDPKKRI--TAADAL-AHP------- 300

Query: 619 KRLWMKGYIPPYKPPVMNSLDTSNFDQEFT-KELPVDS 655
                  Y+ PY  P    +  + FD  F   +LPVD+
Sbjct: 301 -------YLAPYHDPTDEPVAEAKFDWHFNDADLPVDT 331

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score =  101 bits (252), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 71/210 (33%), Positives = 105/210 (50%), Gaps = 14/210 (6%)

Query: 364  IGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLA-ERTVLARVENPFIVPLK 422
            IG GSFG V      DT  + A+K I+ +   +  +V  ++  E TVL  + +P +V   
Sbjct: 1197 IGGGSFGSVYSAVNLDTGDILAVKEIKFNDRKTIKQVFPSIRDEMTVLEMLNHPNVVQYY 1256

Query: 423  FTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRA-RLYTAELLCALETLHNLDVIYRD 481
                  D++ I + +  GG L   L   GR       ++Y+ ++L  L  LH   V +RD
Sbjct: 1257 GVEVHRDRVNIFMEYCEGGSL-ASLLAHGRIEDEMVTQVYSLQMLEGLAYLHESGVDHRD 1315

Query: 482  LKPENILLDHQGHIALCDFGLC---------KLNMKGQDKTNTFCGTPEYLAPELLLGQG 532
            +KPENILLD  G I   DFG           KLN++   +     GTP Y++PE + G G
Sbjct: 1316 IKPENILLDFNGIIKYVDFGAAKVLASNGSKKLNLEQHMEGEKMIGTPMYMSPEAISGTG 1375

Query: 533  YSKVV--DWWTLGVLLYEMMTGLPPYYDED 560
            Y K    D W+LG ++ EM+TG  P+ + D
Sbjct: 1376 YGKFGSDDIWSLGCVILEMVTGRRPWANLD 1405

>Kwal_56.23841
          Length = 432

 Score = 98.6 bits (244), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 96/338 (28%), Positives = 152/338 (44%), Gaps = 75/338 (22%)

Query: 361 LKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERT-----VLARVEN 415
           L  +G G+FG V       TN+  A+K I K +  +       LA+RT     +L  + +
Sbjct: 26  LNPVGMGAFGLVCSANDTYTNQSVAIKKIMKPFSTA------VLAKRTYRELKLLKHLRH 79

Query: 416 PFIVPLKFTFQSP-DKLYIVLAFINGGELFYHLQR---EGRFSLSRARLYTAELLCALET 471
             ++ L+  F SP + +Y V   + G +L   LQ    E +F     + +  ++L  L+ 
Sbjct: 80  ENLICLEDIFLSPLEDIYFVTE-LQGTDLHRLLQTRPLEKQF----VQYFLYQILRGLKY 134

Query: 472 LHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNT-FCGTPEYLAPELLLG 530
           +H+  VI+RDLKP NIL++    + +CDFGL ++    QD   T +  T  Y APE++L 
Sbjct: 135 VHSAGVIHRDLKPSNILINENCDLKICDFGLARI----QDPQMTGYVSTRYYRAPEIMLT 190

Query: 531 -QGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKIL-------------------- 569
            Q Y+  VD W+ G +  EM+ G P +  +D    +  I                     
Sbjct: 191 WQKYNVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPEDVINTICSVNTL 250

Query: 570 --------QEPLRFPDGF---DKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSW 618
                   ++P+ F + F   + DA DLL  +L  DP +R+    AD + SHP       
Sbjct: 251 KFVTSLPHRDPVPFSERFKNVEPDAVDLLEKMLVFDPNKRI--TAADAL-SHP------- 300

Query: 619 KRLWMKGYIPPYKPPVMNSLDTSNFDQEFT-KELPVDS 655
                  Y+ PY  P    +  + FD  F   +LPVD+
Sbjct: 301 -------YLAPYHDPTDEPVADAKFDWHFNDADLPVDT 331

>Scas_675.2
          Length = 527

 Score = 99.8 bits (247), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 83/285 (29%), Positives = 140/285 (49%), Gaps = 38/285 (13%)

Query: 355 VDDFELLKVIGKGSFGKVMQVR-KKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVL--A 411
           + D  L   IG+GSFG VM      D + + A+K +       K+ +      R VL  +
Sbjct: 12  IKDVVLGDTIGQGSFGCVMNAHLAVDPSVIIAVKYVHIP-TCKKNGLTEKDISREVLLHS 70

Query: 412 RV-ENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALE 470
           R  +NP ++ L     + D +++++   +GG+LF  ++ +       A+ Y  +L+ A+ 
Sbjct: 71  RCSKNPNVLRLIDCNIAKDYMWMIMEMADGGDLFDKIEPDVGVDSEVAQFYFQQLVRAIS 130

Query: 471 TLHN-LDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFC----GTPEYLAP 525
            LH    V +RD+KPENILLD  G++ L DFGL     + +D T        G+P Y+AP
Sbjct: 131 YLHEECGVAHRDIKPENILLDKNGNLKLADFGLSS-QYRRKDGTLRISTDQRGSPPYMAP 189

Query: 526 ELLLGQG-YSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDKDAK 584
           E+L  +G Y+   D W++G+LL+ ++TG  P+   ++P +      E L F      +  
Sbjct: 190 EILHSRGYYAHSTDIWSIGILLFVLLTGETPW---ELPVI------EELNFASFLQNNGN 240

Query: 585 --------------DLLIGLLSRDPKRRLGFNGADEIKSHPFFSQ 615
                         +LL  +L  DPK+R        ++SHP+F++
Sbjct: 241 LNLGPWAKIEFFHLNLLRKILQPDPKKRATLK---ILRSHPWFTK 282

>Scas_668.22
          Length = 893

 Score =  100 bits (249), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 70/242 (28%), Positives = 117/242 (48%), Gaps = 15/242 (6%)

Query: 364 IGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPFIVPLKF 423
           IG+G+ G V    +  +N+  A+K +       K  +I+   E  V+    +P IV    
Sbjct: 617 IGQGASGGVYIANEIGSNESVAIKQMNLEKQPKKELIIN---EILVMKGSRHPNIVNFID 673

Query: 424 TFQSPDKLYIVLAFINGGELF----YHLQREGRFSLSRARLYTAELLCALETLHNLDVIY 479
           ++     L++++ ++ GG L     + +  EG+           E L  L+ LH+  V++
Sbjct: 674 SYLLDGDLWVIMEYMEGGSLTDVVTHCILTEGQIGA-----VCRETLSGLQFLHSKGVLH 728

Query: 480 RDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVDW 539
           RD+K +NILL   G I L DFG C    +   K  T  GTP ++APE++  + Y   VD 
Sbjct: 729 RDIKSDNILLSISGDIKLTDFGFCAQINEINLKRTTMVGTPYWMAPEVVSRKEYGPKVDI 788

Query: 540 WTLGVLLYEMMTGLPPYYDEDVPKMYKKILQE---PLRFPDGFDKDAKDLLIGLLSRDPK 596
           W+LG+++ EM+ G PPY +E   +    I       L+ P+      ++ L   L  DP+
Sbjct: 789 WSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELKEPENLSAVLRNFLDWCLKVDPE 848

Query: 597 RR 598
           +R
Sbjct: 849 QR 850

>CAGL0B03509g complement(349638..351431) similar to sp|P38623
           Saccharomyces cerevisiae YLR248w RCK2
           Ca/calmodulin-dependent or sp|P38622 Saccharomyces
           cerevisiae YGL158w RCK1, start by similarity
          Length = 597

 Score = 99.4 bits (246), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 75/296 (25%), Positives = 129/296 (43%), Gaps = 52/296 (17%)

Query: 341 LSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEV 400
           L+ +YK    + +S  D ++     +    +  + ++ +TN++ + + + K   + K+  
Sbjct: 178 LARNYKQVAVKVISKHDLDVSNKEQQAKDKRAGRDKQNNTNRMSSREQVMKEVRIHKA-- 235

Query: 401 IHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARL 460
                   V A    P+IV      ++    Y++   ++GGE+F  + R    S   +R 
Sbjct: 236 --------VAAGC--PYIVGFIDFQETKHYYYLIQELLDGGEIFNEIVRLTYLSEDLSRH 285

Query: 461 YTAELLCALETLHNLDVIYRDLKPENILLDHQGHI------------------------- 495
              ++  A+  +H+L +++RD+KPEN+L     +I                         
Sbjct: 286 VIKQVALAVRHMHSLGIVHRDIKPENLLFKSIEYIPSKKRTFRKSDDPATKADEGVFIPT 345

Query: 496 ---------ALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLL 546
                     L DFGL K     Q  T T CGT  Y APE++  + YS  VD W +G +L
Sbjct: 346 IGGGGIGIVKLADFGLSKQIF--QKNTKTPCGTIGYTAPEVVKDEKYSMQVDMWGIGCVL 403

Query: 547 YEMMTGLPPYYDEDVPKMYKKILQEPLRFP----DGFDKDAKDLLIGLLSRDPKRR 598
           Y M+ G PP+YDE +  + +KI +    F     D     AK  +  LL  DP++R
Sbjct: 404 YTMLCGFPPFYDEKIDVLTEKISRGEYTFLEPWWDEISPGAKHCVKKLLEVDPRKR 459

>CAGL0M03729g complement(420316..422901) similar to sp|P48562
           Saccharomyces cerevisiae YNL298w CLA4, start by
           similarity
          Length = 861

 Score = 99.8 bits (247), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 71/238 (29%), Positives = 116/238 (48%), Gaps = 21/238 (8%)

Query: 387 KAIRKSYIVSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYH 446
           K  RK  IV++  V++        +R EN  +  L+   ++ D L++V+ ++ GG L   
Sbjct: 619 KQPRKELIVNEIMVMND-------SRHEN-IVNFLEAYLKTEDDLWVVMEYMEGGSLTDI 670

Query: 447 LQRE-----GRFSLSRARL-YTAELLC-ALETLHNLDVIYRDLKPENILLDHQGHIALCD 499
           ++           LS  ++ Y     C  L+ LH+ ++I+RD+K +N+LLD +  + + D
Sbjct: 671 IENSPTNGSAYSPLSEPQIAYIVRETCKGLKFLHDKNIIHRDIKSDNVLLDTKARVKITD 730

Query: 500 FGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDE 559
           FG C      + K  T  GTP ++APE++  + Y   VD W+LG++  EM+ G PPY +E
Sbjct: 731 FGFCAKLTDQRSKRATMVGTPYWMAPEVVKQKEYDAKVDVWSLGIMAIEMLEGEPPYLNE 790

Query: 560 DVPKMYKKILQE---PLRFPDGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFS 614
           D  K    I       L+ P     + K  L   L  D K R      +E+  H FF+
Sbjct: 791 DPLKALYLIATNGTPKLKHPQSLSLEIKRFLSVCLCVDVKYRA---STEELLHHSFFN 845

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 98.6 bits (244), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 84/313 (26%), Positives = 141/313 (45%), Gaps = 46/313 (14%)

Query: 345 YKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAI-----RKSYIVS-KS 398
           Y P T R + +++FE+L  +G G +GKV   R   T  + A+K +     R  Y +  K 
Sbjct: 38  YNPLTKRQI-LNNFEILATLGNGQYGKVKLARDLGTGALVAIKILNRFEKRSGYSLQLKV 96

Query: 399 EVIHTLAERTVLARVENPFIVPLKFTFQSPD--KLYIVLAFINGGELFYHLQREGR---- 452
           E      E  V+ R  +  +V L      P+  K+Y+VL + + G + +  + +      
Sbjct: 97  ENPRVNQEIEVMKRCHHENVVELYEILNDPESTKVYLVLEYCSRGPVKWCPENKMEIKAV 156

Query: 453 ----FSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMK 508
                +  ++R    +++  LE LH+  + +RD+KP N+L+   G + + DFG+      
Sbjct: 157 GPSILTFQQSRKVVLDVVSGLEYLHSQGITHRDIKPSNLLISSNGTVKISDFGVAMSTAT 216

Query: 509 GQDKTNT---------FCGTPEYLAPELLLGQ---GYSKVVDWWTLGVLLYEMMTGLPPY 556
           G     +           GTP + APEL   +     S  +D W+LGV +Y ++ G  P+
Sbjct: 217 GSTNIQSSHEQLLKSRALGTPAFFAPELCSTEKEYSCSSAIDIWSLGVTIYCLLFGKLPF 276

Query: 557 YDEDVPKMYKKILQEPLRFPDGFD--------------KDAKDLLIGLLSRDPKRRLGFN 602
                 +++  I+ +PL FP   +               DAKDLL  LL +DP +R+   
Sbjct: 277 NANSGLELFDSIINKPLEFPSYEEMLNGATSGITMEEYTDAKDLLKKLLQKDPDKRIKL- 335

Query: 603 GADEIKSHPFFSQ 615
              +IK HPF   
Sbjct: 336 --ADIKVHPFMCH 346

>CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces
           cerevisiae YOR231w MKK1 ser/thr protein kinase or
           sp|P32491 Saccharomyces cerevisiae YPL140c MKK2, start
           by similarity
          Length = 467

 Score = 97.8 bits (242), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 68/208 (32%), Positives = 102/208 (49%), Gaps = 13/208 (6%)

Query: 357 DFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHT--LAERTVLARVE 414
           + E   V+G+G+ G V + + +   KV+ALK I    I++         L E       +
Sbjct: 179 EIETQGVLGEGAGGSVAKCKLRTGKKVFALKTIN---ILNGDPEFQKQLLRELQFNKSFK 235

Query: 415 NPFIVPL--KFTFQSPDKLYIVLAFINGG--ELFYH--LQREGRFSLSRARLYTAELLCA 468
           + +IV     FT +    +YI + ++ G   E  Y   L R GR S       +  +L  
Sbjct: 236 SEYIVRYFGMFTDEQNSSIYIAMEYMGGKSLEAIYKELLSRGGRISEKVLGKISEAVLRG 295

Query: 469 LETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELL 528
           L  LH   VI+RD+KP+NILL+  G + LCDFG+    +       TF GT  Y+APE +
Sbjct: 296 LSYLHEKKVIHRDIKPQNILLNEDGQVKLCDFGVSGEAV--NSLATTFTGTSYYMAPERI 353

Query: 529 LGQGYSKVVDWWTLGVLLYEMMTGLPPY 556
            GQ YS   D W+LG+ + E+  G  P+
Sbjct: 354 QGQPYSVTCDVWSLGLTILEVAQGHFPF 381

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 99.0 bits (245), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 63/200 (31%), Positives = 102/200 (51%), Gaps = 12/200 (6%)

Query: 364 IGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPFIVPLKF 423
           IG+G+ G V    +  TN   A+K +       K  +I+   E  V+    +  IV    
Sbjct: 689 IGQGASGGVYTAYEIGTNASVAIKQMNLEKQPKKELIIN---EILVMKGSRHNNIVNFID 745

Query: 424 TFQSPDKLYIVLAFINGGELF----YHLQREGRFSLSRARLYTAELLCALETLHNLDVIY 479
           ++     L++++ ++ GG L     + +  EG+ +       + E L  L  LH+  VI+
Sbjct: 746 SYLLKGDLWVIMEYMEGGSLTDVVTHCILTEGQIAA-----VSRETLRGLHFLHSKGVIH 800

Query: 480 RDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVDW 539
           RD+K +NILL   G+I L DFG C    +   K  T  GTP ++APE++  + Y   VD 
Sbjct: 801 RDIKSDNILLSMDGNIKLTDFGFCAQINETNLKRTTMVGTPYWMAPEVVSRKEYGPKVDI 860

Query: 540 WTLGVLLYEMMTGLPPYYDE 559
           W+LG+++ EM+ G PPY +E
Sbjct: 861 WSLGIMIIEMIEGEPPYLNE 880

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 99.0 bits (245), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 105/201 (52%), Gaps = 14/201 (6%)

Query: 364 IGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPFIVPLKF 423
           IG+G+ G V    +  TN   A+K +       K  +++   E  V+   ++  IV    
Sbjct: 704 IGQGASGGVYTAYELGTNASVAIKQMNLEKQPKKELIVN---EILVMKGSKHNNIVNFID 760

Query: 424 TFQSPDKLYIVLAFINGGELF----YHLQREGRF-SLSRARLYTAELLCALETLHNLDVI 478
           ++     L++V+ ++ GG L     + +  EG+  ++SR      E L  L+ LH+  VI
Sbjct: 761 SYLFRGDLWVVMEYMEGGSLTDVVTHCILTEGQIGAVSR------ETLKGLQFLHSKGVI 814

Query: 479 YRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVD 538
           +RD+K +NILL   G I L DFG C    +   K  T  GTP ++APE++  + Y   VD
Sbjct: 815 HRDIKSDNILLSMNGDIKLTDFGFCAQINEVNLKRTTMVGTPYWMAPEVVSRKEYGPKVD 874

Query: 539 WWTLGVLLYEMMTGLPPYYDE 559
            W+LG+++ EM+ G PPY +E
Sbjct: 875 IWSLGIMIIEMIEGEPPYLNE 895

>Kwal_26.8703
          Length = 444

 Score = 97.1 bits (240), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 103/205 (50%), Gaps = 9/205 (4%)

Query: 363 VIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPFIVPL- 421
           V+G+G+ G V + + K  + V+ALK I  +    +++    L E        + +IV   
Sbjct: 162 VLGEGAGGSVTKCKLKGGSMVFALKTITTANSDPETQK-QVLRELQFNRSCSSEYIVRYY 220

Query: 422 -KFTFQSPDKLYIVLAFINGGEL---FYHL-QREGRFSLSRARLYTAELLCALETLHNLD 476
             F  +S   +YI + ++ G  L   + HL +R GR            +L  L  L    
Sbjct: 221 GMFAEESTSSIYIAMEYMGGKSLDAIYKHLLERGGRIGEKVLGKIAESVLKGLSYLQERK 280

Query: 477 VIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKV 536
           +I+RD+KP+NILL+  G + LCDFG+  + +       TF GT  Y+APE + GQ YS  
Sbjct: 281 IIHRDIKPQNILLNEAGQVKLCDFGVSGVAV--NSLATTFTGTSFYMAPERIQGQPYSVT 338

Query: 537 VDWWTLGVLLYEMMTGLPPYYDEDV 561
            D W+LG+ L E+  G  P+  +++
Sbjct: 339 SDVWSLGLTLLEVAQGQFPFGSDNM 363

>KLLA0F23507g complement(2198603..2200066) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, start by similarity
          Length = 487

 Score = 97.4 bits (241), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 65/225 (28%), Positives = 114/225 (50%), Gaps = 29/225 (12%)

Query: 362 KVIGKGSFGKVMQVRKKDTN--KVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPFIV 419
           +++G G+FG V+   K D N  +  A K +  +  V  +     + E T+L ++ +P I+
Sbjct: 143 RIVGSGTFGHVLVAEKVDHNMKRQVAKKTVSYAVKVINTAKTRMVKEATILEKLNHPNII 202

Query: 420 PL-KFTFQSPDKLYIVLAFINGGELFYHLQREGRF---SLSRARLYTAELLCALETLHNL 475
            + +    +   +YI    I+GG+LF +L +       S + + +   ++L AL+ LH+ 
Sbjct: 203 RIHQSCVDALGNVYIFQDLISGGDLFSYLAKGDCLVPISETESLIIIYQILLALKFLHSN 262

Query: 476 DVIYRDLKPENILL---DHQGHIALCDFGLCK-LNMKGQDKTNTFCGTPEYLAPELLL-- 529
            +++RDLK +NILL   +    + L DFG+ K L+   +++ +T  GTPEY APE+    
Sbjct: 263 GIVHRDLKLDNILLHTPEPCTKVVLADFGIAKELSQNTKERMHTVVGTPEYCAPEVGFKA 322

Query: 530 -----------------GQGYSKVVDWWTLGVLLYEMMTGLPPYY 557
                              GY    D W+LGV+ + M+TG+ P+Y
Sbjct: 323 DRNIYRSFSRTATLDPDNNGYDSKCDIWSLGVITHIMLTGISPFY 367

>KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces
           cerevisiae YNL298w CLA4 ser/thr protein kinase, start by
           similarity
          Length = 879

 Score = 98.6 bits (244), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 61/204 (29%), Positives = 104/204 (50%), Gaps = 13/204 (6%)

Query: 421 LKFTFQSPDKLYIVLAFINGGELFYHLQRE-----GRFSLSRARL-YTAELLC-ALETLH 473
           L+   ++ D L++V+ ++ GG L   ++       G+  L+  ++ Y     C  L+ LH
Sbjct: 663 LEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTGSSGQSPLTEPQIAYIVRETCQGLKFLH 722

Query: 474 NLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGY 533
           +  +I+RD+K +N+LLD +G + + DFG C      + K  T  GTP ++APE++  + Y
Sbjct: 723 DKHIIHRDIKSDNVLLDTRGRVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVVKQREY 782

Query: 534 SKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQE---PLRFPDGFDKDAKDLLIGL 590
            + VD W+LG++  EM+   PPY +E+  K    I       L+ P+    + K  L   
Sbjct: 783 DEKVDVWSLGIMTIEMLESEPPYLNEEPLKALYLIATNGTPKLKHPEYLSLEIKRFLSVC 842

Query: 591 LSRDPKRRLGFNGADEIKSHPFFS 614
           L  D K R      +E+  H FF+
Sbjct: 843 LCVDVKYRA---STEELLHHSFFN 863

>Kwal_26.7355
          Length = 1446

 Score = 99.0 bits (245), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 82/266 (30%), Positives = 135/266 (50%), Gaps = 20/266 (7%)

Query: 362  KVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSE----VIHTL-AERTVLARVENP 416
            ++IGKGSFG V       T ++ A+K +      S+ E    V+  L +E   L  +++ 
Sbjct: 1150 EMIGKGSFGSVFLGLNVTTGEMIAVKQVEVPRYGSQDETTLSVLEALRSEVATLKDLDHT 1209

Query: 417  FIVPLKFTFQSPDKLY-IVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNL 475
             IV     F++ + +Y + L ++ GG +   ++  G+F  +  R    ++L  L  LH+ 
Sbjct: 1210 NIVQY-LGFENKNYVYSLFLEYVAGGSVGSLIRLYGKFDENLIRFLAVQVLRGLSYLHSK 1268

Query: 476  DVIYRDLKPENILLDHQGHIALCDFGLCKL-NMKGQDKTNTFCGTPEYLAPELL-LGQGY 533
             +++RD+K +N+LLD  G   + DFG+ K  N    +   T  GT  ++APE++   QGY
Sbjct: 1269 KILHRDMKADNLLLDVDGICKISDFGISKKSNNIYSNSDMTMRGTVFWMAPEMVDTKQGY 1328

Query: 534  SKVVDWWTLGVLLYEMMTGLPPYYD-EDVPKMYK--KILQEPLRFPDGFDK----DAKDL 586
            S  VD W+LG ++ EM  G  P+ + E V  M+K  K    P   P+   K    + K+ 
Sbjct: 1329 SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKFKSAPP-IPEDTQKIISAEGKEF 1387

Query: 587  LIGLLSRDPKRRLGFNGADEIKSHPF 612
            L      +P++R     ADE+ SHPF
Sbjct: 1388 LDACFEINPEKRP---TADELLSHPF 1410

>ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C
           (MKK2) - SH] complement(557738..559312) [1575 bp, 524
           aa]
          Length = 524

 Score = 97.4 bits (241), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 102/207 (49%), Gaps = 9/207 (4%)

Query: 356 DDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVEN 415
           D  E L V+G+G+ G V + + +  +K++ALK I  +    +        E       ++
Sbjct: 234 DQIEELGVLGEGAGGSVTKCKLRHGSKIFALKTI-TTLTTDQESQKQIFRELQFNKSCKS 292

Query: 416 PFIVPL--KFTFQSPDKLYIVLAFINGGEL---FYHLQREGRFSLSRARLYTAE-LLCAL 469
            +IV     FT +    +YI + ++ G  L   + HL + G     +     AE +L  L
Sbjct: 293 DYIVRYYGMFTDEEHSSIYIAMEYMGGRSLDAIYKHLLKHGGRVGEKVLGKIAESVLRGL 352

Query: 470 ETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLL 529
             LH   +I+RD+KP+NILL+  G + LCDFG+    +       TF GT  Y+APE + 
Sbjct: 353 SYLHQRKIIHRDIKPQNILLNEAGQVKLCDFGVSGEAV--NSLATTFTGTSYYMAPERIQ 410

Query: 530 GQGYSKVVDWWTLGVLLYEMMTGLPPY 556
           GQ YS   D W+LG+ L E+     P+
Sbjct: 411 GQPYSVTSDVWSLGLTLLEVAQAHFPF 437

>Scas_619.5*
          Length = 510

 Score = 97.1 bits (240), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 88/297 (29%), Positives = 144/297 (48%), Gaps = 55/297 (18%)

Query: 362 KVIGKGSFGKVMQVRKKD---TNKVY-----ALKAIR-KSYIVSKSEVIHTLAERTVLAR 412
           ++IG G+FG V+   KK     + VY     A+K I+ + Y V K        E  +L +
Sbjct: 172 RIIGNGTFGNVLVAFKKSEIVASDVYSRPNFAVKVIKLRKYKVDK--------EAKILLK 223

Query: 413 VENPFIVPLKFTFQS--PDKLYIVLAFINGGELFYHLQR-EGRFSLSRAR--LYTAELLC 467
           + +  I+ + +TF     + LYI    I GG+LF +L + E   ++S     +   ++L 
Sbjct: 224 LNHANIIKIHYTFNDLMNNNLYIFQDLIPGGDLFSYLAKGECLTAISETETLIIVYQILK 283

Query: 468 ALETLHNLDVIYRDLKPENILL---DHQGHIALCDFGLCK-LNMKGQDKTNTFCGTPEYL 523
           AL  +H   +++RDLK +NILL   +    I L DFG+ K L++K   + NT  GTPEY 
Sbjct: 284 ALHYIHGRGIVHRDLKLDNILLCSPEPCTRIVLADFGIAKDLSLKNT-RMNTIVGTPEYC 342

Query: 524 APEL-------LLGQ-------------GYSKVVDWWTLGVLLYEMMTGLPPYY-DEDVP 562
           APE+       ++ Q             GY    D W+LGV+ + M+TG+ P+Y D    
Sbjct: 343 APEVGFKATRSIIDQSCSRANTIDQSMNGYDSKCDIWSLGVITHIMLTGISPFYGDGSEN 402

Query: 563 KMYKKILQEPLRFP----DGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQ 615
            + + + +  L F     +  + +AK  +  LL  D  +RL    + +   HP+ S+
Sbjct: 403 SIIQNVKRGKLDFSMKPWNNVNHNAKQFVEKLLEIDADKRL---DSKQSFQHPWISR 456

>KLLA0D07304g 623352..624749 some similarities with sp|P32491
           Saccharomyces cerevisiae YPL140c MKK2 protein kinase of
           the map kinase kinase (MEK) family, hypothetical start
          Length = 465

 Score = 96.7 bits (239), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 62/207 (29%), Positives = 101/207 (48%), Gaps = 10/207 (4%)

Query: 356 DDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVEN 415
           +  + L ++G+G+ G V + + ++ +K++ALK I  + I +         E       ++
Sbjct: 177 EQIDTLGILGEGTGGSVTKCKLRNGSKIFALKTI--ATIENDGSEKQIFRELQFNKSCKS 234

Query: 416 PFIVPL--KFTFQSPDKLYIVLAFINGGEL---FYHL-QREGRFSLSRARLYTAELLCAL 469
            FIV     F  +    ++I + ++ G  L   + HL  + GR            +L  L
Sbjct: 235 DFIVRYYGMFACEETSTIFIAMEYMGGRSLDSVYKHLLSKGGRIGEKVLGKIAESVLRGL 294

Query: 470 ETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLL 529
             LH   +I+RD+KP+NIL +  G I LCDFG+    +       TF GT  Y+APE + 
Sbjct: 295 FYLHERKIIHRDIKPQNILFNEIGQIKLCDFGVSGEAVNSL--ATTFTGTSYYMAPERIQ 352

Query: 530 GQGYSKVVDWWTLGVLLYEMMTGLPPY 556
           GQ YS   D W+LG+ L E+  G  P+
Sbjct: 353 GQPYSVTSDVWSLGLTLLEVAQGHSPF 379

>Scas_713.38
          Length = 432

 Score = 96.3 bits (238), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 95/338 (28%), Positives = 151/338 (44%), Gaps = 75/338 (22%)

Query: 361 LKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERT-----VLARVEN 415
           L  +G G+FG V       T++  A+K I K +  +       LA+RT     +L  + +
Sbjct: 26  LNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTA------VLAKRTYRELKLLKHLRH 79

Query: 416 PFIVPLKFTFQSP-DKLYIVLAFINGGELFYHLQR---EGRFSLSRARLYTAELLCALET 471
             ++ L+  F SP + +Y V   + G +L   LQ    E +F     + +  ++L  L+ 
Sbjct: 80  ENLICLQDIFLSPLEDIYFVTE-LQGTDLHRLLQTRPLEKQF----VQYFLYQILRGLKY 134

Query: 472 LHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNT-FCGTPEYLAPELLLG 530
           +H++ VI+RDLKP NIL++    + +CDFGL ++    QD   T +  T  Y APE++L 
Sbjct: 135 VHSVGVIHRDLKPSNILINENCDLKICDFGLARI----QDPQMTGYVSTRYYRAPEIMLT 190

Query: 531 -QGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKIL-------------------- 569
            Q Y   VD W+ G +  EM+ G P +  +D    +  I                     
Sbjct: 191 WQKYDVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPEDVINTICSENTL 250

Query: 570 --------QEPLRFPDGF---DKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSW 618
                   ++P+ F + F   + DA DLL  +L  DPK+R+    A E  +HP       
Sbjct: 251 KFVTSLPHRDPIPFSERFKTVEPDAVDLLGKMLVFDPKKRV---TAAEALAHP------- 300

Query: 619 KRLWMKGYIPPYKPPVMNSLDTSNFDQEFT-KELPVDS 655
                  Y+ PY  P    +    FD  F   +LPVD+
Sbjct: 301 -------YLAPYHDPTDEPVADCKFDWHFNDADLPVDT 331

>KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_1
           Kluyveromyces lactis MAP kinase, start by similarity
          Length = 495

 Score = 96.7 bits (239), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 84/317 (26%), Positives = 144/317 (45%), Gaps = 63/317 (19%)

Query: 350 NRALSVDD-FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVI-HTLAER 407
           N+  +VD  F+L+K IG GS+G V   R  +      +   + + + SK+ +   +L E 
Sbjct: 16  NQDFTVDKRFQLIKEIGHGSYGIVCSARFTEAADETTVAIKKVTNVFSKTLLCKRSLREL 75

Query: 408 TVLARVEN----PFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRA----- 458
            +L           +  +   FQ PD ++      NG  L+  L       + ++     
Sbjct: 76  KLLRHFRGHKNITCLYDMDIVFQ-PDGMF------NGLYLYEELMECDMHQIVKSGQPLT 128

Query: 459 ----RLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTN 514
               + +  ++LC L+ +H+ DV++RDLKP N+L++    + +CDFGL +   +   + N
Sbjct: 129 DAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENN 188

Query: 515 TF----CGTPEYLAPELLLG-QGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKIL 569
            F      T  Y APE++L  QGY+K +D W+ G +L E++ G P +  +D      +IL
Sbjct: 189 QFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSCGCILAELLGGKPIFKGKDYVDQLNRIL 248

Query: 570 Q-------EPLR-------------------------FPDGFDKDAKDLLIGLLSRDPKR 597
           Q       E L+                         +P+  + DA +LL G+LS DP+ 
Sbjct: 249 QVLGTPPEETLKRIGSKNVQDYIHQLGYIPKIPFSTLYPNA-NPDALNLLEGMLSFDPQL 307

Query: 598 RLGFNGADEIKSHPFFS 614
           R+     D+   HP+ S
Sbjct: 308 RI---TVDDALQHPYLS 321

>Kwal_23.5290
          Length = 819

 Score = 97.4 bits (241), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 100/203 (49%), Gaps = 13/203 (6%)

Query: 421 LKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARL------YTAELLC-ALETLH 473
           L+   ++ D L++V+ ++ GG L   ++       S + L      Y     C  L+ LH
Sbjct: 603 LEAYLKTEDDLWVVMEYMEGGSLTDLIENSPANGSSHSPLTEPQIAYIVRETCQGLKFLH 662

Query: 474 NLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGY 533
           +  +I+RD+K +N+LLD++  + + DFG C      + K  T  GTP ++APE++  + Y
Sbjct: 663 DKHIIHRDIKSDNVLLDNRARVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVVKQREY 722

Query: 534 SKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQE---PLRFPDGFDKDAKDLLIGL 590
            + VD W+LG++  EM+ G PPY +ED  K    I       L+ P+      K  L   
Sbjct: 723 DEKVDVWSLGIMTIEMLEGEPPYLNEDPLKALYLIATNGTPKLKQPEVLSLKIKRFLSVC 782

Query: 591 LSRDPKRRLGFNGADEIKSHPFF 613
           L  D K R      +E+  H FF
Sbjct: 783 LCVDVKYRA---STEELLHHSFF 802

>Scas_598.6
          Length = 790

 Score = 97.4 bits (241), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 74/275 (26%), Positives = 128/275 (46%), Gaps = 22/275 (8%)

Query: 358 FELLKVIGKGSFGKVMQVRK--------KDTNKVYALKAIRKSYIVSKSEVIHTLAERTV 409
           F++++  G+G+ G V    +         +T +V    AI++  +  +      + E  V
Sbjct: 502 FQMIEKAGQGASGSVYLAERIAIPPGEFDETPEVGDKVAIKQMILSKQPRKELIVNEILV 561

Query: 410 LARVENPFIVP-LKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARL------YT 462
           +    +  IV  L+   ++ D L++V+ F+ GG L   ++       S + L      Y 
Sbjct: 562 MKDSRHKNIVNFLEAYLKTEDDLWVVMEFMEGGSLTDIIENSPATGSSSSPLTEPQIAYI 621

Query: 463 AELLC-ALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPE 521
               C  L+ LH+  +I+RD+K +N+LLD+   + + DFG C      + K  T  GTP 
Sbjct: 622 VRETCQGLKFLHDKHIIHRDIKSDNVLLDNNARVKITDFGFCAKLTDQRSKRATMVGTPY 681

Query: 522 YLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQE---PLRFPDG 578
           ++APE++  + Y + VD W+LG++  EM+   PPY +ED  K    I       L+ P+ 
Sbjct: 682 WMAPEVVKQREYDEKVDVWSLGIMTIEMLESEPPYLNEDPLKALYLIATNGTPKLKNPES 741

Query: 579 FDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFF 613
              + K  L   L  D + R      +E+  H FF
Sbjct: 742 LSLEIKRFLSVCLCVDVRYRA---STEELLHHGFF 773

>KLLA0F20053g 1867209..1868543 highly similar to sp|P32485
           Saccharomyces cerevisiae YLR113w HOG1 ser/thr protein
           kinase of MAP kinase (MAPK) family, start by similarity
          Length = 444

 Score = 95.9 bits (237), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 96/338 (28%), Positives = 152/338 (44%), Gaps = 75/338 (22%)

Query: 361 LKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERT-----VLARVEN 415
           L  +G G+FG V       T++  A+K I K +  S       LA+RT     +L  + +
Sbjct: 25  LNPVGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTS------VLAKRTYRELKLLKHLRH 78

Query: 416 PFIVPLKFTFQSP-DKLYIVLAFINGGELFYHLQR---EGRFSLSRARLYTAELLCALET 471
             ++ L+  F SP + +Y V   + G +L   LQ    E +F     + +  ++L  L+ 
Sbjct: 79  ENLICLEDIFLSPLEDIYFVTE-LQGTDLHRLLQTRPLEKQF----VQYFLYQILRGLKY 133

Query: 472 LHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNT-FCGTPEYLAPELLLG 530
           +H+  VI+RDLKP NIL++    + +CDFGL ++    QD   T +  T  Y APE++L 
Sbjct: 134 VHSAGVIHRDLKPSNILINENCDLKICDFGLARI----QDPQMTGYVSTRYYRAPEIMLT 189

Query: 531 -QGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKIL-------------------- 569
            Q Y+  VD W+ G +  EM+ G P +  +D    +  I                     
Sbjct: 190 WQKYNVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVIDTICSENTL 249

Query: 570 --------QEPLRFPDGF---DKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSW 618
                   ++P+ F   F   + DA DLL  +L  DPK+R+    AD + +HP+ S    
Sbjct: 250 KFVTSLPHRDPVPFSSRFQNLEPDAIDLLEKMLVFDPKKRI--TAADAL-AHPYLS---- 302

Query: 619 KRLWMKGYIPPYKPPVMNSLDTSNFDQEFT-KELPVDS 655
                     PY  P    +  + FD  F   +LPVD+
Sbjct: 303 ----------PYHDPTDEPIAEAKFDWNFNDADLPVDT 330

>Kwal_55.22001
          Length = 363

 Score = 94.4 bits (233), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 97/352 (27%), Positives = 162/352 (46%), Gaps = 59/352 (16%)

Query: 346 KPATNRALSVDDFELLKVIGKGSFGKVMQV-RKKDTNKVYALKAIRKSYIVSKSEVIHTL 404
           + ++ R + V ++   K IG G+FG V+Q     D NK Y   AI+K  + +++E  +  
Sbjct: 17  RSSSTRPMLVKEY---KKIGHGAFGTVVQAFLTPDNNKWYGPFAIKK--VPAQTE--YKS 69

Query: 405 AERTVLARVENPFIVPLK--FTFQSP--DKLYIVLAF-----INGGELFYHLQREGRFSL 455
            E  +L   ++P +V L+  FT  SP  +KLY  LA          E+  +   +    L
Sbjct: 70  RELEILRIADHPNVVKLEYFFTHTSPQDNKLYQHLAMECLPETLQLEIHRYASNKLELPL 129

Query: 456 SRARLYTAELLCALETLHNLDVIYRDLKPENILLD-HQGHIALCDFGLCKLNMKGQDKTN 514
              +LYT ++   +  LH L + +RD+KP N+L+D + G + +CDFG  K   + Q   +
Sbjct: 130 KHTKLYTYQIARGMLYLHALGICHRDIKPSNVLVDPNTGVLKICDFGSAKKLEQNQPSIS 189

Query: 515 TFCGTPEYLAPELLLG-QGYSKVVDWWTLGVLLYEMMTGLPPYYDEDV------------ 561
             C    Y APEL++G   Y+  +D W LG ++ EM+ G   +  ++             
Sbjct: 190 YICSR-FYRAPELIVGCTQYTTQIDIWGLGCVMGEMLIGKAVFQGQEPLLQLREISKLLG 248

Query: 562 -----------PKMYKKILQEPL-------RFPDGFDK---DAKDLLIGLLSRDPKRRLG 600
                      P     +  +PL       RF   F +   +  DLL+ +L+ +P+RRL 
Sbjct: 249 PPDKKFLFFSNPSYDGPLFSKPLFTGSVQERFEKHFGQAGPEGIDLLMKILTYEPERRL- 307

Query: 601 FNGADEIKSHPFFSQLSWKRLWM-KGYIPPYKPPVMNSLDTSNFDQEFTKEL 651
                 I +HPFF  L  +R +  +G+  P   P +   D S F+ +   +L
Sbjct: 308 --SPRRILAHPFFEDLKKERYFFPRGHTQPKYLPEL--FDFSPFELQVIADL 355

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 97.1 bits (240), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 82/262 (31%), Positives = 117/262 (44%), Gaps = 30/262 (11%)

Query: 364  IGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAER-TVLARVENPFIVPLK 422
            IG G+FG+V      +  ++ A+K I+     +  ++   + E  TVL  + +P IV   
Sbjct: 1040 IGGGTFGQVYSAINLENGEILAVKEIKIHDTTTMKKIFPLIKEEMTVLEMLNHPNIVQYY 1099

Query: 423  FTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRA-RLYTAELLCALETLHNLDVIYRD 481
                  DK+ I + +  GG L   L   GR       ++YT ELL  L  LH   V++RD
Sbjct: 1100 GVEVHRDKVNIFMEYCEGGSL-ASLLDHGRIEDEMVTQVYTFELLEGLAYLHQSGVVHRD 1158

Query: 482  LKPENILLDHQGHIALCDFGLCKLNMKGQDKT----------------NTFCGTPEYLAP 525
            +KPENILLD  G I   DFG  +  +  + +T                N   GTP Y+AP
Sbjct: 1159 IKPENILLDFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDFGVETKSLNEMMGTPMYMAP 1218

Query: 526  ELLLG---QGYSKVVDWWTLGVLLYEMMTGLPPY--YDEDVPKMYK----KILQEPLRFP 576
            E + G   +G     D W LG ++ EM TG  P+   D +   MY     +I Q P R  
Sbjct: 1219 ETISGSAVKGKLGADDVWALGCVVLEMATGRRPWSNLDNEWAIMYHVAAGRIPQLPNR-- 1276

Query: 577  DGFDKDAKDLLIGLLSRDPKRR 598
            D      +  L   L +DP  R
Sbjct: 1277 DEMTAAGRAFLERCLVQDPTMR 1298

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 94.7 bits (234), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 67/241 (27%), Positives = 124/241 (51%), Gaps = 21/241 (8%)

Query: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSY-----IVSKSEVIHTLAERTVLAR 412
           +++ ++I  GSF  V   +   T +  ALK +RK +     +   + ++H   E  +L R
Sbjct: 7   YKVGRLIQSGSFSVVHHAQDCQTGQDVALKYVRKPHDNPEQLQKVAALVHN--EYAILRR 64

Query: 413 V-ENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTA--ELLCAL 469
           +  +  I  L   ++  D    VL +   G+L+  ++        R   ++   +L  A+
Sbjct: 65  LGTHRNICQLLDFYEDADTYVFVLEYCAYGDLYDFIKAIRERPTMRINFHSFLFQLCSAI 124

Query: 470 ETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFC-GTPEYLAPELL 528
              H+ DV +RD+KPEN+L+D +G + L DFGL ++    +D    +C GT +YLAPE  
Sbjct: 125 SYCHSKDVSHRDIKPENVLMDDRGQVKLTDFGLSQIGSVSKD----YCIGTEKYLAPETF 180

Query: 529 LGQGYSK-VVDWWTLGVLLYEMMTGLPPY--YDEDVPKM---YKKILQEPLRFPDGFDKD 582
           L + ++    D+W+LG+ ++ +M G  P+     D PK    +++ +++P RF + +  D
Sbjct: 181 LREYHNTFATDYWSLGITIFCLMFGSCPFESASSDAPKRSANFQRFIRDPHRFVESYYLD 240

Query: 583 A 583
           A
Sbjct: 241 A 241

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score = 95.9 bits (237), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 99/203 (48%), Gaps = 13/203 (6%)

Query: 421 LKFTFQSPDKLYIVLAFINGGELFYHLQR-------EGRFSLSRARLYTAELLCALETLH 473
           L+   ++ D L++V+ ++ GG L   ++        E   +  +      E    L+ LH
Sbjct: 577 LEAYLKTEDDLWVVMEYMEGGSLTDVIENSIGSDASESPMTEPQIAYIVRETCQGLKFLH 636

Query: 474 NLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGY 533
           +  +I+RD+K +N+LLD  G + + DFG C      + K  T  GTP ++APE++  + Y
Sbjct: 637 DKHIIHRDIKSDNVLLDTHGRVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVVKQREY 696

Query: 534 SKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQE---PLRFPDGFDKDAKDLLIGL 590
            + VD W+LG++  EM+ G PPY +E+  K    I       L+ P+    + K  L   
Sbjct: 697 DEKVDVWSLGIMTIEMLEGEPPYLNEEPLKALYLIATNGTPKLKHPELLSLEIKRFLSVC 756

Query: 591 LSRDPKRRLGFNGADEIKSHPFF 613
           L  D + R      +E+  H FF
Sbjct: 757 LCVDVRYRA---STEELLHHSFF 776

>Scas_713.21
          Length = 641

 Score = 95.5 bits (236), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 93/305 (30%), Positives = 148/305 (48%), Gaps = 49/305 (16%)

Query: 356 DDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTV-----L 410
           ++  +++++GKG   KV +V+ + T K YALK I    +    E + T  ER +     L
Sbjct: 319 EELSIVELLGKGGSSKVYKVQDR-TGKYYALKQI---LLEELDENLKTDLEREIELLKRL 374

Query: 411 ARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHL-QREGR-FSLSRARLYTAELLCA 468
           AR E   +V L   ++  D++  VL      +L + L +R  R F ++  RL + E++  
Sbjct: 375 AREER--VVKL-IEYKIDDRMVQVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIEC 431

Query: 469 LETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKT-----NTFCGTPEYL 523
           ++ +H+ D+++ DLKP N +   +G + L DFG+     K  D T     NT  GTP Y+
Sbjct: 432 IKAVHDSDIVHSDLKPANFIF-VKGTLKLIDFGIAN---KIADNTLNVYRNTQMGTPNYM 487

Query: 524 APELLLGQGYS-----------KVVDWWTLGVLLYEMMTGLPPY-----YDEDVPKMYKK 567
           APE L+ Q YS           K  D W+ G +LY+M  G PPY     +D  +  M   
Sbjct: 488 APETLISQNYSNNNNNLLWKIGKPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPN 547

Query: 568 I-LQEPLRFPDGFDKDAKDLLIGL----LSRDPKRRLGFNGADEIKSHPFFSQLSWKRLW 622
           I +  P   P G  K     L+ L    L+RDP+ R      DEI+   FF+ +   + +
Sbjct: 548 IQIDYPNESPCG--KKVPQSLVALIKTCLNRDPQLRA---TTDEIQHCSFFNPMIISKPF 602

Query: 623 MKGYI 627
           ++  I
Sbjct: 603 LESLI 607

>CAGL0D02244g complement(229504..230967) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, hypothetical start
          Length = 487

 Score = 94.7 bits (234), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 81/275 (29%), Positives = 131/275 (47%), Gaps = 53/275 (19%)

Query: 330 IGLAQGNGKLNLSVDYKPAT---------NRALSVDDFELLK-VIGKGSFGKVM------ 373
           I L +  GK  L    +P+T         N   +VD++ +   V+G G+FG V+      
Sbjct: 116 IELCENGGKF-LKFSCQPSTPSLPKKITINYTENVDNWNISNIVVGNGTFGYVLIAYMGI 174

Query: 374 -----QVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPFIVPL-KFTFQS 427
                +  +K T K YA+K ++    +SK +      E  +L ++ +P I+ + K     
Sbjct: 175 GAHSGKSSQKITPKCYAVKIVKMK--LSKLD-----KEAKILMQLNHPNIIKVFKTHTDK 227

Query: 428 PDKLYIVLAFINGGELFYHLQREGRF---SLSRARLYTAELLCALETLHNLDVIYRDLKP 484
            + LYI    I GG+LF +L +       S + A ++  ++L AL+ LH   +++RDLK 
Sbjct: 228 SNNLYIFQELIPGGDLFSYLAKGDCLMPISQTEALVFVYQILHALKYLHTKGIVHRDLKL 287

Query: 485 ENILL---DHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPEL-------------- 527
           +NILL   +    I L DFG+ +     + +  T  GTPEY APE+              
Sbjct: 288 DNILLCTPEPFTKIVLADFGIARTVTTMKSRMFTVVGTPEYCAPEVGFKANRKAYHSFFR 347

Query: 528 ---LLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDE 559
              L  QGY    D W+LGV+ + M+TG+ P+Y +
Sbjct: 348 AATLEQQGYDSKCDLWSLGVITHIMLTGISPFYGD 382

>ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C
           (TOS3) - SH] (273163..276708) [3546 bp, 1181 aa]
          Length = 1181

 Score = 95.9 bits (237), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 91/369 (24%), Positives = 159/369 (43%), Gaps = 91/369 (24%)

Query: 341 LSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRK--------- 391
           +S++Y P + R + ++ +E+++ +G G  GKV       T +  A+K + +         
Sbjct: 91  ISLEYDPISKRKV-LNTYEIIRELGSGQHGKVKLALDLVTKQHVAIKIVDRHGKKKSSWK 149

Query: 392 ---SYIVSKSEVIHTLAERTVLARVENPFIVPLKFTF--QSPDKLYIVLAFINGGELFY- 445
              + +  +SE I    E  ++ + ++  +V L          K+Y+VL + + GE+ + 
Sbjct: 150 LKKTPVREESEKIRR--EIAIMKKCDHEHVVKLIEVLDDMKSRKIYLVLEYCSKGEVKWC 207

Query: 446 ---HLQREGR----FSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALC 498
               L+   R     +  R R     ++  LE LH   +I+RD+KP N+LL     + + 
Sbjct: 208 PGDQLEAAARGPPLLTFQRTREILRGVVLGLEYLHYQGIIHRDIKPANLLLSEHDIVKIS 267

Query: 499 DFGLC---------------------KLNMKGQD--KTNTFCGTPEYLAPELLLGQ-GYS 534
           DFG+                       L  +G D  +     GTP + APE+ LG   Y 
Sbjct: 268 DFGVSLASSNSGTPSSRSSSSSSVKGVLGAEGPDDLELAKTAGTPAFFAPEICLGSDAYE 327

Query: 535 K-----------------VVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFP- 576
           K                 ++D W LGV LY ++ G  P+  E   ++++KI+ +PL FP 
Sbjct: 328 KLNIDRQSNPCSGSLISYMIDIWALGVTLYCLLFGKLPFIAEYEMELFEKIVNDPLEFPR 387

Query: 577 ------DGFDK--------DAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFS-------Q 615
                 +G            A+DLL  LL ++P +R+      +IK+HPF          
Sbjct: 388 LEFMQSNGVSMISCKEEYLSAQDLLNKLLEKNPMQRINIV---DIKAHPFVCWDFDHVDG 444

Query: 616 LSWKRLWMK 624
           LS +R+ M+
Sbjct: 445 LSGQRISMR 453

>CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces
            cerevisiae YAL017w FUN31 or sp|Q08217 Saccharomyces
            cerevisiae YOL045w, start by similarity
          Length = 1206

 Score = 95.9 bits (237), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 76/268 (28%), Positives = 130/268 (48%), Gaps = 28/268 (10%)

Query: 348  ATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEV------- 400
            A  R     DF +L+ +G+G++GKV     K+   +  +K I K  I+  + V       
Sbjct: 936  AQKRKKKYSDFVVLQKMGEGAYGKVNLCIHKEKKYIVVIKMIFKERILVDTWVRDRKLGT 995

Query: 401  ----IHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVL---AFINGGELFYHLQREGRF 453
                I  LA  T+  R     +  L F F+  D  Y+           +LF  ++ +   
Sbjct: 996  IPSEIQILA--TINKRPHENILGLLDF-FEDDDYYYLETPPHGQTGSVDLFDIIEFKSNM 1052

Query: 454  SLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKT 513
            +   A+L   +++  ++ LH+  +++RD+K EN+++D +G + L DFG       G    
Sbjct: 1053 TEFEAKLIFKQIVSGIKHLHDQGIVHRDIKDENVIVDSKGFVKLIDFGSAAYVKSG--PF 1110

Query: 514  NTFCGTPEYLAPELLLGQGYS-KVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEP 572
            + F GT +Y APE+L G  Y  K  D W +G+LLY ++    P+Y+ D      +IL+  
Sbjct: 1111 DVFVGTIDYAAPEVLGGNPYEGKSQDIWAIGILLYTLIYKENPFYNID------EILEGE 1164

Query: 573  LRFPDGFD--KDAKDLLIGLLSRDPKRR 598
            LRF D  D  ++ K L+  +L+R  ++R
Sbjct: 1165 LRFNDSADVSQECKALITKILNRCVRKR 1192

>Scas_688.14
          Length = 479

 Score = 94.0 bits (232), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 82/313 (26%), Positives = 140/313 (44%), Gaps = 55/313 (17%)

Query: 350 NRALSVDD-FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVI-HTLAER 407
           N+  +VD  F+L+K IG G++G V   R  +  +   +   + + + SKS +   +L E 
Sbjct: 14  NQDFTVDKRFQLIKEIGHGAYGIVCSARFAEAVEDTTVAIKKVTNVFSKSLLCKRSLREL 73

Query: 408 TVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRA--------- 458
            +L        +   +     D ++      NG  L+  L       + ++         
Sbjct: 74  KLLRHFRGHKNITCLYDM---DIVFYPDGTFNGLYLYEELMECDMHQIIKSSQPLTDAHY 130

Query: 459 RLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTF-- 516
           + +  ++LC L+ +H+ DV++RDLKP N+L++    + +CDFGL +   +   + N F  
Sbjct: 131 QSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENNQFLT 190

Query: 517 --CGTPEYLAPELLLG-QGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQ--- 570
               T  Y APE++L  QGY+K +D W+ G +L E + G P +  +D      +ILQ   
Sbjct: 191 EYVATRWYRAPEIMLSYQGYTKAIDIWSTGCILAEFLGGKPIFKGKDYVDQLTRILQVLG 250

Query: 571 ----EPLR-------------------------FPDGFDKDAKDLLIGLLSRDPKRRLGF 601
               E LR                         +PD  +  A DLL  +L+ DP++R+  
Sbjct: 251 TPPDETLRRIGSKNVQDYIHQLGYIPKVPFVNLYPDA-NPQALDLLEKMLAFDPQKRI-- 307

Query: 602 NGADEIKSHPFFS 614
              DE   HP+ S
Sbjct: 308 -TTDEALEHPYLS 319

>KLLA0F01276g complement(120001..121560) similar to sp|P38147
           Saccharomyces cerevisiae YBR274w CHK1 regulats
           inhibitory Cdk phosphorylation of PDS1, start by
           similarity
          Length = 519

 Score = 94.0 bits (232), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 83/279 (29%), Positives = 143/279 (51%), Gaps = 30/279 (10%)

Query: 355 VDDFELLKVIGKGSFGKVMQVR-KKDTNKVYALKAIR----KSYIVSKSEVIHTLAERTV 409
           +D  +L + IGKGSF  V +   + D + V A+K I     +   +S+ +V   L E  +
Sbjct: 12  IDGLQLGRTIGKGSFAFVKRASLEVDPSTVIAVKFIHLPSCEKQGMSQEDV---LREVKL 68

Query: 410 LARVENPFIVPLKF--TFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLC 467
            +R  N F+  LK      S   L+I +    GG+LF  ++ +       A+ Y  +L+ 
Sbjct: 69  HSRCSN-FVNVLKVIDCNLSDPFLWIAMELAEGGDLFDKIEPDIGVDSEVAQFYYKQLIK 127

Query: 468 ALETLHN-LDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFC----GTPEY 522
           A+  LH+   V +RD+KPENILLD  G++ L DFGL  L  K +D +        G+  Y
Sbjct: 128 AISYLHDTCGVAHRDIKPENILLDKDGNLKLADFGLASL-FKRKDGSKRISRDQRGSLPY 186

Query: 523 LAPELLLGQG-YSKVVDWWTLGVLLYEMMTGLPPY---YDEDVPKMYKKILQEPLRFPDG 578
           +APE++   G Y+ + D W++GVLL+ ++TG  P+   +++D  + ++  ++   +   G
Sbjct: 187 MAPEIIYCDGYYADMTDIWSIGVLLFVLLTGETPWELPHEDD--ETFRNFIKGEGKLDQG 244

Query: 579 ----FDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFF 613
                D    +LL  +L  DP++R      D ++ H ++
Sbjct: 245 SWLKIDFVELNLLRKILQPDPEKRASL---DTLRKHTWY 280

>AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH]
           (807470..808831) [1362 bp, 453 aa]
          Length = 453

 Score = 93.2 bits (230), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 94/338 (27%), Positives = 150/338 (44%), Gaps = 75/338 (22%)

Query: 361 LKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERT-----VLARVEN 415
           L  +G G+FG V       T +  A+K I K +  +       LA+RT     +L  + +
Sbjct: 32  LNPVGMGAFGLVCSAVDTYTQQPVAIKKIMKPFSTA------VLAKRTYRELKLLKHLRH 85

Query: 416 PFIVPLKFTFQSP-DKLYIVLAFINGGELFYHLQR---EGRFSLSRARLYTAELLCALET 471
             ++ L+  F SP + +Y V   + G +L   LQ    E +F     + +  ++L  L+ 
Sbjct: 86  ENLICLEDIFLSPLEDIYFVTE-LQGTDLHRLLQTRPLEKQF----LQYFLYQILRGLKY 140

Query: 472 LHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNT-FCGTPEYLAPELLLG 530
           +H+  VI+RDLKP NIL++    + +CDFGL ++    QD   T +  T  Y APE++L 
Sbjct: 141 VHSAGVIHRDLKPSNILINENCDLKICDFGLARI----QDPQMTGYVSTRYYRAPEIMLT 196

Query: 531 -QGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKIL-------------------- 569
            Q Y+  VD W+ G +  EM+ G P +  +D    +  I                     
Sbjct: 197 WQKYNVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDVIDTICSENTL 256

Query: 570 --------QEPLRFPDGFDK---DAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSW 618
                   ++P+ F + F     DA DLL  +L  DPK+R+    A +  +HP       
Sbjct: 257 KFVTSLPHRDPVPFTERFKNLKPDAVDLLEKMLVFDPKKRI---TAGDALTHP------- 306

Query: 619 KRLWMKGYIPPYKPPVMNSLDTSNFDQEFT-KELPVDS 655
                  Y+ PY  P    +  + FD  F   +LPVD+
Sbjct: 307 -------YLAPYHDPTDEPVADAKFDWNFNDADLPVDT 337

>Scas_707.34
          Length = 905

 Score = 94.4 bits (233), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 78/313 (24%), Positives = 142/313 (45%), Gaps = 67/313 (21%)

Query: 356 DDFELLKVIGKGSFGKVMQ---------------VRKKDTNK--VYALKAIRKSYIVSKS 398
           D + + K IGKGSF  V +               V     N    +A+K + +S + +K 
Sbjct: 36  DRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKIVPRSKLKNKK 95

Query: 399 EVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRF----- 453
            + +   E  +L ++ +P IV L    ++    Y+++ + + G+L + +++  +      
Sbjct: 96  LLENLEIEIAILKKISHPHIVKLIDFERTSKDFYLIMEYCSLGDLTFLIKKRQQLIKNHP 155

Query: 454 -----------------SLSRARL--YTAELLCALETLHNLDVIYRDLKPENILLD---- 490
                             L +A +  Y  +L  AL+ L + ++++RD+KP+N+LL     
Sbjct: 156 LLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKNLVHRDIKPQNLLLSAPLI 215

Query: 491 -----HQGH------------IALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGY 533
                   H            + + DFG  +  +       T CG+P Y+APE+L  Q Y
Sbjct: 216 NYNDPKSFHDLGFVGIYNLPILKIADFGFARF-LPNTSMAETLCGSPLYMAPEILNYQKY 274

Query: 534 SKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQ--EPLRFPD--GFDKDAKDLLIG 589
           +   D W++G +LYEM  G PP+   +  ++YKKI +  + + FP     D + K L+  
Sbjct: 275 NAKADLWSVGTVLYEMCYGNPPFKASNHLELYKKIKKANDLIYFPTYIEIDNNLKSLISK 334

Query: 590 LLSRDPKRRLGFN 602
           LL+ DP+ R+ F+
Sbjct: 335 LLTFDPQERIEFD 347

>Scas_640.16
          Length = 505

 Score = 93.2 bits (230), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 77/285 (27%), Positives = 124/285 (43%), Gaps = 24/285 (8%)

Query: 361 LKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPFIVP 420
           L V+G+G+ G V + + K   KV+ALK +  +             E       ++ +IV 
Sbjct: 213 LGVLGEGAGGSVEKCKLKHGKKVFALKIVN-TLNTDPEFQKQIFRELQFNKSFKSDYIVR 271

Query: 421 LKFTFQ--SPDKLYIVLAFINGG--ELFYH--LQREGRFSLSRARLYTAELLCALETLHN 474
               F   +   +YI + ++ G   E  Y   L R GR S       +  +L  L  LH 
Sbjct: 272 YYGMFNDVNSSSIYIAMEYMGGKSLEAVYKNLLSRGGRISEKVLGKISESVLRGLSYLHE 331

Query: 475 LDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQGYS 534
             VI+RD+KP+NIL + +G + LCDFG+    +       TF GT  Y+APE + GQ YS
Sbjct: 332 QKVIHRDIKPQNILFNEKGQVKLCDFGVSGEAVNSL--ATTFTGTSFYMAPERIQGQPYS 389

Query: 535 KVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKI------------LQEPLRFPDGFDKD 582
              D W+LG+ + E+  G  P+  + +      I            L++       + K 
Sbjct: 390 VTCDIWSLGLTILEVAQGRFPFGSDKITATIAPIELLVLILTFNPELKDEPELNITWSKA 449

Query: 583 AKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKRLWMKGYI 627
            K  +   L +DP  R       ++  HP+      K++ M+ +I
Sbjct: 450 FKSFIHFCLKKDPHER---PSPRQMIDHPWIQGQMKKKVNMENFI 491

>AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH]
           (1043479..1044750) [1272 bp, 423 aa]
          Length = 423

 Score = 92.0 bits (227), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 82/322 (25%), Positives = 140/322 (43%), Gaps = 56/322 (17%)

Query: 332 LAQGNGKLNLSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRK 391
           ++Q  G   L     P        ++F++L+ IG+GSFG V +V    T+K+   K I+ 
Sbjct: 1   MSQSRGIRRLQTSSYPQKLGHSQPNEFKVLEEIGRGSFGSVRKVLHVPTSKLMVRKEIKY 60

Query: 392 SYIVSKSEVIHTLAERTVLARVENPFIVPL------------KFTFQSPDKLYIVLAFIN 439
            ++ SK E    +AE T+LA + +  IV                 + + + LY+ + + +
Sbjct: 61  GHMNSK-ERQQLIAECTILAGLRHENIVEFYNWDHASSRTGNSVDYGNGEVLYLYMEYCS 119

Query: 440 GGEL---FYHLQREGRFSLSR----------ARLYTAELLCALETLHNL----------- 475
            G+L     H +   ++   R            LY     C L  L  +           
Sbjct: 120 CGDLSQMIKHYKGMRKYVPERDIWRIAVQLLLALYKCHTSCDLPQLDTIYDKISKSAIES 179

Query: 476 ------DVIYRDLKPENILLDHQG------------HIALCDFGLCKLNMKGQDKTNTFC 517
                  VI+RDLKP NI L   G             + L DFGL K      +   T+ 
Sbjct: 180 EAGKVTSVIHRDLKPGNIFLTGDGVGGRGSVDYSKVEVKLGDFGLAKSLQSAIEFATTYV 239

Query: 518 GTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLR-FP 576
           GTP Y++PE+L+ Q YS + D W+LG ++YE+     P+   +  ++ + I +  ++  P
Sbjct: 240 GTPYYMSPEVLMDQPYSPLSDIWSLGCVIYELCALRVPFPARNFMELQRMIQRADVQPLP 299

Query: 577 DGFDKDAKDLLIGLLSRDPKRR 598
           D + K+ + L+I  ++ + K R
Sbjct: 300 DYYSKELQQLVISCINPNEKLR 321

>ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH]
           (146098..147402) [1305 bp, 434 aa]
          Length = 434

 Score = 92.0 bits (227), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 84/328 (25%), Positives = 151/328 (46%), Gaps = 45/328 (13%)

Query: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALK-AIRKSYIVSKSEVIHTLAERTVLARVENP 416
           +E+L+++GKGS+G V+     + N  Y ++ AI+K   + + EV+   A R +  +  + 
Sbjct: 73  YEVLQMLGKGSYGTVVSA-IDNLNANYPIRIAIKKITNIFQREVLLKRAIREL--KFMHY 129

Query: 417 F--------IVPLKFTFQSP-DKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLC 467
           F        ++ L+   + P D LY     I+  +L   +    +FS    + +T ++LC
Sbjct: 130 FKGHKNIVSLINLEIVNEKPYDGLYCYQELIDY-DLARVIHSNVQFSEFHIKHFTYQILC 188

Query: 468 ALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCK------LNMKGQDKTNTFCGTPE 521
            ++ +H+ DVI+RDLKP NIL    G + +CDFGL +       N K  +    +  T  
Sbjct: 189 GVKYIHSADVIHRDLKPGNILCSISGQLKICDFGLARGISPLFTNTKTSNHITNYVATRW 248

Query: 522 YLAPELLLGQG-YSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFD 580
           Y APEL+L    Y+K +D W +G +L E     P +  +D      +I++          
Sbjct: 249 YRAPELILSHKRYNKSIDMWAIGCILAEFYGRKPIFMGQDSMHQISEIVK---------- 298

Query: 581 KDAKDLLIGLLSRDPKRRLGFNGADEI--KSHPFFSQLSWKRLWMKGYIPPYKPPVMNSL 638
                 ++G  SRD   + G + A +I     P ++++ W  ++      P+  P    L
Sbjct: 299 ------VLGTPSRDTIIKYGSSRAYDIFCPPKPQYAKIPWAEIY------PFAGPDALDL 346

Query: 639 DTSNFDQEFTKELPVDSVVNDFLSESVQ 666
                D +  + L V+  +     +SV+
Sbjct: 347 IERLLDWDPDRRLTVEEAIEHDFVKSVR 374

>KLLA0D09328g complement(788565..791705) some similarities with
           sp|P38990 Saccharomyces cerevisiae YER129w PAK1 DNA
           polymerase alpha suppressing protein kinase,
           hypothetical start
          Length = 1046

 Score = 94.0 bits (232), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 80/335 (23%), Positives = 150/335 (44%), Gaps = 69/335 (20%)

Query: 341 LSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRK--------- 391
           +S++Y P + R + ++ +E+++ +G G  GKV   R   T ++ A+K + +         
Sbjct: 99  VSLEYDPISKRKV-LNTYEIIEELGHGQHGKVKLARDLVTKQLVAIKIVNRHKKRTFNDK 157

Query: 392 ---SYIVSKSEVIHTLAER--TVLARVENPFIVPLKFTFQSPD--KLYIVLAFINGGELF 444
               +   +S +     +R   ++ +  +  +V L          K+Y+VL + + GE+ 
Sbjct: 158 FSNRFKTPQSGIEDEKIKREIAIMKKCHHEHVVKLIEVLDDAKSRKIYLVLEYCSKGEIK 217

Query: 445 YH----LQREGR----FSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIA 496
           +     ++ + R     S  R R     +L  LE LH   +I+RD+KP N+LL   G + 
Sbjct: 218 WCPGDVIETKARGPPLLSFQRTREIFRGVLLGLEYLHFQGIIHRDIKPANLLLSEDGIVK 277

Query: 497 LCDFGLCKLNMKGQDKTNTF--------CGTPEYLAPELLLGQGYSKV------------ 536
           + DFG+  L       T++          GTP + APE+ L +   K             
Sbjct: 278 ISDFGVS-LAFSSDSSTDSLNELELAKTAGTPAFFAPEICLVEDTIKKFDLDPNSKEPII 336

Query: 537 ---VDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFDK------------ 581
               D W +G+ L+ ++ G+ P+  +   +++ KI+ EPL F + + K            
Sbjct: 337 SFPTDIWAMGITLHCLLFGMLPFISDYELELFDKIVNEPLVF-EPYQKIEQCQVSQVECK 395

Query: 582 ----DAKDLLIGLLSRDPKRRLGFNGADEIKSHPF 612
               +A++LL  LL ++PK+R+    A   K HP+
Sbjct: 396 EEYEEAQNLLNKLLEKNPKKRMAIQDA---KKHPW 427

>Kwal_55.20326
          Length = 750

 Score = 93.2 bits (230), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 74/257 (28%), Positives = 118/257 (45%), Gaps = 10/257 (3%)

Query: 349 TNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERT 408
           T   ++V   EL           V    KK  N+     A++ S  V +  V     E  
Sbjct: 480 TGELMAVKQVELQPTAVAAGVVSVPDEVKKQYNQNANGSAVKNSSQVHRKMVDALQHEMG 539

Query: 409 VLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCA 468
           +L  +++  IV    + Q    L I L ++ GG +   L   G F     R +T ++L  
Sbjct: 540 LLKELQHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNSYGPFEEPLIRNFTRQILIG 599

Query: 469 LETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCK----LNMKGQDKTNTFCGTPEYLA 524
           L  LH  D+I+RD+K  NIL+D +G + + DFG+ K    LN + Q+K  +  G+  ++A
Sbjct: 600 LSYLHRKDIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNQQ-QNKRASLQGSVYWMA 658

Query: 525 PELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDG---FDK 581
           PE++     +K  D W++G ++ EM TG  P+ D    +   KI      FPD       
Sbjct: 659 PEVVKQVVTTKKADIWSVGCVIIEMFTGKHPFPDFSQMQAIFKIGTNT--FPDSPSWSSN 716

Query: 582 DAKDLLIGLLSRDPKRR 598
           +AKD L+     D ++R
Sbjct: 717 EAKDFLLKTFELDYRKR 733

>KLLA0E11979g complement(1060048..1061892) some similarities with
           sp|P25333 Saccharomyces cerevisiae YCR008w SAT4
           serine/threonine-specific protein kinase, hypothetical
           start
          Length = 614

 Score = 92.8 bits (229), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 100/203 (49%), Gaps = 12/203 (5%)

Query: 362 KVIGKGSFGKVMQVRKKDTNKV-----YALKAIRKSYIVSKSEVIHTL-AERTVLARVEN 415
           +VIGKGSFG V    KK+   V     YA+K  R+    +  +    L +E  + + +++
Sbjct: 334 EVIGKGSFGVVRICHKKNLKSVSGEILYAVKEFRRRPTENPVKYSKRLTSEFCISSSLKH 393

Query: 416 PFIVPLKFTFQSPDKLYI-VLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHN 474
             I+     FQ     Y  V+ + +GG+LF  +   G+     A  +  +L+  +  +HN
Sbjct: 394 TNIIETLDLFQDAKGDYCEVMEYCSGGDLFTLIIAAGKLEYQEADCFLKQLITGVVYMHN 453

Query: 475 LDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDK----TNTFCGTPEYLAPELLLG 530
           + V +RDLKPEN+LL H G + + DFG  +      +K    +   CG+  Y+APE    
Sbjct: 454 MGVCHRDLKPENLLLTHDGTLKITDFGNSECFRMAWEKEIHLSGGVCGSGPYIAPEEYTQ 513

Query: 531 QGYS-KVVDWWTLGVLLYEMMTG 552
           + +  + VD W  GV+   M TG
Sbjct: 514 EEFDPRAVDIWACGVIYMAMRTG 536

>KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyveromyces
            lactis MAP kinase kinase kinase, start by similarity
          Length = 1338

 Score = 93.6 bits (231), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 82/271 (30%), Positives = 129/271 (47%), Gaps = 30/271 (11%)

Query: 362  KVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAER-----TVLARVENP 416
            ++IGKGSFG V       T ++ A+K +      S+ E   ++ E      + L  + + 
Sbjct: 1042 EIIGKGSFGAVYLALNVTTGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKDLNHV 1101

Query: 417  FIVPLKFTFQSPDKLY-IVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNL 475
             IV     F+  + +Y + L ++ GG +   ++  GRF     R  T ++L  L  LH+ 
Sbjct: 1102 NIVQY-LGFEEKNGIYSLFLEYVAGGSVGSLIRMYGRFDDQLIRHLTKQVLEGLAYLHSK 1160

Query: 476  DVIYRDLKPENILLDHQGHIALCDFGLC-KLNMKGQDKTNTFCGTPEYLAPELL-LGQGY 533
             +++RD+K +N+LLD+ G   + DFG+  K N    +   T  GT  ++APE++    GY
Sbjct: 1161 GILHRDMKADNLLLDNDGVCKISDFGISRKSNNIYSNSDMTMRGTVFWMAPEMVDTAHGY 1220

Query: 534  SKVVDWWTLGVLLYEMMTGLPPYYD-EDVPKMY---KKILQEPLRFPDGFDKDAKDL--- 586
            S  VD W+LG ++ EM  G  P+ + E V  M+   K     P+  PD    D KDL   
Sbjct: 1221 SAKVDIWSLGCVVLEMFAGKRPWSNFEVVAAMFQIGKSKTAPPI--PD----DTKDLVSP 1274

Query: 587  -----LIGLLSRDPKRRLGFNGADEIKSHPF 612
                 L      DP+ R     AD +  HPF
Sbjct: 1275 AGQSFLDQCFEIDPEMRP---TADSLVGHPF 1302

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score = 93.6 bits (231), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 75/265 (28%), Positives = 128/265 (48%), Gaps = 18/265 (6%)

Query: 362  KVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAER-----TVLARVENP 416
            ++IGKGSFG V       T ++ A+K +      +++E++  + E        L  +++ 
Sbjct: 1155 EMIGKGSFGAVYLSLNITTGEMMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKDLDHL 1214

Query: 417  FIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLD 476
             IV    +    +   + L ++ GG +   ++  GRF     R    ++L  L+ LH+  
Sbjct: 1215 NIVQYLGSEIRGNIYSLFLEYVAGGSVGSLIRLYGRFDEKLIRHLNTQVLSGLKYLHSKG 1274

Query: 477  VIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTN-TFCGTPEYLAPELL-LGQGYS 534
            +++RD+K +N+LLD  G   + DFG+ K +      ++ T  GT  ++APE++   QGYS
Sbjct: 1275 ILHRDMKADNLLLDEDGICKISDFGISKKSKNIYSNSDMTMRGTVFWMAPEMVDTKQGYS 1334

Query: 535  KVVDWWTLGVLLYEMMTGLPPYYD-EDVPKMYK--KILQEPLRFPDG----FDKDAKDLL 587
              VD W+LG ++ EM  G  P+ + E V  M++  K    P   PD          KD L
Sbjct: 1335 AKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGKSKSAPP-IPDDTIQLISSKGKDFL 1393

Query: 588  IGLLSRDPKRRLGFNGADEIKSHPF 612
                  DP++R     AD++  H F
Sbjct: 1394 SKCFEIDPEKRP---TADDLLEHSF 1415

>Kwal_27.12559
          Length = 414

 Score = 90.9 bits (224), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 85/310 (27%), Positives = 137/310 (44%), Gaps = 56/310 (18%)

Query: 357 DFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENP 416
           ++E+++V+GKGS+G V+    K  +      AI+K   +   E++   A R +  +  N 
Sbjct: 65  NYEIIQVLGKGSYGVVVSAIDKGEDGKPRRLAIKKVTNIFNREILLKRAIREL--KFLNF 122

Query: 417 F--------IVPLKFTFQSP-DKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLC 467
           F        +V L+   + P D LY     ++  +L   +    +FS    + +  ++LC
Sbjct: 123 FKGHKNIVSLVDLEIVSEKPYDGLYCYQELVDY-DLARVIHSTVQFSEFHIKHFLYQILC 181

Query: 468 ALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCK------LNMKGQD-KTNTFCGTP 520
            L+ +H+ DVI+RDLKP NIL    G++ +CDFGL +         K  +    ++  T 
Sbjct: 182 GLKYIHSADVIHRDLKPGNILCSIGGNLKICDFGLARGIAPQYFEQKSDEIHITSYVATR 241

Query: 521 EYLAPELLLG-QGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQ---EPLR-- 574
            Y APEL+L  + Y+K +D W +G +L E     P +   D      +IL+    P R  
Sbjct: 242 WYRAPELILSHRRYTKAIDIWAVGCILAEFYGRKPIFMGHDSLHQVSEILKVLGSPCRET 301

Query: 575 ---------------------------FPDGFDKDAKDLLIGLLSRDPKRRLGFNGADEI 607
                                      +P     DA+ LL  LL+ DP +R G   A   
Sbjct: 302 VAKYCSARSWEIFSGRSEVKKMPWSSVYPKSCS-DAQALLDMLLTWDPDKRPGVEVA--- 357

Query: 608 KSHPFFSQLS 617
             HPFF  +S
Sbjct: 358 LCHPFFEDVS 367

>Scas_720.94
          Length = 1683

 Score = 93.2 bits (230), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 79/269 (29%), Positives = 118/269 (43%), Gaps = 35/269 (13%)

Query: 364  IGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAER-TVLARVENPFIVPLK 422
            IG G+FG V      D  ++ A+K I+     +  ++   + E  TVL  + +P IV   
Sbjct: 1367 IGGGTFGTVYSAVNLDNGEILAVKEIKIQDSKTMKKIFPLVKEEMTVLEMLNHPNIVQYY 1426

Query: 423  FTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRA-RLYTAELLCALETLHNLDVIYRD 481
                  DK+ I + +  GG +   L+  GR       ++YT ELL  L  LH   V++RD
Sbjct: 1427 GVEVHRDKVNIFMEYCEGGSMASLLEH-GRIEDEMVTQVYTLELLEGLAYLHQAGVVHRD 1485

Query: 482  LKPENILLDHQGHIALCDFGLCK-----------LNMK--------------GQDKTNTF 516
            +KPENILLD  G I   DFG  +           +N K              G +  +  
Sbjct: 1486 IKPENILLDFNGIIKYVDFGAARKIAKNGTKVTNINSKSKDDDEPDEKDTEGGANSVHDM 1545

Query: 517  CGTPEYLAPELLLGQGYSKVV---DWWTLGVLLYEMMTGLPPY--YDEDVPKMYKKIL-Q 570
             GTP Y+APE + G          D W+ G ++ EM+TG  P+   D +   +Y     Q
Sbjct: 1546 LGTPMYMAPESITGYKNKTKFGSDDIWSFGCVVLEMITGRRPWANLDNEWAIIYHVAAGQ 1605

Query: 571  EP-LRFPDGFDKDAKDLLIGLLSRDPKRR 598
             P L +P+      +  L   L +DP +R
Sbjct: 1606 TPQLPYPNEVSPAGRRFLQRCLVQDPIKR 1634

>Scas_602.11
          Length = 1186

 Score = 92.8 bits (229), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 86/391 (21%), Positives = 163/391 (41%), Gaps = 103/391 (26%)

Query: 322 FRLYNHQWIGLAQGNGKLN--------LSVDYKPATNRALSVDDFELLKVIGKGSFGKVM 373
           F  +N+++  L +  G+ +        +S+ Y P + R + ++ +E++K +G G  GKV 
Sbjct: 129 FNTFNNKFATLDEKLGRTSTKVKETNRISLTYDPISKRKV-LNTYEIIKELGHGQHGKVK 187

Query: 374 QVRKKDTNKVYALKAIRKSYIVSKSEVI-----------HTLAERTVLARVENPFIVPLK 422
             +   T+++ A+K + +   +  +                  E  ++ ++ +  +V L 
Sbjct: 188 LAKDLLTSQLVAIKIVDRHEKLRLTNFFKFNKRKQQNDDRIKREIAIMKKLHHKHVVKLI 247

Query: 423 FTFQ--SPDKLYIVLAFINGGELFYH----LQREGR----FSLSRARLYTAELLCALETL 472
                    K+Y+VL +   GE+ +     L+ E +     S   AR     ++  LE L
Sbjct: 248 EVLDDLKSRKIYLVLEYCAQGEIKWCPKDCLETEAKGPPLLSFQSAREIIRGVILGLEYL 307

Query: 473 HNLDVIYRDLKPENILLDHQGHIALCDFG-------------------------LCKLNM 507
           H   +I+RD+KP N+L+D +G + + DFG                         L + + 
Sbjct: 308 HYQGIIHRDIKPANLLVDEEGTVKISDFGVSLASRSSGNSTANSSSVLGGTPRNLSRSST 367

Query: 508 KGQDKTNT-------------FCGTPEYLAPELLLGQ-----------------GYSKVV 537
           +  + TN                GTP + APE+ LG+                   S ++
Sbjct: 368 ESMNTTNNNDDESIDEVELAKTAGTPAFFAPEICLGEEAFDKFSLRKNEMFKGSCISFMI 427

Query: 538 DWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFD---------------KD 582
           D W LG+  Y ++ G+ P+  +   ++++KI+ EPL FP   +               + 
Sbjct: 428 DIWALGITFYCLLFGMLPFISDFELELFEKIVGEPLTFPSYEELQANRVSNVCSIEEYEA 487

Query: 583 AKDLLIGLLSRDPKRRLGFNGADEIKSHPFF 613
           AK++L  LL ++P +R       E+K HPF 
Sbjct: 488 AKNVLQRLLEKNPSKRCSI---LELKYHPFI 515

>Scas_680.20
          Length = 482

 Score = 91.3 bits (225), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 84/303 (27%), Positives = 138/303 (45%), Gaps = 56/303 (18%)

Query: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPF 417
           ++ L++ G GSFG V++ +     ++ ALK I ++      E+        +L  +++P 
Sbjct: 167 YKTLEIQGSGSFGLVLKAKTLHNGEIVALKKIIQNKKFKNREL-------HMLRLLDHPN 219

Query: 418 IVPLKFTFQSP---DKLYIVLAFINGGELFYHLQREGRFSLSRA--------RLYTAELL 466
           I+ LK+ F  P   D+ Y+ L F       Y   R+   + S          + Y  ++ 
Sbjct: 220 IISLKYFFVEPIDNDESYLNLIFEFVPLSLYQRIRQVATTTSSVQPSHKLEFKCYMWQIF 279

Query: 467 CALETLHN-LDVIYRDLKPENILLDHQG-HIALCDFGLCKLNMKGQDKTNTFCGTPEYLA 524
            AL+ LHN +++ +RD+KP+NIL+D     + +CDFG  K  +   DK  +F  +  Y A
Sbjct: 280 KALDYLHNEVNICHRDIKPQNILIDPMDWSLKICDFGSAK-RLNPHDKNVSFICSRFYRA 338

Query: 525 PELLLGQ-GYSKVVDWWTLGVLLYEMMTGLPPYY----DEDVPKMYKKILQEPL------ 573
           PEL+LG   Y+  +D W+ G +  E++  L P++    D D      +IL  P       
Sbjct: 339 PELILGAIQYTNSIDLWSTGCVFAELLL-LKPFFAGKSDTDQIVEIIRILGTPTLKDIIS 397

Query: 574 --------RFP------------DGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFF 613
                   RFP            D  +K A DLL  +L  DP  R+    + +   HP+F
Sbjct: 398 MNENYKDYRFPRIHGISWSRLFSDKVEKSAIDLLDKILRYDPTERI---DSSKCLIHPYF 454

Query: 614 SQL 616
             L
Sbjct: 455 DDL 457

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score = 92.4 bits (228), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 77/265 (29%), Positives = 128/265 (48%), Gaps = 18/265 (6%)

Query: 362  KVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVI-----HTLAERTVLARVENP 416
            ++IGKGSFG V       T ++ A+K +      S+ E         ++E + L  +++ 
Sbjct: 1128 EMIGKGSFGAVYLGLNVTTGEMMAVKQVEVPKFGSQDETTVNNAEALISEVSTLKDLDHL 1187

Query: 417  FIVPLKFTFQSPDKLY-IVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNL 475
             IV     F++ + +Y + L ++ GG +   ++  G F     R  T ++L  L  LH  
Sbjct: 1188 NIVQY-LGFENKNCIYSLFLEYVAGGSVGSLIRLYGHFDEQLIRFLTTQVLEGLAYLHLR 1246

Query: 476  DVIYRDLKPENILLDHQGHIALCDFGLC-KLNMKGQDKTNTFCGTPEYLAPELL-LGQGY 533
             +++RD+K +N+LLD+ G   + DFG+  K N    +   T  GT  ++APE++   QGY
Sbjct: 1247 GILHRDMKADNLLLDNDGVCKISDFGISRKSNNIYSNSEMTMRGTVFWMAPEMVDTTQGY 1306

Query: 534  SKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFPDGFD------KDAKDLL 587
            S  VD W+LG ++ EM  G  P+ + +V     +I +     P   D      +D +  L
Sbjct: 1307 SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGKSKSAPPIPEDTLPHISQDGRAFL 1366

Query: 588  IGLLSRDPKRRLGFNGADEIKSHPF 612
                  DP+ R     AD + SHPF
Sbjct: 1367 DDCFMIDPEERP---TADTLLSHPF 1388

>Scas_700.35
          Length = 439

 Score = 90.5 bits (223), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 63/204 (30%), Positives = 101/204 (49%), Gaps = 12/204 (5%)

Query: 361 LKVIGKGSFGKVMQVR-KKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLAR-VENPFI 418
           L ++G+G+ G V + R +K++++V+ALK I    + +  E    L       +  ++ +I
Sbjct: 152 LGMLGEGAGGSVAKCRLRKNSSQVFALKTINT--LNTDPEFQKQLFRELEFNKSFKSNYI 209

Query: 419 VPLKFTFQSP--DKLYIVLAFINGGEL--FYH--LQREGRFSLSRARLYTAELLCALETL 472
           V     F       +YI + ++ G  L   Y   L R GR            +L  L  L
Sbjct: 210 VTYYGMFNDTLNGSIYIAMEYMGGQSLDTIYKSLLSRGGRIGEKILGKIAESVLRGLSYL 269

Query: 473 HNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQG 532
           H   +I+RD+KP+NILL+ +G + LCDFG+    +       TF GT  Y+APE + G  
Sbjct: 270 HERKIIHRDIKPQNILLNEEGEVKLCDFGVSGEAV--NSLATTFTGTSFYMAPERIQGHP 327

Query: 533 YSKVVDWWTLGVLLYEMMTGLPPY 556
           YS   D W+LG+ + E+  G  P+
Sbjct: 328 YSVTCDVWSLGLTILEVAQGRFPF 351

>Kwal_23.5576
          Length = 504

 Score = 90.9 bits (224), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 82/316 (25%), Positives = 141/316 (44%), Gaps = 61/316 (19%)

Query: 350 NRALSVDD-FELLKVIGKGSFGKVMQVR------------KKDTNKVYALKAIRKSYIVS 396
           N+  +VD  F+L+K IG G++G V   R            KK TN V++   + K  +  
Sbjct: 14  NQEFTVDKRFQLIKEIGHGAYGIVCSARFIEAAEETNVAIKKVTN-VFSKTLLCKRSLRE 72

Query: 397 KSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGR-FSL 455
              + H    + +    +   +     TF     LY+    +      + + + G+  + 
Sbjct: 73  LKLLRHFRGHKNITCLYDMDIVFSPNNTFNG---LYLYEELMECD--IHQIIKSGQPLTD 127

Query: 456 SRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNT 515
           +  + +  +LLCAL+ +H+ DV++RDLKP N+L++    + +CDFGL +   +   + N 
Sbjct: 128 AHYQSFIYQLLCALKYIHSADVLHRDLKPGNLLVNADCQLKVCDFGLARGYSENPVENNQ 187

Query: 516 F----CGTPEYLAPELLLG-QGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQ 570
           F      T  Y APE++L  QGY+K +D W+ G +L E++ G P +  +D      +ILQ
Sbjct: 188 FLTEYVATRWYRAPEIMLSYQGYTKAIDIWSCGCILAELLGGKPIFKGKDYVDQLNRILQ 247

Query: 571 -------EPLR-------------------------FPDGFDKDAKDLLIGLLSRDPKRR 598
                  E L                          +P   +  A DLL  +L+ DP++R
Sbjct: 248 VLGTPPEETLERIGSKNVQDYIHQLGYIPKVPFVTLYPQA-NVQALDLLEKMLTFDPQKR 306

Query: 599 LGFNGADEIKSHPFFS 614
           +     +E   HP+ S
Sbjct: 307 I---TVEEALEHPYLS 319

>CAGL0J04290g complement(400939..402012) similar to sp|P16892
           Saccharomyces cerevisiae YBL016w FUS3 or sp|P14681
           Saccharomyces cerevisiae YGR040w KSS1, start by
           similarity
          Length = 357

 Score = 89.4 bits (220), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 81/308 (26%), Positives = 140/308 (45%), Gaps = 59/308 (19%)

Query: 357 DFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENP 416
           DF+L  ++G+G++G V     K T ++ A+K I           + TL E  +L R ++ 
Sbjct: 12  DFQLKSLLGEGAYGVVCSAVHKPTGEIVAIKKIVP--FDKPLFALRTLREIKILRRFQHE 69

Query: 417 FIVPLKFTFQSPD------KLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALE 470
            I+ + F  Q P+      ++YI+   +      + +      +    + +  + L A++
Sbjct: 70  NIISI-FDIQKPESFEKFNEVYIIQELMQTD--LHRVIATQTLTDDHIQYFIYQTLRAIK 126

Query: 471 TLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTN--------TFCGTPEY 522
           TLH  +VI+RDLKP NIL++    + +CDFGL ++   G++  N         +  T  Y
Sbjct: 127 TLHGSNVIHRDLKPSNILINSNCDLKVCDFGLARIIDSGENGDNEVDKIGMTEYVATRWY 186

Query: 523 LAPELLLGQG-YSKVVDWWTLGVLLYEM---------------------MTGLPPYYDED 560
            APE++L    YS+ +D W+ G +L E+                     + G P   D+ 
Sbjct: 187 RAPEVMLTNAKYSRAMDIWSCGCILGELFLKRPLFPGKDYRHQLLLIFGLIGTPDSSDKS 246

Query: 561 V-------PKMYKKILQE--PLR-----FPDGFDKDAKDLLIGLLSRDPKRRLGFNGADE 606
           +        + Y   LQ+  P+R     FP G +    DLL  +L  DP+ R+    AD+
Sbjct: 247 MECIESRRARQYIASLQKYPPVRPLQKAFP-GVNPVGVDLLSRMLVFDPRERI---SADD 302

Query: 607 IKSHPFFS 614
             +HP+ S
Sbjct: 303 ALAHPYLS 310

>Scas_683.6
          Length = 377

 Score = 89.4 bits (220), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 85/308 (27%), Positives = 138/308 (44%), Gaps = 58/308 (18%)

Query: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIR---KSYIVSKSEVIHTLAERTVLARVE 414
           ++L+ +IG+G++G V     K +    A+K I+   K+  V+++  +  +   T     E
Sbjct: 13  YQLVDLIGEGAYGTVCSAIHKPSGIKVAIKKIQPFSKAMFVTRT--LREIKLLTYFNNHE 70

Query: 415 NPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQR-------EGRFSLSRARLYTAELLC 467
           N   +  K    S DK   V  ++    +   LQR           +    + +T ++L 
Sbjct: 71  NIISILDKIKPISMDKFQAV--YLVQELMETDLQRVISNNNTNKSLTDDHIQYFTYQILR 128

Query: 468 ALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCG-------TP 520
           AL+++H+  VI+RDLKP N+LL+    + +CDFGL +      D   T  G       T 
Sbjct: 129 ALKSIHSAKVIHRDLKPSNLLLNSNCDLKICDFGLSRCLTSSNDSKKTLVGFMTEYVATR 188

Query: 521 EYLAPELLLG-QGYSKVVDWWTLGVLLYEMMTGLP--PYYD-----------------ED 560
            Y APE++L  Q Y+  +D W++G +L EM+TG P  P  D                 ED
Sbjct: 189 WYRAPEIMLTFQEYTTAMDIWSVGCILAEMVTGRPLFPGRDYHHQLWLILEVLGTPSLED 248

Query: 561 VPKMYKKILQE-----PLRFPDGFD---------KDAKDLLIGLLSRDPKRRLGFNGADE 606
             ++  K  +E     PL+ P  +D          D  DLL  +L  +P +R+    A E
Sbjct: 249 FEQIKSKRAREYIANLPLKPPMAWDIVLSNTNLNPDLIDLLTKMLMFNPNKRI---SAAE 305

Query: 607 IKSHPFFS 614
              HP+ S
Sbjct: 306 ALQHPYLS 313

>Scas_643.20
          Length = 1082

 Score = 91.7 bits (226), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 73/256 (28%), Positives = 128/256 (50%), Gaps = 29/256 (11%)

Query: 342  SVDYKPATN-----RALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVS 396
            S +Y P+T+     R     DF +L+ +G+G++GKV     K+   +  +K I K  I+ 
Sbjct: 801  SFNYTPSTSIGSQKRIKKFSDFTVLQQLGEGAYGKVKLCIHKEKRTIVVIKMIFKERILV 860

Query: 397  KSEV----IHTL-AERTVLARVE---NPFIVPLKFTFQSPDKLYIVLAFINGGE-----L 443
             + V    + T+ +E  ++A +    +  IV L   F+  D+ Y  +     GE     L
Sbjct: 861  DTWVRDRKLGTIPSEIQIMATLNKKPHKNIVALLDFFE--DEEYYYMETPAHGETGSIDL 918

Query: 444  FYHLQREGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLC 503
            F  ++ +   +    +L   +++  L+ LH+  +++RD+K EN+++D +GH+ L D+G  
Sbjct: 919  FDLIELKKNMTEYEEKLIFKQVVSGLKHLHDQGIVHRDIKDENVIVDSKGHVKLIDYGSA 978

Query: 504  KLNMKGQDKTNTFCGTPEYLAPELLLGQGY-SKVVDWWTLGVLLYEMMTGLPPYYDEDVP 562
                 G    + F GT +Y APE+L G  Y  K  D W +G+LLY ++    P+Y+ D  
Sbjct: 979  AYTKSG--PFDVFVGTIDYAAPEVLGGSVYDGKPQDIWAIGILLYTIIFKENPFYNID-- 1034

Query: 563  KMYKKILQEPLRFPDG 578
                +I+   LRF D 
Sbjct: 1035 ----EIMDGELRFNDA 1046

>Kwal_33.13222
          Length = 148

 Score = 84.0 bits (206), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 42/113 (37%), Positives = 67/113 (59%), Gaps = 3/113 (2%)

Query: 425 FQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLDVIYRDLKP 484
           +++   LY+VL ++  GELF  L   G    + A  +  +++  +   H L +++RDLKP
Sbjct: 16  WETNSNLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKP 75

Query: 485 ENILLDHQGHIALCDFGLCKLNMKGQDK-TNTFCGTPEYLAPELLLGQGYSKV 536
           EN+LLDH+ +I + DFG+  L  K  DK   T CG+P Y APE++ G   S++
Sbjct: 76  ENLLLDHKFNIKIADFGMAALESK--DKLLETSCGSPHYAAPEIVSGTALSRL 126

>AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W
           (RCK1) - SH] complement(289989..291593) [1605 bp, 534
           aa]
          Length = 534

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 87/311 (27%), Positives = 131/311 (42%), Gaps = 75/311 (24%)

Query: 358 FELLKVIGKGSFGKVMQ-VRKKDTNKVY--------ALKAIRKSYI-------------- 394
           ++LL  IG+G+F +V + V  KD    Y        A+K I K  +              
Sbjct: 91  YKLLGKIGEGAFSEVYRAVPLKDGPNAYLSSRYKQVAVKVISKKRLSTTASTTGRRRDKR 150

Query: 395 --------VSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLY-IVLAFINGGELFY 445
                    S+ +V+  +     ++  EN  IV     FQ  +  Y IV   + GGE+F 
Sbjct: 151 EEAGENKATSREQVLKEITIHKAVSSGEN--IVTF-IDFQETESYYFIVQELLAGGEIFG 207

Query: 446 HLQREGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLD--------------- 490
            + R   FS   +R    +L  A++ +H+L +++RD+KPEN+L                 
Sbjct: 208 EIVRLTYFSEDLSRHVIRQLALAVKHMHSLGIVHRDIKPENLLFSPIDFIPSKRQQLRQS 267

Query: 491 -------------------HQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQ 531
                                G I L DFGL K        T T CGT  Y APE++  +
Sbjct: 268 DDPKTKQDEGLFRPGIGGGGIGVIKLADFGLSKQIYA--TNTTTPCGTVGYTAPEVVKDE 325

Query: 532 GYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRF--P--DGFDKDAKDLL 587
            YS  VD W +G +LY ++ G PP+YDE +  + + I +    F  P  D     AK+ +
Sbjct: 326 RYSMKVDMWGIGCVLYTVLCGFPPFYDEKIDVLTELISKGQYTFLRPWWDEISPGAKNAV 385

Query: 588 IGLLSRDPKRR 598
             LL  DP +R
Sbjct: 386 RRLLEVDPDKR 396

>YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capable
           of suppressing DNA polymerase alpha mutations [3429 bp,
           1142 aa]
          Length = 1142

 Score = 91.3 bits (225), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 69/284 (24%), Positives = 130/284 (45%), Gaps = 49/284 (17%)

Query: 341 LSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAI-------RKSY 393
           +S+ Y P + R + ++ +E++K +G G  GKV   R   + ++ A+K +       RK +
Sbjct: 117 ISLTYDPVSKRKV-LNTYEIIKELGHGQHGKVKLARDILSKQLVAIKIVDRHEKKQRKFF 175

Query: 394 IVSKSEVI----HTLAERTVLARVENPFIVPLKFTFQ--SPDKLYIVLAFINGGELFYH- 446
              KS  I        E  ++ +  +  +V L          K+Y+VL + + GE+ +  
Sbjct: 176 TFIKSSKISENDKIKREIAIMKKCHHKHVVQLIEVLDDLKSRKIYLVLEYCSRGEVKWCP 235

Query: 447 ---LQREGR----FSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCD 499
              ++ + +     S    R     ++  LE LH   +I+RD+KP N+L+   G + + D
Sbjct: 236 PDCMESDAKGPSLLSFQETREILRGVVLGLEYLHYQGIIHRDIKPANLLISGDGTVKISD 295

Query: 500 FGLC----------KLNMKGQDKTNTFCGTPEYLAPELLLGQ-----------------G 532
           FG+                 + +     GTP + APE+ LG+                  
Sbjct: 296 FGVSLAASSTNSSDSSESLDELELAKTVGTPAFFAPEMCLGEDAFTRYNLTKENLFRGSC 355

Query: 533 YSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRFP 576
            S ++D W +GV LY ++ G+ P++ +   K+++KI+ +PL+FP
Sbjct: 356 ISFMIDIWAVGVTLYCLLFGMLPFFSDFELKLFEKIVNDPLKFP 399

>Scas_623.11
          Length = 378

 Score = 88.2 bits (217), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 109/208 (52%), Gaps = 19/208 (9%)

Query: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPF 417
           F   ++IGKGSFG V     ++T++V A+K + +       E+        ++  +++P 
Sbjct: 47  FPTTEIIGKGSFGLVFCTTIRETDEVVAIKKVLQDRRFKNREL-------EIMKLIQHPN 99

Query: 418 IVPLKFTFQSP---DKLYIVLAFINGGELFYHLQR---EGRFSLSR--ARLYTAELLCAL 469
           ++ LK+ F      D++Y+ L      +  Y   R     R S+SR   + Y  +L  +L
Sbjct: 100 VINLKYYFYEKDVDDEVYLNLILDYMPQSLYQRLRHFVHQRQSMSRLEIKFYMFQLFKSL 159

Query: 470 ETLHNL-DVIYRDLKPENILLD-HQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPEL 527
             LHN  +V +RD+KP+NIL+D +  ++ LCDFG  K  +K  +   ++  +  Y APEL
Sbjct: 160 NYLHNAKNVCHRDIKPQNILVDPNSWNLKLCDFGSAK-QLKPTEPNVSYICSRYYRAPEL 218

Query: 528 LLGQ-GYSKVVDWWTLGVLLYEMMTGLP 554
           + G   YS  +D W+ G ++ E++ G P
Sbjct: 219 IFGATNYSNQIDIWSSGCVMAELLLGQP 246

>AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH]
           (805583..806956) [1374 bp, 457 aa]
          Length = 457

 Score = 89.0 bits (219), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 77/292 (26%), Positives = 134/292 (45%), Gaps = 40/292 (13%)

Query: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENPF 417
           ++ +  +G+G++GKV + R   TNK+ ALK +R          I ++ E  +L   ++  
Sbjct: 122 YQRITQVGEGTYGKVYKCRNIYTNKLVALKKLRLE-TERDGFPITSIREIKLLQHCQHEN 180

Query: 418 IVPL-KFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLHNLD 476
           +  + +   ++   +Y++  + +       + +E  FS +  +    +LL  +E LH   
Sbjct: 181 VSTIAEIMCEAQKTVYMIFEYADNDLSGLLMNKEIHFSDANCKHLFRQLLKGMEYLHECR 240

Query: 477 VIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQG-YSK 535
           +++RD+K  NIL+D++G++ + DFGL +   +  D TN    T  Y  PELLLG   Y  
Sbjct: 241 ILHRDIKGSNILIDNRGNLKITDFGLARKMKQEPDYTNRVI-TLWYRPPELLLGTTRYGT 299

Query: 536 VVDWWTLGVLLYEM---------------------MTGLPPYYDE----DVPKMYKKILQ 570
            VD W  G LL E+                     + G P         D+P  +  I Q
Sbjct: 300 EVDMWGCGCLLVELFLKAAFFQGTNELEQLRCIFQVLGTPTIEQWPGLFDMPWWFMMIPQ 359

Query: 571 EPLRFPDGFD---------KDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFF 613
           +   +P  FD         +  +DL  GLL  D K+R  F+ ++ +KS  F+
Sbjct: 360 QKENYPSRFDEKVSGVLPTQSCRDLARGLLLYDQKKR--FSASEALKSAYFY 409

>Kwal_26.7154
          Length = 1213

 Score = 90.5 bits (223), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 78/275 (28%), Positives = 132/275 (48%), Gaps = 33/275 (12%)

Query: 357  DFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEV-----------IHTLA 405
            DFE+L+ +G+G++GKV     K    +  +K I K  I+  + V           I  +A
Sbjct: 952  DFEVLQKMGEGAYGKVDLCMHKKDRYIVVIKLIFKERILVDTWVRDRKLGTIPSEIQIMA 1011

Query: 406  ERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGG----ELFYHLQREGRFSLSRARLY 461
              T+ A+     ++ L F F+  D  YI  A ++G     +LF  ++ +   +   A L 
Sbjct: 1012 --TLNAKPHENILMLLDF-FEDDDYYYIETA-VHGTSGSIDLFDLIEMKTDMTEHEAMLI 1067

Query: 462  TAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPE 521
              ++   ++ LH+  +++RD+K EN+++D  G + + DFG       G    + F GT +
Sbjct: 1068 FKQIASGIKNLHDNGIVHRDIKDENVIVDCNGFVKIVDFGSAAYVKSG--PFDVFVGTID 1125

Query: 522  YLAPELLLGQGYS-KVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQEPLRF--PDG 578
            Y APE+L G+ Y  K  D W +GVLLY ++    P+Y+ D      +IL   LR    + 
Sbjct: 1126 YAAPEVLGGEPYEGKPQDIWAIGVLLYTIIYKENPFYNID------EILDADLRVNSSER 1179

Query: 579  FDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFF 613
               D   L+  +L+R   +R      DEI +H + 
Sbjct: 1180 ISDDCIALIRKILNRSVSKRPSI---DEICNHKWL 1211

>CAGL0I04422g 394159..395427 some similarities with sp|P22209
           Saccharomyces cerevisiae YAR018c KIN3 ser/thr protein
           kinase, hypothetical start
          Length = 422

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 130/276 (47%), Gaps = 65/276 (23%)

Query: 357 DFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARVENP 416
           D++++K IG+GSFG V +V    T +V   K I+  ++ SK E    +AE T+L+++++ 
Sbjct: 13  DYQVVKEIGRGSFGSVHKVIHVPTQQVLVRKDIKYGHMNSK-ERQQLIAECTILSQLKHE 71

Query: 417 FIVPL-KFTF-QSPDKLYIVLAFINGGEL---FYHLQREGRFSLSR------ARLYTAEL 465
            IV    + F +  + LY+ + + + G+L     H ++E ++   +      A++ TA  
Sbjct: 72  NIVEFYSWDFNEQQEVLYLYMEYCSRGDLSGMIKHYKQEHKYIPEKVVWGILAQMLTALY 131

Query: 466 LC-------ALETLHNLD---------VIYRDLKPENILLDH------------------ 491
            C       +L T+++           VI+RDLKP NI L +                  
Sbjct: 132 KCHYGEELPSLTTIYDRMKPPSKGRNIVIHRDLKPGNIFLSYDDNSSDSTDKADIAQSNW 191

Query: 492 -------------------QGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLGQG 532
                              Q  + + DFGL K      D   T+ GTP Y++PE+L+ Q 
Sbjct: 192 YRKPNNRGGDESKLTTDYSQVVVKVGDFGLAKSLATSVDFATTYVGTPYYMSPEVLMDQP 251

Query: 533 YSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKI 568
           YS + D W+LG ++YEM +  PP+  ++  ++  KI
Sbjct: 252 YSPLSDIWSLGCVIYEMCSLHPPFLAKNYLELQTKI 287

>AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -
           SH] (1066272..1067981) [1710 bp, 569 aa]
          Length = 569

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 76/304 (25%), Positives = 141/304 (46%), Gaps = 54/304 (17%)

Query: 358 FELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVI-HTLAERTVLARVENP 416
           F+L+K IG G++G V   R  ++ +   +   + + + SK+ +   +L E  +L      
Sbjct: 23  FQLIKEIGYGAYGIVCSARFMESVEDTTVAIKKVTNVFSKALLCKRSLRELKLLRHFRGH 82

Query: 417 FIVPLKFTFQSPDKLYIVLAFINGGELF--------YHLQREGR-FSLSRARLYTAELLC 467
             +   +     D + +     NG +L+        + + + G+  + +  + +  ++LC
Sbjct: 83  KNITCLYDM---DIVLLPDGSFNGLDLYEELMEWDMHQIIKSGQPLTDAHYQSFVYQILC 139

Query: 468 ALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTF----CGTPEYL 523
            L+ +H+ DV++RDLKP N+L++    + +CDFGL +   +   + + F      T  Y 
Sbjct: 140 GLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPIENDQFLTEYVATRWYR 199

Query: 524 APELLLG-QGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMYKKILQ-------EPLR- 574
           APE++L  QGY++ +D W+ G +L E++ G P +  +D      +ILQ       E L+ 
Sbjct: 200 APEIMLSYQGYTRAIDVWSCGCVLAELLGGRPIFKGKDYVDQLNRILQVLGTPPEETLKR 259

Query: 575 ------------------------FPDGFDKDAKDLLIGLLSRDPKRRLGFNGADEIKSH 610
                                   +P+  + DA DLL  +L+ DPK R+     DE   H
Sbjct: 260 IGSKNVQDYIHQLGYIPKVPFERLYPNA-NPDAADLLERMLALDPKTRI---TVDEALEH 315

Query: 611 PFFS 614
           P+ S
Sbjct: 316 PYLS 319

>CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces
           cerevisiae YDL159w STE7 ser/thr/tyr protein kinase of
           MAP kinase kinase family, hypothetical start
          Length = 451

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 91/329 (27%), Positives = 144/329 (43%), Gaps = 54/329 (16%)

Query: 341 LSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALK--------AIRKS 392
           L+VD     N  L   D   L  +G G+ G VM+V    +++V A K        AI K 
Sbjct: 89  LAVDGHSGCNYDLR--DLVQLGKLGSGNSGTVMKVLHVPSSRVIAKKTIVIEQNNAIVKQ 146

Query: 393 YIVSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGEL------FYH 446
            I  +  ++ ++AE   +        +       S D + I++ ++N G L      +  
Sbjct: 147 QIYRELTIMRSVAEHRNIVEFYGAHNLSSDSINGSND-VVILMEYMNCGSLDTITRTYKS 205

Query: 447 LQREGRFSLSRA-------------RLYTAELLCALETLH-NLDVIYRDLKPENILLDHQ 492
           LQR G  + +R+                   +L  L  L+ N  +I+RD+KP N+L++ +
Sbjct: 206 LQRRGILAANRSYPVQEWFSKPVIISRIAYSVLNGLSYLYENYKIIHRDIKPSNVLINSK 265

Query: 493 GHIALCDFGLC-KLNMKGQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMMT 551
           G I LCDFG+  KLN    D   TF GT  Y++PE + G  Y+   D W+LG++L E++T
Sbjct: 266 GRIKLCDFGVSRKLNNSIAD---TFVGTSTYMSPERIQGNKYTTKGDVWSLGLMLIELLT 322

Query: 552 G-LPPYYDEDVP----KMYKKILQEPL-RFPDGFDK----DAKDLLIGLLSRDPKRRLGF 601
           G  P     D P     + ++I+ EP  + P    K    D  + +     +  K R   
Sbjct: 323 GEFPLGGHNDTPDGILDLLQRIVNEPAPKLPSSVIKVLPPDMVNFIDLCCVKVEKDR--- 379

Query: 602 NGADEIKSHPFFSQLSWK------RLWMK 624
               E+  HPF  +   K      +LW K
Sbjct: 380 GSLQELLKHPFIVRFRTKESTDAFKLWTK 408

>KLLA0E14828g complement(1323743..1324675)
           gi|27526973|emb|CAD36964.1 Kluyveromyces lactis
           serine/threonine-protein kinase KIN28, start by
           similarity
          Length = 310

 Score = 86.3 bits (212), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 98/202 (48%), Gaps = 2/202 (0%)

Query: 354 SVDDFELLKVIGKGSFGKVMQVRKKDTNKVYALKAIRKSYIVSKSEVIHTLAERTVLARV 413
           +VDD+   K  G+G++  V    KK T +  A+K I+ S      + +  L E   L  +
Sbjct: 6   TVDDYTKEKKAGEGTYAVVYLGTKKSTGRSIAVKEIKTSQFKDGLD-MSALREVKFLQEL 64

Query: 414 ENPFIVPLKFTFQSPDKLYIVLAFINGGELFYHLQREGRFSLSRARLYTAELLCALETLH 473
           ++  ++ L   F + D L +VL F+              FS +  + +    L  +   H
Sbjct: 65  KHVNVIELVDVFMANDNLNLVLEFLPADLEIIIKDTSIMFSPADIKSWILMTLRGVHHCH 124

Query: 474 NLDVIYRDLKPENILLDHQGHIALCDFGLCKLNMKGQDKTNTFCGTPEYLAPELLLG-QG 532
              +++RDLKP N+LL   G + + DFGL +L    Q+   +   T  Y APELL G + 
Sbjct: 125 RNFILHRDLKPNNLLLAPDGQLKIADFGLARLMASPQEILTSNVVTRWYRAPELLFGAKH 184

Query: 533 YSKVVDWWTLGVLLYEMMTGLP 554
           Y+  VD W++GV+  E+M  +P
Sbjct: 185 YTSAVDIWSVGVIFAELMLRIP 206

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.136    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 23,149,180
Number of extensions: 1082038
Number of successful extensions: 4920
Number of sequences better than 10.0: 663
Number of HSP's gapped: 3976
Number of HSP's successfully gapped: 747
Length of query: 681
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 573
Effective length of database: 12,857,365
Effective search space: 7367270145
Effective search space used: 7367270145
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)