Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.71231081106650170.0
KLLA0F07513g1048106127830.0
CAGL0H06193g112657023130.0
YAL019W (FUN30)113156622910.0
Scas_548.4105456522680.0
ACR286C101955722590.0
Kwal_26.916414545557663e-84
YOR290C (SNF2)17035627659e-84
AFR562C14445407559e-83
Scas_594.717035587561e-82
CAGL0I09614g10395407386e-82
CAGL0M04807g17305767481e-81
Kwal_34.1592510255347291e-80
Scas_665.1710605337301e-80
KLLA0B08327g15345497391e-80
YOR304W (ISW2)11205337311e-80
Kwal_23.477713015357361e-80
Scas_662.713425327301e-79
AER375C12885377253e-79
Scas_652.1710255467174e-79
Kwal_14.160011025507151e-78
KLLA0F04521g13445377131e-77
CAGL0C01683g11155647062e-77
Scas_576.614575457123e-77
AFR537W10255346981e-76
CAGL0G08756g13545327033e-76
KLLA0E04048g8265816821e-75
CAGL0L11770g14765476954e-75
KLLA0F24838g10625496841e-74
Kwal_56.2344214355476874e-74
YER164W (CHD1)14685456812e-73
KLLA0C17578g15255456804e-73
YIL126W (STH1)13595326751e-72
AGR123C14225476671e-71
CAGL0H05533g19045786316e-67
AEL256C18665806121e-64
Kwal_14.15378425485175e-54
AEL065C10256015208e-54
KLLA0E22726g10335765172e-53
Scas_646.3*14563285192e-53
Scas_668.188755435097e-53
CAGL0I04224g9425485117e-53
CAGL0E05038g14843355103e-52
Kwal_55.2014314943345094e-52
YDR334W15143345095e-52
AEL297W8955455035e-52
ADR309W14863255078e-52
Scas_669.2013973325041e-51
Kwal_27.1138813343315041e-51
YFR038W8532804962e-51
Sklu_2125.310525714984e-51
KLLA0F21758g15723344998e-51
Scas_520.58632904929e-51
CAGL0M01188g14503344989e-51
YGL150C (INO80)14893324971e-50
KLLA0E08965g14893394933e-50
KLLA0A03069g8955524822e-49
CAGL0J02662g8442794793e-49
AGR379W14143364844e-49
YBR073W (RDH54)9245404662e-47
Kwal_47.180778092794624e-47
YBR245C (ISW1)11293344648e-47
Scas_597.810653364621e-46
ADL098C8042834562e-46
AFL040W10863344565e-46
Scas_664.918592764507e-45
KLLA0E23804g18732864491e-44
Scas_718.409265274441e-44
YPL082C (MOT1)18672824401e-43
KLLA0F06710g10963334309e-43
Scas_591.107726063724e-36
Kwal_34.160827264233119e-29
Scas_549.410794023121e-28
CAGL0I01694g10714143102e-28
YJR035W (RAD26)10854113102e-28
AGL212W9031482922e-26
Sklu_1582.22831542672e-25
YGL163C (RAD54)8982782833e-25
Kwal_27.105139001492833e-25
KLLA0F11814g9311482824e-25
AAR147W15801582745e-24
Kwal_14.186813571722673e-23
KLLA0F17479g11141652646e-23
KLLA0C05368g16051282602e-22
CAGL0G09493g14081432593e-22
Kwal_23.36607681602555e-22
CAGL0M01958g9201642556e-22
AFR220W10851602522e-21
YOR191W (RIS1)16191452522e-21
KLLA0B09240g8001612502e-21
ADL345C7461472502e-21
Scas_674.12d13231392451e-20
CAGL0K07766g8301472431e-20
YBR114W (RAD16)7901482431e-20
YLR032W (RAD5)11691612342e-19
Scas_721.10011371722307e-19
CAGL0A03432g11511602281e-18
Kwal_47.177719721572234e-18
Sklu_2412.711271602163e-17
Kwal_14.128715181681691e-11
AAL030C15391271441e-08
Scas_573.915022891431e-08
KLLA0F12166g15281231412e-08
YLR247C15561191369e-08
CAGL0B05049g14701961322e-07
Sklu_2234.210061351214e-06
Sklu_2432.91475741109e-05
ADR260C438107890.020
Scas_720.17519166890.020
KLLA0F23716g554115840.078
YGL078C (DBP3)523169830.12
YNL112W (DBP2)546115810.18
CAGL0L03846g544115760.73
Scas_623.544687722.4
CAGL0H03377g540169722.6
YDL084W (SUB2)44689703.4
CAGL0K07029g816129713.5
CAGL0L06908g439107695.5
KLLA0E22033g437107678.2
KLLA0F15950g46970678.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.7123
         (1066 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.7123                                                         1937   0.0  
KLLA0F07513g 707516..710662 similar to sp|P31380 Saccharomyces c...  1076   0.0  
CAGL0H06193g 604422..607802 similar to sp|P31380 Saccharomyces c...   895   0.0  
YAL019W (FUN30) [49] chr1 (114922..118317) Member of the Snf2p f...   887   0.0  
Scas_548.4                                                            878   0.0  
ACR286C [1333] [Homologous to ScYAL019W (FUN30) - SH] (877337..8...   874   0.0  
Kwal_26.9164                                                          299   3e-84
YOR290C (SNF2) [5074] chr15 complement(855144..860255) Component...   299   9e-84
AFR562C [3754] [Homologous to ScYOR290C (SNF2) - SH] (1439983..1...   295   9e-83
Scas_594.7                                                            295   1e-82
CAGL0I09614g 917707..920826 highly similar to tr|Q08773 Saccharo...   288   6e-82
CAGL0M04807g complement(514847..520039) similar to sp|P22082 Sac...   292   1e-81
Kwal_34.15925                                                         285   1e-80
Scas_665.17                                                           285   1e-80
KLLA0B08327g 742205..746809 similar to sp|P22082 Saccharomyces c...   289   1e-80
YOR304W (ISW2) [5088] chr15 (884510..887872) Protein required fo...   286   1e-80
Kwal_23.4777                                                          288   1e-80
Scas_662.7                                                            285   1e-79
AER375C [2876] [Homologous to ScYIL126W (STH1) - SH] (1332505..1...   283   3e-79
Scas_652.17                                                           280   4e-79
Kwal_14.1600                                                          280   1e-78
KLLA0F04521g complement(435649..439683) similar to sp|P32597 Sac...   279   1e-77
CAGL0C01683g 178695..182042 highly similar to sp|P38144 Saccharo...   276   2e-77
Scas_576.6                                                            278   3e-77
AFR537W [3729] [Homologous to ScYOR304W (ISW2) - SH] complement(...   273   1e-76
CAGL0G08756g complement(829778..833842) highly similar to sp|P32...   275   3e-76
KLLA0E04048g 375999..378479 similar to sp|P43610 Saccharomyces c...   267   1e-75
CAGL0L11770g 1254125..1258555 highly similar to sp|P32657 Saccha...   272   4e-75
KLLA0F24838g complement(2309842..2313030) similar to sgd|S000583...   268   1e-74
Kwal_56.23442                                                         269   4e-74
YER164W (CHD1) [1592] chr5 (505387..509793) Protein involved in ...   266   2e-73
KLLA0C17578g 1547890..1552467 similar to sp|P32657 Saccharomyces...   266   4e-73
YIL126W (STH1) [2550] chr9 (117992..122071) Component of abundan...   264   1e-72
AGR123C [4434] [Homologous to ScYER164W (CHD1) - SH] (980963..98...   261   1e-71
CAGL0H05533g 538045..543759 highly similar to sp|P32333 Saccharo...   247   6e-67
AEL256C [2250] [Homologous to ScYPL082C (MOT1) - SH] (156109..16...   240   1e-64
Kwal_14.1537                                                          203   5e-54
AEL065C [2441] [Homologous to ScYJR035W (RAD26) - SH] (511520..5...   204   8e-54
KLLA0E22726g complement(2018248..2021349) similar to sp|P40352 S...   203   2e-53
Scas_646.3*                                                           204   2e-53
Scas_668.18                                                           200   7e-53
CAGL0I04224g complement(369858..372686) highly similar to sp|P32...   201   7e-53
CAGL0E05038g 488549..493003 similar to sp|P53115 Saccharomyces c...   201   3e-52
Kwal_55.20143                                                         200   4e-52
YDR334W (SWR1) [1163] chr4 (1135923..1140467) Member of the Snf2...   200   5e-52
AEL297W [2208] [Homologous to ScYGL163C (RAD54) - SH] complement...   198   5e-52
ADR309W [2050] [Homologous to ScYDR334W (SWR1) - SH] complement(...   199   8e-52
Scas_669.20                                                           198   1e-51
Kwal_27.11388                                                         198   1e-51
YFR038W (YFR038W) [1720] chr6 (229367..231928) Member of the Snf...   195   2e-51
Sklu_2125.3 YJR035W, Contig c2125 6474-9632                           196   4e-51
KLLA0F21758g complement(2023805..2028523) similar to sp|Q05471 S...   196   8e-51
Scas_520.5                                                            194   9e-51
CAGL0M01188g complement(132330..136682) similar to sp|Q05471 Sac...   196   9e-51
YGL150C (INO80) [1838] chr7 complement(221107..225576) Member of...   196   1e-50
KLLA0E08965g complement(797861..802330) similar to sp|P53115 Sac...   194   3e-50
KLLA0A03069g complement(271516..274203) similar to sp|P32863 Sac...   190   2e-49
CAGL0J02662g 261909..264443 similar to sp|P43610 Saccharomyces c...   189   3e-49
AGR379W [4690] [Homologous to ScYGL150C (INO80) - SH] complement...   191   4e-49
YBR073W (RDH54) [263] chr2 (383172..385946) Protein required for...   184   2e-47
Kwal_47.18077                                                         182   4e-47
YBR245C (ISW1) [424] chr2 complement(708107..711496) Putative AT...   183   8e-47
Scas_597.8                                                            182   1e-46
ADL098C [1643] [Homologous to ScYFR038W (MEI4) - SH] (508448..51...   180   2e-46
AFL040W [3153] [Homologous to ScYBR245C (ISW1) - SH] complement(...   180   5e-46
Scas_664.9                                                            177   7e-45
KLLA0E23804g 2108059..2113680 similar to sp|P32333 Saccharomyces...   177   1e-44
Scas_718.40                                                           175   1e-44
YPL082C (MOT1) [5362] chr16 complement(398475..404078) Transcrip...   174   1e-43
KLLA0F06710g 645650..648940 similar to sp|P38144 Saccharomyces c...   170   9e-43
Scas_591.10                                                           147   4e-36
Kwal_34.16082                                                         124   9e-29
Scas_549.4                                                            124   1e-28
CAGL0I01694g complement(141422..144637) similar to sp|P40352 Sac...   124   2e-28
YJR035W (RAD26) [2931] chr10 (497269..500526) Putative helicase ...   124   2e-28
AGL212W [4100] [Homologous to ScYBR073W (RDH54) - SH] complement...   117   2e-26
Sklu_1582.2 , Contig c1582 197-1048                                   107   2e-25
YGL163C (RAD54) [1826] chr7 complement(193711..196407) DNA-depen...   113   3e-25
Kwal_27.10513                                                         113   3e-25
KLLA0F11814g complement(1089699..1092494) similar to sp|P38086 S...   113   4e-25
AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH] complement(6...   110   5e-24
Kwal_14.1868                                                          107   3e-23
KLLA0F17479g complement(1601287..1604631) similar to sp|P32849 S...   106   6e-23
KLLA0C05368g 481598..486415 some similarities with sgd|S0005717 ...   104   2e-22
CAGL0G09493g complement(902228..906454) similar to tr|Q08562 Sac...   104   3e-22
Kwal_23.3660                                                          102   5e-22
CAGL0M01958g complement(238113..240875) similar to sp|P38086 Sac...   102   6e-22
AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH] complement(...   101   2e-21
YOR191W (RIS1) [4987] chr15 (692475..697334) Protein involved in...   101   2e-21
KLLA0B09240g complement(810178..812580) similar to sp|P31244 Sac...   100   2e-21
ADL345C [1395] [Homologous to ScYBR114W (RAD16) - SH] (100332..1...   100   2e-21
Scas_674.12d                                                           99   1e-20
CAGL0K07766g 770935..773427 highly similar to sp|P31244 Saccharo...    98   1e-20
YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision ...    98   1e-20
YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded DNA...    95   2e-19
Scas_721.100                                                           93   7e-19
CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces c...    92   1e-18
Kwal_47.17771                                                          91   4e-18
Sklu_2412.7 YLR032W, Contig c2412 15481-18864                          88   3e-17
Kwal_14.1287                                                           70   1e-11
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    60   1e-08
Scas_573.9                                                             60   1e-08
KLLA0F12166g complement(1116715..1121301) weakly similar to sgd|...    59   2e-08
YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protei...    57   9e-08
CAGL0B05049g 487186..491598 some similarities with tr|Q06554 Sac...    55   2e-07
Sklu_2234.2 YOR191W, Contig c2234 6350-9366 reverse complement         51   4e-06
Sklu_2432.9 , Contig c2432 20306-24733 reverse complement              47   9e-05
ADR260C [2001] [Homologous to ScYDL084W (SUB2) - SH] (1152259..1...    39   0.020
Scas_720.17                                                            39   0.020
KLLA0F23716g join(complement(2216857..2218129), some similaritie...    37   0.078
YGL078C (DBP3) [1904] chr7 complement(360289..361860) ATP-depend...    37   0.12 
YNL112W (DBP2) [4481] chr14 (413639..414911,415914..416281) ATP-...    36   0.18 
CAGL0L03846g join(complement(443151..444414),complement(441680.....    34   0.73 
Scas_623.5                                                             32   2.4  
CAGL0H03377g complement(313755..315377) highly similar to sp|P20...    32   2.6  
YDL084W (SUB2) [784] chr4 (305237..306577) Essential pre-mRNA sp...    32   3.4  
CAGL0K07029g complement(689672..692122) similar to sp|P21372 Sac...    32   3.5  
CAGL0L06908g complement(777557..778876) highly similar to sp|Q07...    31   5.5  
KLLA0E22033g 1959770..1961083 highly similar to sp|Q07478 Saccha...    30   8.2  
KLLA0F15950g 1477113..1478522 similar to sp|P20449 Saccharomyces...    30   8.4  

>Kwal_26.7123
          Length = 1081

 Score = 1937 bits (5017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 951/1066 (89%), Positives = 951/1066 (89%)

Query: 1    MTRTFPDIKKFELQVRVGHPKQTSSRATRAVSGRLKRLMSSTTPRKNEEVQVPESSPADD 60
            MTRTFPDIKKFELQVRVGHPKQTSSRATRAVSGRLKRLMSSTTPRKNEEVQVPESSPADD
Sbjct: 1    MTRTFPDIKKFELQVRVGHPKQTSSRATRAVSGRLKRLMSSTTPRKNEEVQVPESSPADD 60

Query: 61   GKIASSSPLKMDNGTASLLRDRFVYKPLEKAETXXXXXXXXXXXXXXQMDADVARLVVEY 120
            GKIASSSPLKMDNGTASLLRDRFVYKPLEKAET              QMDADVARLVVEY
Sbjct: 61   GKIASSSPLKMDNGTASLLRDRFVYKPLEKAETGAGSSNGNGKSNGGQMDADVARLVVEY 120

Query: 121  PDFSETLIKAVFKSNSYNLDLTRERLHKIDSQKSSRSWAWRPGEKKPTSRLMSLGGFSEA 180
            PDFSETLIKAVFKSNSYNLDLTRERLHKIDSQKSSRSWAWRPGEKKPTSRLMSLGGFSEA
Sbjct: 121  PDFSETLIKAVFKSNSYNLDLTRERLHKIDSQKSSRSWAWRPGEKKPTSRLMSLGGFSEA 180

Query: 181  ANAGNNMDTSRNGTLLMSPEKSSKVTVEKQKKSIFDRYSHVMNQRHRPTMEAVVVDPSTI 240
            ANAGNNMDTSRNGTLLMSPEKSSKVTVEKQKKSIFDRYSHVMNQRHRPTMEAVVVDPSTI
Sbjct: 181  ANAGNNMDTSRNGTLLMSPEKSSKVTVEKQKKSIFDRYSHVMNQRHRPTMEAVVVDPSTI 240

Query: 241  TQLEPSTRKRRKLLRADNIGREXXXXXXXXXXXXXXXXXXXXXXXXXXXXNVSGEDYHEY 300
            TQLEPSTRKRRKLLRADNIGRE                            NVSGEDYHEY
Sbjct: 241  TQLEPSTRKRRKLLRADNIGRESPAAHSQASKKSSVSLSDEDEDEISGDENVSGEDYHEY 300

Query: 301  TPEVNIDDDILKFINEADEKDIADVADTTLDKASVLVKHRPFTDLVSFSQMDFMTXXXXX 360
            TPEVNIDDDILKFINEADEKDIADVADTTLDKASVLVKHRPFTDLVSFSQMDFMT     
Sbjct: 301  TPEVNIDDDILKFINEADEKDIADVADTTLDKASVLVKHRPFTDLVSFSQMDFMTEEELQ 360

Query: 361  XXXXXXXATRRGQLKRDGDKLLDKMIQTMKGYNAIDSLIKRCSSYGALIASQMQKWGVNI 420
                   ATRRGQLKRDGDKLLDKMIQTMKGYNAIDSLIKRCSSYGALIASQMQKWGVNI
Sbjct: 361  KNQEKKKATRRGQLKRDGDKLLDKMIQTMKGYNAIDSLIKRCSSYGALIASQMQKWGVNI 420

Query: 421  EDIQNGELNFXXXXXXXXXXXXXADVNVTPVTSNGRDSKKPIRMKKXXXXXXXXXXXXXX 480
            EDIQNGELNF             ADVNVTPVTSNGRDSKKPIRMKK              
Sbjct: 421  EDIQNGELNFIDISDDESESDDDADVNVTPVTSNGRDSKKPIRMKKDEDDSESDDEEDDY 480

Query: 481  XXXXXXXYXXXXXXXXXXXXXXPKHKNVKFFKQKPKLLSPDVTLKDYQQTGINWLNLLYR 540
                   Y              PKHKNVKFFKQKPKLLSPDVTLKDYQQTGINWLNLLYR
Sbjct: 481  QDSEDEEYGGRRTRHSGRGRGRPKHKNVKFFKQKPKLLSPDVTLKDYQQTGINWLNLLYR 540

Query: 541  NNLSCILADEMGLGKTCQVIAFLSYLKQNNEPGPHLVVVPSSTLENWLREFNKFCPDLKI 600
            NNLSCILADEMGLGKTCQVIAFLSYLKQNNEPGPHLVVVPSSTLENWLREFNKFCPDLKI
Sbjct: 541  NNLSCILADEMGLGKTCQVIAFLSYLKQNNEPGPHLVVVPSSTLENWLREFNKFCPDLKI 600

Query: 601  EPYYGSQQERAELRDILEDNDGQYDVIVTTYNLASGNKYDVSFLKNRGFNVVVYDEGHML 660
            EPYYGSQQERAELRDILEDNDGQYDVIVTTYNLASGNKYDVSFLKNRGFNVVVYDEGHML
Sbjct: 601  EPYYGSQQERAELRDILEDNDGQYDVIVTTYNLASGNKYDVSFLKNRGFNVVVYDEGHML 660

Query: 661  KNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEFIMPNLFISKKNDLSAVFRQR 720
            KNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEFIMPNLFISKKNDLSAVFRQR
Sbjct: 661  KNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEFIMPNLFISKKNDLSAVFRQR 720

Query: 721  ARTSDSNKDYNPLLAQEAIARAKTMMKPFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRT 780
            ARTSDSNKDYNPLLAQEAIARAKTMMKPFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRT
Sbjct: 721  ARTSDSNKDYNPLLAQEAIARAKTMMKPFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRT 780

Query: 781  IYNREIQQVLDHKRMLXXXXXXXXXXXXXPTKKNGGAQISKNLIMSLRKAALHPLLFRHH 840
            IYNREIQQVLDHKRML             PTKKNGGAQISKNLIMSLRKAALHPLLFRHH
Sbjct: 781  IYNREIQQVLDHKRMLREREEEGSAEEPRPTKKNGGAQISKNLIMSLRKAALHPLLFRHH 840

Query: 841  YDDVMLDKMSRAILKEPEYAENGNKEYIQEDMSYMNDFELHRLCTRFPDSLAKFQLKNDE 900
            YDDVMLDKMSRAILKEPEYAENGNKEYIQEDMSYMNDFELHRLCTRFPDSLAKFQLKNDE
Sbjct: 841  YDDVMLDKMSRAILKEPEYAENGNKEYIQEDMSYMNDFELHRLCTRFPDSLAKFQLKNDE 900

Query: 901  WMNSGKITALRKILENIIEHKKEKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVND 960
            WMNSGKITALRKILENIIEHKKEKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVND
Sbjct: 901  WMNSGKITALRKILENIIEHKKEKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVND 960

Query: 961  RQALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQ 1020
            RQALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQ
Sbjct: 961  RQALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQ 1020

Query: 1021 TKTVHITTLITRNSIEEKILQLAKNKLALDTYISEDDSKAAEALEN 1066
            TKTVHITTLITRNSIEEKILQLAKNKLALDTYISEDDSKAAEALEN
Sbjct: 1021 TKTVHITTLITRNSIEEKILQLAKNKLALDTYISEDDSKAAEALEN 1066

>KLLA0F07513g 707516..710662 similar to sp|P31380 Saccharomyces
            cerevisiae YAL019w FUN30, start by similarity
          Length = 1048

 Score = 1076 bits (2783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 569/1061 (53%), Positives = 722/1061 (68%), Gaps = 79/1061 (7%)

Query: 46   KNEEVQVPESSPADDGKIASSSPLKMDNGT------------ASLLRDRFVYKPLEKAET 93
            K +EVQVP SSP        SSPL+ + GT            +SLLRD+F Y+P  KA  
Sbjct: 12   KQDEVQVPSSSPLLQTN-EESSPLRPETGTRIDESPISSNSTSSLLRDKFTYQPATKARN 70

Query: 94   XXXXXXXXXXXXXXQMDADVARLVVEYPDFSETLIKAVFKSNSYNLDLTRERLHKIDSQK 153
                            +  +  LV EY D S TLI A+FK NS ++  +R+RL  I + +
Sbjct: 71   GYSQNDLSH-------EQALKVLVQEYKDLSPTLINAIFKQNSMSISSSRKRLDHIVASR 123

Query: 154  SSRSWAWRPGEK-KPT--------------SRLMSLGGFSEAANAGNNMDTSRNGTLLMS 198
            +  SW ++      PT              SRL+SL    E  ++GN++ ++    L   
Sbjct: 124  TGGSWRFQSKTNVNPTLNLNKPNSPMDLSKSRLISL---KEGGSSGNSIKSNPAINLPSR 180

Query: 199  PEKSSKVTVEKQKKSIFDRYSHVMNQRHRPTMEAVVVDPSTITQLEPSTRKRRKLLRADN 258
               +SK+T+EKQK SIFDRYSHVM +  +P+    + D +T++ ++  + K+ KL+R D 
Sbjct: 181  NVSTSKITIEKQKTSIFDRYSHVM-KVSQPSPARSMADRTTMSTIKNLSSKKGKLVRGDA 239

Query: 259  IGREXXXXXXXXXXXXXXXXXXXXXXXXXXXXNVSGE-----DYHEYTPEVNIDDDILKF 313
            I ++                            N  GE     +Y E   E N D  +LKF
Sbjct: 240  IKKKQKIKLSDDEEDEITDQS-----------NDDGELDTEPEYEEKVTESNFDQ-VLKF 287

Query: 314  INEADEKDIADVADTTLDKASVLVKHRPFTDLVSFSQMDFMTXXXXXXXXXXXXATRRGQ 373
            +NEAD KD+AD+ + +++KA++++K RPF DL  F Q+DF +              R+ Q
Sbjct: 288  LNEADPKDLADLGEISIEKAALVIKERPFEDLEQFQQLDFQSKSPSPAPGK----ARKSQ 343

Query: 374  LKRDGDKLLDKMIQTMKGYNAIDSLIKRCSSYGALIASQMQKWGVNIEDIQNGELN---- 429
             K+DG K+LDK+ Q++KGYNAI+SLI++CS YG +IA+QM  WGV+    ++ ELN    
Sbjct: 344  QKKDGLKILDKIEQSIKGYNAIESLIRKCSKYGDVIANQMTNWGVDFSSSKDTELNILDV 403

Query: 430  --FXXXXXXXXXXXXXADVNVTPVTSNGRD-SKKPIRMKKXXXXXXXXXXXXXXXXXXXX 486
              +             A+V +   ++  R+ S  P + K+                    
Sbjct: 404  DTYSDDEANETITNDSANVQIIKSSTTSRENSLGPSKRKRNDDEEEFSDVDYEESDDDDF 463

Query: 487  XYXXXXXXXXXXXXXXPKHKN-VKFFKQKPKLLSPDVTLKDYQQTGINWLNLLYRNNLSC 545
                                N +KF +QKPKLLS DV LKDYQQTGINWL+LLY+N+LSC
Sbjct: 464  DVKPRARTKQKKTSITQLRNNQMKFIRQKPKLLSSDVELKDYQQTGINWLHLLYQNDLSC 523

Query: 546  ILADEMGLGKTCQVIAFLSYLKQNNEPGPHLVVVPSSTLENWLREFNKFCPDLKIEPYYG 605
            ILADEMGLGKTCQVI+FL+YLKQ +  GPHLVVVPSSTLENWLREFNKFCP LK+EPYYG
Sbjct: 524  ILADEMGLGKTCQVISFLAYLKQTHHNGPHLVVVPSSTLENWLREFNKFCPHLKVEPYYG 583

Query: 606  SQQERAELRDILEDNDGQYDVIVTTYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMS 665
            SQQERAELRDILE+N+GQYDVIVTTYNLA+G KYDVSFL+NR F+VVVYDEGHMLKNSMS
Sbjct: 584  SQQERAELRDILEENEGQYDVIVTTYNLAAGTKYDVSFLRNRNFDVVVYDEGHMLKNSMS 643

Query: 666  ERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSD 725
            ERF KLMKI A+FRLLLTGTPLQNNLKELMSLLEFIMPNLF+SKK+DL+ VF+Q+ RTSD
Sbjct: 644  ERFNKLMKINAHFRLLLTGTPLQNNLKELMSLLEFIMPNLFVSKKDDLATVFKQKTRTSD 703

Query: 726  SNKDYNPLLAQEAIARAKTMMKPFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNRE 785
            ++K YNPLLA+ AI RAKTMMKPFILRR+KDQVLKHLP KH+ I +CEM+++Q+T+Y +E
Sbjct: 704  ADKGYNPLLAEHAIERAKTMMKPFILRRKKDQVLKHLPRKHNHILHCEMTELQKTLYQQE 763

Query: 786  IQQVLDHKRMLXXXXXXXXXXXXXPTKKNGGAQISKNLIMSLRKAALHPLLFRHHYDDVM 845
            I+QV++H+R +                +     +SKNLIM+LRKA++HPLLFRH Y+D +
Sbjct: 764  IKQVMEHRRKIKEGVKM----------EKASRNVSKNLIMALRKASIHPLLFRHIYNDKI 813

Query: 846  LDKMSRAILKEPEYAENGNKEYIQEDMSYMNDFELHRLCTRFPDSLAKFQLKNDEWMNSG 905
            + KMS+AI+ EPEY ENGN EYI+EDMSYM DFELH+LC +FP SL KF+L++DEWMNSG
Sbjct: 814  ISKMSKAIIAEPEYYENGNIEYIKEDMSYMTDFELHKLCCKFP-SLYKFKLQSDEWMNSG 872

Query: 906  KITALRKILENIIEHKKEKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALI 965
            K+  L+ +L  II+ + EKVLVFSLFTQ+LDILE  L+TLNI FLRLDG TQVNDRQ+LI
Sbjct: 873  KVEQLKSVLHKIIDIQHEKVLVFSLFTQVLDILEFVLSTLNIKFLRLDGQTQVNDRQSLI 932

Query: 966  DKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVH 1025
            D+F++DDTIPVF+LSTKAGGFGINLVCANNVIIFDQSFNPHDD+QAADR+HRVGQTK V 
Sbjct: 933  DRFYEDDTIPVFLLSTKAGGFGINLVCANNVIIFDQSFNPHDDRQAADRAHRVGQTKEVQ 992

Query: 1026 ITTLITRNSIEEKILQLAKNKLALDTYISEDDSKAAEALEN 1066
            +TTLI+R++IEEKIL LAKNKLALDT+IS++D K  EALEN
Sbjct: 993  VTTLISRDTIEEKILHLAKNKLALDTHISQEDKKNEEALEN 1033

>CAGL0H06193g 604422..607802 similar to sp|P31380 Saccharomyces
            cerevisiae YAL019w FUN30, hypothetical start
          Length = 1126

 Score =  895 bits (2313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/570 (73%), Positives = 487/570 (85%), Gaps = 11/570 (1%)

Query: 504  KHKNVKFFKQKPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFL 563
            K+  VKFF+ +PKLL+PDV+LKDYQQTGINWLNLLY N +SCILAD+MGLGKTCQVI+FL
Sbjct: 552  KNSVVKFFRGRPKLLNPDVSLKDYQQTGINWLNLLYHNQISCILADDMGLGKTCQVISFL 611

Query: 564  SYLKQNNEPGPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQ 623
            +YLKQ  +P PHL+VVPSSTLENWLREF KFCP LKIEPYYG+QQERA+LR+ILE NDG+
Sbjct: 612  AYLKQIGQPSPHLIVVPSSTLENWLREFQKFCPSLKIEPYYGTQQERADLREILERNDGK 671

Query: 624  YDVIVTTYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLT 683
            YDVIVTTYNLA+GNKYDVSFLK R FNVVVYDEGHMLKNSMSERF KLM+I ANFRLLLT
Sbjct: 672  YDVIVTTYNLAAGNKYDVSFLKTRNFNVVVYDEGHMLKNSMSERFNKLMRIHANFRLLLT 731

Query: 684  GTPLQNNLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAK 743
            GTPLQNNLKELMSLLEFIMPNLF+SKK  L+AVF+QRA+TSD NK +NPLLAQ+AI RAK
Sbjct: 732  GTPLQNNLKELMSLLEFIMPNLFVSKKESLAAVFKQRAKTSDDNKGHNPLLAQQAITRAK 791

Query: 744  TMMKPFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXX 803
            TMMKPFILRRRKDQVLKHLP KH +  YC M+D QR IYNRE++ V++HK+M+       
Sbjct: 792  TMMKPFILRRRKDQVLKHLPAKHVRTSYCAMNDTQREIYNREVKLVMEHKQMIRDGTLPE 851

Query: 804  XXXXXXPTKKNGGAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENG 863
                    + N     SKNLIMSLRKA++HPLLFRH YDD  +DKM  AIL EP YAENG
Sbjct: 852  DKKERSKIENNS----SKNLIMSLRKASIHPLLFRHIYDDAKIDKMCDAILDEPAYAENG 907

Query: 864  NKEYIQEDMSYMNDFELHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKE 923
            NKEYI+EDMS+M DFELHRLC  FP++L  +QLKNDEWMNSGK+ AL+K+L++II  K+E
Sbjct: 908  NKEYIREDMSFMTDFELHRLCCNFPNTLGDYQLKNDEWMNSGKVDALKKLLDDIINKKRE 967

Query: 924  KVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIPVFILSTKA 983
            KVL+F+LFTQ+LDILE  L+TLN  FLRLDGSTQVNDRQ +IDKF+DD+TIP+F+LST+A
Sbjct: 968  KVLIFTLFTQVLDILEKVLSTLNYKFLRLDGSTQVNDRQTMIDKFYDDNTIPIFMLSTRA 1027

Query: 984  GGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLA 1043
            GGFGINLVCAN+VIIFDQSFNPHDD+QAADR+HRVGQTK V +TTLIT++SIEEKI QLA
Sbjct: 1028 GGFGINLVCANHVIIFDQSFNPHDDRQAADRAHRVGQTKEVTVTTLITKDSIEEKIFQLA 1087

Query: 1044 KNKLALDTYI--SED-----DSKAAEALEN 1066
            K KLALD+ +  SED     D+K ++ LE+
Sbjct: 1088 KTKLALDSQVSSSEDQSDLIDNKVSDLLED 1117

 Score =  199 bits (505), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 133/399 (33%), Positives = 202/399 (50%), Gaps = 47/399 (11%)

Query: 62  KIASSSPLKMDNGT--ASLLRDRFVYKPLEKAETXXXXXXXXXXXXXXQMDADV-----A 114
           K  SSSPLK +  T  A  LR++FV+KP     +                 A V      
Sbjct: 21  KTVSSSPLKPEASTQDAQKLREQFVFKPNNNLSSAITSTGQTASSATSGTAAPVNPNAFE 80

Query: 115 RLVVEYPDFSETLIKAVFKSNSYNLDLTRERLHKIDSQKSSRSWAWRPGEKKPTSRLMSL 174
            LV E+PDFS+TL++AV+KSNS++L L RERL +I +Q+  ++W          +R    
Sbjct: 81  SLVAEFPDFSQTLVQAVYKSNSFDLSLARERLTRIRNQR--KNWVSSKNLNSNVAR---- 134

Query: 175 GGFSEAANAGNNMDTSRNGTLLMSPEKSSKVTVEKQKKSIFDRYSHVMNQRHRPTMEAVV 234
              S AA+ G    +  N T       SSK+ +EKQKKSIFDRYS  +N   + +     
Sbjct: 135 --GSRAASTGTGRLSGINNT-----SDSSKIVLEKQKKSIFDRYSSAVNSNAQNSG---- 183

Query: 235 VDPSTITQLE-PSTRKRRKLLRADNIGREXXXXXXXXXXXXXXXXXXXXXXXXXXX---- 289
           ++     +++   + K+RKL+R D +  +                               
Sbjct: 184 INSELFEKMQRNGSHKKRKLVRGDKLAGDESYVDSSNSQLAKAKQQLLKSRNKKFNLSDD 243

Query: 290 -----------XNVSGEDYHEYTPEVNIDDDILKFINEADEKDIADVADTTLDKASVLVK 338
                       + SG++Y E+TP  NIDD IL+F+N ++  DI D+ + + ++A ++  
Sbjct: 244 EEEVGNDNGDFSDASGDEYEEHTPVANIDDQILEFLNNSEIDDIMDLGEVSYERAKIIQS 303

Query: 339 HRPFTDLVSFSQMDFMTXXXXXXXXXXXXA----TRRGQLKR-DGDKLLDKMIQTMKGYN 393
            RPFT L SFSQ +F+T                  RRG  +R +G+K+LD++ Q M+GYN
Sbjct: 304 ARPFTSLYSFSQQEFLTEEEKEKQAKLLAQPKKRGRRGAAQRKEGEKVLDRVSQAMRGYN 363

Query: 394 AIDSLIKRCSSYGALIASQMQKWGVNI--EDIQNGELNF 430
           AI+S+IK CS YG L++SQ++KWGV +  E+  +GEL+F
Sbjct: 364 AIESVIKTCSQYGKLVSSQIKKWGVKVDAENGDDGELDF 402

>YAL019W (FUN30) [49] chr1 (114922..118317) Member of the Snf2p family
            of DNA-dependent ATPases, involved in resistance to UV
            radiation [3396 bp, 1131 aa]
          Length = 1131

 Score =  887 bits (2291), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/566 (75%), Positives = 487/566 (86%), Gaps = 11/566 (1%)

Query: 508  VKFFKQKPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLK 567
            VKFFK KP+LLSP+++LKDYQQTGINWLNLLY+N +SCILAD+MGLGKTCQVI+F +YLK
Sbjct: 556  VKFFKGKPRLLSPEISLKDYQQTGINWLNLLYQNKMSCILADDMGLGKTCQVISFFAYLK 615

Query: 568  QNNEPGPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQYDVI 627
            Q NEPGPHLVVVPSSTLENWLREF KF P LKIEPYYGS QER ELRDILE N G+YDVI
Sbjct: 616  QINEPGPHLVVVPSSTLENWLREFQKFAPALKIEPYYGSLQEREELRDILERNAGKYDVI 675

Query: 628  VTTYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPL 687
            VTTYNLA+GNKYDVSFLKNR FNVVVYDEGHMLKNS SERF KLMKI ANFRLLLTGTPL
Sbjct: 676  VTTYNLAAGNKYDVSFLKNRNFNVVVYDEGHMLKNSTSERFAKLMKIRANFRLLLTGTPL 735

Query: 688  QNNLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMMK 747
            QNNLKELMSLLEFIMPNLFISKK    A+F+QRA+T+D NK++NPLLAQEAI RAKTMMK
Sbjct: 736  QNNLKELMSLLEFIMPNLFISKKESFDAIFKQRAKTTDDNKNHNPLLAQEAITRAKTMMK 795

Query: 748  PFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXX 807
            PFILRRRKDQVLKHLP KH+ I+YCE++ +Q+ IY++EIQ VL+HKRM+           
Sbjct: 796  PFILRRRKDQVLKHLPPKHTHIQYCELNAIQKKIYDKEIQIVLEHKRMIKDGELPKDAK- 854

Query: 808  XXPTKKNGGAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEY 867
                K    +  SKNLIM+LRKA+LHPLLFR+ Y+D ++ KMS AIL EP YAENGNKEY
Sbjct: 855  ---EKSKLQSSSSKNLIMALRKASLHPLLFRNIYNDKIITKMSDAILDEPAYAENGNKEY 911

Query: 868  IQEDMSYMNDFELHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLV 927
            I+EDMSYM DFELH+LC  FP++L+K+QL NDEWM SGKI AL+K+L+ II  K+EKVL+
Sbjct: 912  IKEDMSYMTDFELHKLCCNFPNTLSKYQLHNDEWMQSGKIDALKKLLKTIIVDKQEKVLI 971

Query: 928  FSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIPVFILSTKAGGFG 987
            FSLFTQ+LDILEM L+TL+  FLRLDGSTQVNDRQ LIDKF++D  IP+FILSTKAGGFG
Sbjct: 972  FSLFTQVLDILEMVLSTLDYKFLRLDGSTQVNDRQLLIDKFYEDKDIPIFILSTKAGGFG 1031

Query: 988  INLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKL 1047
            INLVCANNVIIFDQSFNPHDD+QAADR+HRVGQTK V+ITTLIT++SIEEKI QLAKNKL
Sbjct: 1032 INLVCANNVIIFDQSFNPHDDRQAADRAHRVGQTKEVNITTLITKDSIEEKIHQLAKNKL 1091

Query: 1048 ALDTYISED-------DSKAAEALEN 1066
            ALD+YISED       +SK ++ LE+
Sbjct: 1092 ALDSYISEDKKSQDVLESKVSDMLED 1117

 Score =  209 bits (533), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 142/411 (34%), Positives = 216/411 (52%), Gaps = 52/411 (12%)

Query: 50  VQVPE-SSPADDGKIASSSPLK-----MDNGTASLLRDRFVYKPLEKAETXXXXXXXXXX 103
           VQVPE SSP    K+ASSSPLK     + + + + LR RF +KP + +E           
Sbjct: 13  VQVPETSSPT---KVASSSPLKPTSPTVPDASVASLRSRFTFKPSDPSEGAHTSKPLPSG 69

Query: 104 XXXXQMDADVARLVVEYPDFSETLIKAVFKSNSYNLDLTRERLHKIDSQKSSRSWAWRPG 163
                 +  +  L  E+PDFS+TL++AVFKSNS+NL   RERL ++  Q+ + +W     
Sbjct: 70  SP----EVALVNLAREFPDFSQTLVQAVFKSNSFNLQSARERLTRLRQQRQNWTWNKNAS 125

Query: 164 EKK-----PTSRLMSLGGFSEAANAGNNMDTSRNGTLLMSPEKSSKVTVEKQKKSIFDRY 218
            KK     P  + + L      ++   N++            KSSK+TV KQK SIFDRY
Sbjct: 126 PKKSETPPPVKKSLPLANTGRLSSIHGNINN-----------KSSKITVAKQKTSIFDRY 174

Query: 219 SHVMNQRHR----PTMEAVVVDPSTITQLEPSTRKRRKLLRADN--IG------------ 260
           S+V+NQ+      PT   + +D   +++L  +  K+R+L+RAD   IG            
Sbjct: 175 SNVINQKQYTFELPT--NLNIDSEALSKLPVNYNKKRRLVRADQHPIGKSYESSATQLGS 232

Query: 261 -REXXXXXXXXXXXXXXXXXXXXXXXXXXXXNVSGEDYHEYTPEVNIDDDILKFINEADE 319
            RE                            + SG+DY E TP++N+D+ +L+FIN++D 
Sbjct: 233 AREKLLANRKYGRHANDNDEEEEESMMTDDDDASGDDYTESTPQINLDEQVLQFINDSDI 292

Query: 320 KDIADVADTTLDKASVLVKHRPFTDLVSFSQMDFMTXXXXXXXXXXXXATRRGQLKRDGD 379
            D++D++DTT+ KA ++  HRP++ L +F   +F                R      + +
Sbjct: 293 VDLSDLSDTTMHKAQLIASHRPYSSLNAFVNTNF-NDKDTEENASNKRKRRAAASANESE 351

Query: 380 KLLDKMIQTMKGYNAIDSLIKRCSSYGALIASQMQKWGVNIEDIQNGELNF 430
           +LLDK+ Q+++GYNAI+S+IK+CSSYG L+ SQM+KWGV +E   N EL+ 
Sbjct: 352 RLLDKITQSIRGYNAIESVIKKCSSYGDLVTSQMKKWGVQVEG-DNSELDL 401

>Scas_548.4
          Length = 1054

 Score =  878 bits (2268), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/565 (73%), Positives = 483/565 (85%), Gaps = 13/565 (2%)

Query: 507  NVKFFKQKPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYL 566
            N+K+FK KPKLL  +VTLKDYQQTGINWLNLLY N +SCILAD+MGLGKTCQVI+F +YL
Sbjct: 479  NIKYFKGKPKLLDSEVTLKDYQQTGINWLNLLYHNQMSCILADDMGLGKTCQVISFFAYL 538

Query: 567  KQNNEPGPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQYDV 626
            KQ NEPGPHLVVVPSSTLENWLREF KFCP LKIEPYYGSQ ERA+LR+ILE   GQYDV
Sbjct: 539  KQINEPGPHLVVVPSSTLENWLREFQKFCPTLKIEPYYGSQNERADLREILERTAGQYDV 598

Query: 627  IVTTYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTP 686
            IVTTYNLA+GNKYDVSFL+NR FNVVVYDEGHMLKNSMSERF KLM+I+ NFRLLLTGTP
Sbjct: 599  IVTTYNLAAGNKYDVSFLRNRQFNVVVYDEGHMLKNSMSERFNKLMRIQGNFRLLLTGTP 658

Query: 687  LQNNLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMM 746
            LQNNL+ELMSLLEFIMP LFISKK  L++VF+QRA+T+D NK +NPLL QEAI RAKTMM
Sbjct: 659  LQNNLRELMSLLEFIMPALFISKKESLASVFKQRAKTTDDNKGHNPLLVQEAIERAKTMM 718

Query: 747  KPFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXX 806
            KPFILRRRKDQVLKHLP KH KIEYC M D+QR IY+ EI+ V++HK+M+          
Sbjct: 719  KPFILRRRKDQVLKHLPAKHHKIEYCIMQDLQRKIYDSEIKTVMEHKKMI--------LD 770

Query: 807  XXXPTKKNGGAQI----SKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAEN 862
               P      A+I    S NLIM+LRKAALHPLLFR  Y+D ++ KMS+AI+ EP+Y  +
Sbjct: 771  GTLPDDPKERAKIQSSSSSNLIMTLRKAALHPLLFRTIYNDALIAKMSKAIINEPQYKVD 830

Query: 863  GNKEYIQEDMSYMNDFELHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKK 922
            GN E+I+EDMS M DFELHRLC  FP++L+++QLKN EWMNSGK+  L ++L+ II  +K
Sbjct: 831  GNIEFIKEDMSVMTDFELHRLCLNFPNTLSRYQLKNKEWMNSGKVDTLCRLLKEIIFERK 890

Query: 923  EKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIPVFILSTK 982
            EKVL+FSLFTQ+LDILE+ L+ LN  FLRLDGSTQVNDRQ+LIDKF++DDTIP+FILSTK
Sbjct: 891  EKVLIFSLFTQVLDILELVLSELNYKFLRLDGSTQVNDRQSLIDKFYEDDTIPIFILSTK 950

Query: 983  AGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQL 1042
            AGGFGINLVCANNVIIFDQSFNPHDD+QAADR+HRVGQTK V+ITTLIT++SIEEKI QL
Sbjct: 951  AGGFGINLVCANNVIIFDQSFNPHDDRQAADRAHRVGQTKEVNITTLITKDSIEEKIFQL 1010

Query: 1043 AKNKLALDTYISEDDSKAA-EALEN 1066
            AKNKLALD++ISEDD K A +ALE+
Sbjct: 1011 AKNKLALDSHISEDDGKKADDALED 1035

 Score =  127 bits (318), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 83/133 (62%)

Query: 293 SGEDYHEYTPEVNIDDDILKFINEADEKDIADVADTTLDKASVLVKHRPFTDLVSFSQMD 352
           SG++Y E     NIDD +LKFINE+D  D+ D+ADTT  KA ++V  RPF  L  F Q +
Sbjct: 263 SGDEYEERATLKNIDDQVLKFINESDVLDLTDLADTTFKKAEIIVSRRPFQSLDQFLQSE 322

Query: 353 FMTXXXXXXXXXXXXATRRGQLKRDGDKLLDKMIQTMKGYNAIDSLIKRCSSYGALIASQ 412
           F++                   K + ++LL+++   ++GYNAIDSLIK+CSSYG LI SQ
Sbjct: 323 FISEEEAKKTTKKTKGRGHNSQKNESERLLERITLAIRGYNAIDSLIKKCSSYGKLIESQ 382

Query: 413 MQKWGVNIEDIQN 425
           M KWG+ ++DI N
Sbjct: 383 MAKWGITMDDITN 395

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/221 (33%), Positives = 107/221 (48%), Gaps = 33/221 (14%)

Query: 42  TTPRKNEEVQVPE-SSPADD-GKIASSSPLK-MDNGTASLLRDRFVYKPLEKAETXXXXX 98
           T P +  +VQVPE SSP+    +  SSSPLK +    ++ LRD+F Y P           
Sbjct: 2   TDPYEPNDVQVPETSSPSKPLQQDPSSSPLKPLQPPPSATLRDKFTYSP--NTTQPASNN 59

Query: 99  XXXXXXXXXQMDADVARLVVEYPDFSETLIKAVFKSNSYNLDLTRERLHKIDSQKSSRSW 158
                      ++ +A L   +PDFS+TLI AV KSNSYNLDL  +RL++I  Q+   +W
Sbjct: 60  NSNASSSLAGQESALANLTAAFPDFSQTLILAVLKSNSYNLDLVTQRLNRIKQQR--ENW 117

Query: 159 AWRPGEKKPTSRLMSLGGFSEAANAGNNMDTSRNGTLLMSPEKSSKVTVEKQKKSIFDRY 218
              P      +RL SL    +A                     SSK+ V+KQK SI+DRY
Sbjct: 118 KATPTTSSLATRLGSLKSKPKAP-------------------ASSKIVVDKQKGSIYDRY 158

Query: 219 SHVMN-QRHRPTMEAVVVDPSTITQLEPSTRKRRKLLRADN 258
           S V+  Q H      +  DP  + +++   R++ K L  +N
Sbjct: 159 SSVIKAQTH------LEYDPGLLKKVQEGDRRKFKRLVREN 193

>ACR286C [1333] [Homologous to ScYAL019W (FUN30) - SH]
            (877337..880396) [3060 bp, 1019 aa]
          Length = 1019

 Score =  874 bits (2259), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/557 (74%), Positives = 478/557 (85%), Gaps = 14/557 (2%)

Query: 503  PKHKNVKFFKQKPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAF 562
            P+ KNVKFFK+KPKLL+PD+ LKDYQQTG+NW+NLLY++NLSCILADEMGLGKTCQVI+F
Sbjct: 450  PEKKNVKFFKRKPKLLAPDIELKDYQQTGLNWINLLYQHNLSCILADEMGLGKTCQVISF 509

Query: 563  LSYLKQNNEPGPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDG 622
            L+YLK+ N  GPHLVVVPSSTLENWLREF KFCP LKIEPYYGSQQERAELRDILE+NDG
Sbjct: 510  LAYLKEQNHTGPHLVVVPSSTLENWLREFKKFCPQLKIEPYYGSQQERAELRDILEENDG 569

Query: 623  QYDVIVTTYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLL 682
            QYD IVTTYNLASGNK DVSFLKNR FNVV+YDEGHMLKNSMSERFTKLMKI ANFRLLL
Sbjct: 570  QYDAIVTTYNLASGNKADVSFLKNRQFNVVIYDEGHMLKNSMSERFTKLMKIHANFRLLL 629

Query: 683  TGTPLQNNLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARA 742
            TGTPLQNNL+ELMSLLEFIMP+LF+SKK++L+AVF+QRARTSDSNKDYNPLLAQEAI RA
Sbjct: 630  TGTPLQNNLRELMSLLEFIMPSLFVSKKDELAAVFKQRARTSDSNKDYNPLLAQEAIDRA 689

Query: 743  KTMMKPFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXX 802
            KT+MKPFILRRRKDQVLKHLP KH  IEYC+M+  Q+ IYNREI+ V++H+RM+      
Sbjct: 690  KTIMKPFILRRRKDQVLKHLPAKHHHIEYCDMTPEQQAIYNREIRLVMEHRRMV------ 743

Query: 803  XXXXXXXPTKKNGGAQI----SKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPE 858
                   PT     A +    SKNLIM+LRKAA+HPLLFRHHY D  + +MS  IL EPE
Sbjct: 744  --RDGVLPTDAGERALVAQSTSKNLIMALRKAAIHPLLFRHHYSDDRIAEMSERILAEPE 801

Query: 859  YAENGNKEYIQEDMSYMNDFELHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENII 918
            YA++GN++YI+EDMSYM D ELHRLC RFP SLA FQL    WM SGK+  L+ +L   I
Sbjct: 802  YADSGNRDYIREDMSYMCDLELHRLCCRFP-SLASFQLSEPTWMASGKVHRLQPLLRAAI 860

Query: 919  EHKKEKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIPVFI 978
              ++EK LVFSLFTQ+LDILE+ L++L I FLRLDGST VNDRQALID+FH D  +PVF+
Sbjct: 861  A-RREKTLVFSLFTQVLDILELVLSSLGIAFLRLDGSTPVNDRQALIDRFHTDTDVPVFL 919

Query: 979  LSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEK 1038
            LSTKAGGFGINLVCAN+VIIFDQSFNPHDD+QAADR+HRVGQT+ V +TTL++R ++EEK
Sbjct: 920  LSTKAGGFGINLVCANHVIIFDQSFNPHDDRQAADRAHRVGQTREVAVTTLVSRATVEEK 979

Query: 1039 ILQLAKNKLALDTYISE 1055
            ILQLA++KLALD+ +S+
Sbjct: 980  ILQLARHKLALDSSVSD 996

 Score =  234 bits (598), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 155/393 (39%), Positives = 215/393 (54%), Gaps = 50/393 (12%)

Query: 46  KNEEVQVPESSPADDGKIASSSPLK------MDNGTASLLRDRFVYKPLEKAETXXXXXX 99
           + E  QV  SSP +  + A SSPLK           A+ LR RF Y+   +AE       
Sbjct: 15  ERERAQVVGSSPGE--QRAESSPLKRYGAGEAAEAVAAQLRTRFEYRAGAEAEGGNG--- 69

Query: 100 XXXXXXXXQMDADVARLVVEYPDFSETLIKAVFKSNSYNLDLTRERLHKIDSQKSSRSWA 159
                    +D  + ++  +YPDFS+TLI+AVFKSNS++L LT  RL ++ ++KS++SWA
Sbjct: 70  ---------LDEQMQKMRQQYPDFSDTLIRAVFKSNSFSLPLTMSRLDELRAKKSAKSWA 120

Query: 160 WRPGEKKPTSRLMSLGGFSEAANAGNNMDTSRNGTLLMSPEKSSKVTVEKQKKSIFDRYS 219
               +   T+RL SL      A A            + SPE+SSKVT+E+Q  SIFDRYS
Sbjct: 121 MPSKKLGATARLPSLKPGRYGAEA------------VASPERSSKVTLERQTTSIFDRYS 168

Query: 220 HVMNQRHRPTMEAVVVDPSTITQLEPSTRKRRKLLRADNIGREXXXXXXXXXXXXXXXXX 279
           HV+ QR +    A V    T         K+RKL+RA+++                    
Sbjct: 169 HVI-QRGKVEAPAPVWSAPT---------KKRKLVRAEDL-----LAAKPEERVSLSDEE 213

Query: 280 XXXXXXXXXXXNVSGEDYHEYTPEVNIDDDILKFINEADEKDIADVADTTLDKASVLVKH 339
                        SG++Y E TPE++IDD +L F+NEAD  DIAD+A+T++ KA+ +V  
Sbjct: 214 EDAISADGSADEASGDEYEERTPELDIDDQVLTFLNEADAGDIADLAETSIGKAAAVVAK 273

Query: 340 RPFTDLVSFSQMDFMT--XXXXXXXXXXXXATRRGQLKRDGDKLLDKMIQTMKGYNAIDS 397
           RPF  L +F  MDF                + RRG  KRDG K+LDK++Q+MKGYNAI+S
Sbjct: 274 RPFRSLEAFGAMDFEADDEVASTGENAKRGSRRRGPTKRDGAKMLDKIMQSMKGYNAIES 333

Query: 398 LIKRCSSYGALIASQMQKWGVNIEDIQNGELNF 430
           LIK+CSSY  LIA Q++KWGV + + ++ ELNF
Sbjct: 334 LIKKCSSYRRLIADQIKKWGVEMGENES-ELNF 365

>Kwal_26.9164
          Length = 1454

 Score =  299 bits (766), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 203/555 (36%), Positives = 292/555 (52%), Gaps = 80/555 (14%)

Query: 505  HKNVKFFKQKPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLS 564
            H+  +  KQ+P +L    TLK+YQ  G+ W+  LY N+L+ ILADEMGLGKT Q I+ L+
Sbjct: 584  HRIKEEIKQQPSILV-GGTLKEYQLKGLQWMVSLYNNHLNGILADEMGLGKTIQTISLLT 642

Query: 565  YLKQ-NNEPGPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQ 623
            YL +  N  GP LV+VP STL NW  EF+K+ P ++   Y GS  ER   + I+    GQ
Sbjct: 643  YLYEVKNVRGPSLVIVPLSTLTNWDSEFDKWAPVIRKVAYKGSPNERKSKQGII--RSGQ 700

Query: 624  YDVIVTTYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMK-IEANFRLLL 682
            +DV++TT+      +  +S +K   +  ++ DEGH +KN+ S+    L      ++RL+L
Sbjct: 701  FDVVLTTFEYIIKERALLSKIK---WVHMIIDEGHRMKNAQSKLSLTLNNYYHTDYRLIL 757

Query: 683  TGTPLQNNLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSN---KDYNPLLAQE-- 737
            TGTPLQNNL EL +LL F++P +F S K+     F +   T  +N   +D   L  +E  
Sbjct: 758  TGTPLQNNLPELWALLNFVLPKIFNSVKS-----FDEWFNTPFANTGGQDKIALSEEETL 812

Query: 738  -AIARAKTMMKPFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRML 796
              I R   +++PF+LRR K  V K LP K  K+  C+MS +Q+ +Y    +Q+L H+R+ 
Sbjct: 813  LVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVLKCKMSALQQKLY----EQMLKHRRLF 868

Query: 797  XXXXXXXXXXXXXPTKKNGGAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKE 856
                          + KN G +   N IM L+K   HP +F    D +            
Sbjct: 869  IGDLN---------SNKNVGMRGFNNQIMQLKKICNHPFVFEEVEDQI-----------N 908

Query: 857  PEYAENGNKEYIQEDMSYMNDFELHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILEN 916
            P    N N                                    W  +GK   L +IL  
Sbjct: 909  PTRETNANI-----------------------------------WRVAGKFELLERILPK 933

Query: 917  IIEHKKEKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDT-IP 975
              +    ++L+F   TQ++DI+E  L   N+ +LRLDG T+ +DR  L++ F+  ++   
Sbjct: 934  -FKATGHRILIFFQMTQIMDIMEDFLRLSNMKYLRLDGHTKSDDRTLLLNLFNAPNSEYF 992

Query: 976  VFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSI 1035
             F+LST+AGG G+NL  A+ VIIFD  +NPH D QA DR+HR+GQ   V I  LIT NS+
Sbjct: 993  CFLLSTRAGGLGLNLQSADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITENSV 1052

Query: 1036 EEKILQLAKNKLALD 1050
            EE IL  A  KL +D
Sbjct: 1053 EEVILDRAHKKLDID 1067

>YOR290C (SNF2) [5074] chr15 complement(855144..860255) Component of
            SWI-SNF global transcription activator complex, acts to
            assist gene-specific activators through chromatin
            remodeling, involved in sensitivity to UV irradiation
            [5112 bp, 1703 aa]
          Length = 1703

 Score =  299 bits (765), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 208/562 (37%), Positives = 299/562 (53%), Gaps = 88/562 (15%)

Query: 505  HKNVKFFKQKPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLS 564
            H+  +  K++P +L    TLKDYQ  G+ W+  L+ N+L+ ILADEMGLGKT Q I+ L+
Sbjct: 749  HRIKEDIKKQPSILVGG-TLKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLT 807

Query: 565  YL-KQNNEPGPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQER----AELRDILED 619
            YL +  N  GP+LV+VP STL NW  EF K+ P L+   + GS  ER    A++R     
Sbjct: 808  YLYEMKNIRGPYLVIVPLSTLSNWSSEFAKWAPTLRTISFKGSPNERKAKQAKIR----- 862

Query: 620  NDGQYDVIVTTYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSE-RFTKLMKIEANF 678
              G++DV++TT+      +  +S +K   +  ++ DEGH +KN+ S+   T      A++
Sbjct: 863  -AGEFDVVLTTFEYIIKERALLSKVK---WVHMIIDEGHRMKNAQSKLSLTLNTHYHADY 918

Query: 679  RLLLTGTPLQNNLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSN---KDYNPLLA 735
            RL+LTGTPLQNNL EL +LL F++P +F S K+     F +   T  +N   +D   L  
Sbjct: 919  RLILTGTPLQNNLPELWALLNFVLPKIFNSVKS-----FDEWFNTPFANTGGQDKIELSE 973

Query: 736  QE---AIARAKTMMKPFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDH 792
            +E    I R   +++PF+LRR K  V K LP K  K+  C+MS +Q+ +Y    QQ+L +
Sbjct: 974  EETLLVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMY----QQMLKY 1029

Query: 793  KRMLXXXXXXXXXXXXXPTKKNGGAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRA 852
            +R+                KK  G +   N IM L+K   HP +F    D +        
Sbjct: 1030 RRLFIGDQN---------NKKMVGLRGFNNQIMQLKKICNHPFVFEEVEDQI-------- 1072

Query: 853  ILKEPEYAENGNKEYIQEDMSYMNDFELHRLCTRFPDSLAKFQLKNDEWMNSGKITALRK 912
                     N  +E         ND                     D W  +GK   L +
Sbjct: 1073 ---------NPTRE--------TND---------------------DIWRVAGKFELLDR 1094

Query: 913  ILENIIEHKKEKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDD 972
            IL   ++    +VL+F   TQ++DI+E  L  +NI +LRLDG T+ ++R  L+  F+  D
Sbjct: 1095 ILPK-LKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSELLRLFNAPD 1153

Query: 973  T-IPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLIT 1031
            +    FILST+AGG G+NL  A+ VIIFD  +NPH D QA DR+HR+GQ   V I  LIT
Sbjct: 1154 SEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLIT 1213

Query: 1032 RNSIEEKILQLAKNKLALDTYI 1053
             NS+EE IL+ A  KL +D  +
Sbjct: 1214 TNSVEEVILERAYKKLDIDGKV 1235

>AFR562C [3754] [Homologous to ScYOR290C (SNF2) - SH]
            (1439983..1444257,1444339..1444398) [4335 bp, 1444 aa]
          Length = 1444

 Score =  295 bits (755), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 198/540 (36%), Positives = 284/540 (52%), Gaps = 78/540 (14%)

Query: 523  TLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQ-NNEPGPHLVVVPS 581
            TLK+YQ  G+ W+  L+ N+L+ ILADEMGLGKT Q I+ L+YL +     GP LV+VP 
Sbjct: 560  TLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEFKGIHGPFLVIVPL 619

Query: 582  STLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQYDVIVTTYNLASGNKYDV 641
            STL NW  EF+K+ P L+   + G   ER  L  I++   G +DV++TT+      +  +
Sbjct: 620  STLTNWNAEFDKWAPTLRKLAFKGPPSERKALSGIIK--SGNFDVVLTTFEYIIKERPLL 677

Query: 642  SFLKNRGFNVVVYDEGHMLKNSMSERFTKLMK-IEANFRLLLTGTPLQNNLKELMSLLEF 700
            S +K   +  ++ DEGH +KN+ S+    L +    ++RL+LTGTPLQNNL EL +LL F
Sbjct: 678  SKVK---WVHMIIDEGHRMKNAQSKLSLTLNQYYHTDYRLILTGTPLQNNLPELWALLNF 734

Query: 701  IMPNLFISKKNDLSAVFRQRARTSDSN---KDYNPLLAQE---AIARAKTMMKPFILRRR 754
            ++P +F S K+     F +   T  +N   +D   L  +E    I R   +++PF+LRR 
Sbjct: 735  VLPKIFNSVKS-----FDEWFNTPFANTGGQDKIELSEEETLLVIRRLHKVLRPFLLRRL 789

Query: 755  KDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXXPTKKN 814
            K  V K LP K  K+  C MS +Q+ +Y    +Q+L H+R+               +KK 
Sbjct: 790  KKDVEKELPDKVEKVLKCRMSALQQKLY----EQMLKHRRLFVVDDPS--------SKKM 837

Query: 815  GGAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQEDMSY 874
             G +   N IM L+K   HP +F    D +            P    N N          
Sbjct: 838  VGLRGFNNQIMQLKKICNHPFVFEEVEDQI-----------NPNRETNANI--------- 877

Query: 875  MNDFELHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFSLFTQM 934
                                      W  +GK   L KIL    +    +VL+F   TQ+
Sbjct: 878  --------------------------WRVAGKFELLEKILPK-FKASGHRVLIFFQMTQI 910

Query: 935  LDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDT-IPVFILSTKAGGFGINLVCA 993
            +DI+E  L   ++ +LRLDG T+ +DR AL++KF+   +    F+LST+AGG G+NL  A
Sbjct: 911  MDIMEDFLRFCDMKYLRLDGHTKSDDRTALLNKFNAPGSDYFCFLLSTRAGGLGLNLQTA 970

Query: 994  NNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLALDTYI 1053
            + VIIFD  +NPH D QA DR+HR+GQ   V I  LIT NS+EE IL+ A  KL +D  +
Sbjct: 971  DTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEVILERAHRKLDIDGKV 1030

>Scas_594.7
          Length = 1703

 Score =  295 bits (756), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 200/558 (35%), Positives = 293/558 (52%), Gaps = 80/558 (14%)

Query: 505  HKNVKFFKQKPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLS 564
            H+  +  +Q+P +L    TLK+YQ  G+ W+  L+ N+L+ ILADEMGLGKT Q I+ L+
Sbjct: 795  HRIKEEIRQQPAMLV-GGTLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLT 853

Query: 565  YLKQNNE-PGPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQ 623
            YL +     GP+LV+VP STL NW  EF K+ P ++   Y GS  ER     I++   G+
Sbjct: 854  YLYETKHIHGPYLVIVPLSTLSNWSNEFAKWAPTMRCISYKGSPNERKSKHAIIK--SGE 911

Query: 624  YDVIVTTYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSE-RFTKLMKIEANFRLLL 682
            +DV++TT+      +  +S +K   +  ++ DEGH +KN+ S+   T      +++RL+L
Sbjct: 912  FDVVLTTFEYIIKERALLSKVK---WIHMIIDEGHRMKNAQSKLSLTLNTYYHSDYRLIL 968

Query: 683  TGTPLQNNLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSN---KDYNPLLAQE-- 737
            TGTPLQNNL EL +LL F +P +F S K+     F +   T  +N   +D   L  +E  
Sbjct: 969  TGTPLQNNLPELWALLNFALPKIFNSVKS-----FDEWFNTPFANTGGQDKIELSEEETL 1023

Query: 738  -AIARAKTMMKPFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRML 796
              I R   +++PF+LRR K  V K LP K  K+  C+MS +Q+ +Y    QQ+L ++R+ 
Sbjct: 1024 LVIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVIKCKMSALQQIMY----QQMLKYRRLF 1079

Query: 797  XXXXXXXXXXXXXPTKKNGGAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKE 856
                           KK  G +   N +M L+K   HP +F    D +            
Sbjct: 1080 IGDHT---------NKKMVGLRGFNNQLMQLKKICNHPFVFEEVEDQI-----------N 1119

Query: 857  PEYAENGNKEYIQEDMSYMNDFELHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILEN 916
            P    N N                                    W  +GK   L K+L  
Sbjct: 1120 PTRETNANI-----------------------------------WRVAGKFELLEKVLPK 1144

Query: 917  IIEHKKEKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDT-IP 975
             ++    +VL+F   TQ++DI+E  L  ++I +LRLDG T+ +DR  L+  F+  D+   
Sbjct: 1145 -LKATGHRVLIFFQMTQIMDIVEDFLRFIDIKYLRLDGHTKSDDRSNLLKLFNAPDSEYL 1203

Query: 976  VFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSI 1035
             FILST+AGG G+NL  A+ VIIFD  +NPH D QA DR+HR+GQ   V I  LIT +S+
Sbjct: 1204 CFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITEHSV 1263

Query: 1036 EEKILQLAKNKLALDTYI 1053
            EE IL+ A  KL +D  +
Sbjct: 1264 EEAILERAHKKLDIDGKV 1281

>CAGL0I09614g 917707..920826 highly similar to tr|Q08773 Saccharomyces
            cerevisiae YOR304w ISW2 or sp|P38144 Saccharomyces
            cerevisiae YBR245c ISW1, hypothetical start
          Length = 1039

 Score =  288 bits (738), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 190/540 (35%), Positives = 286/540 (52%), Gaps = 85/540 (15%)

Query: 524  LKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQNNE-PGPHLVVVPSS 582
            L+DYQ  G+NW+  L+ N +S ILADEMGLGKT Q I+FL YL+   +  GP LV+VP S
Sbjct: 133  LRDYQIQGLNWMISLHENKISGILADEMGLGKTLQTISFLGYLRYVKKIEGPFLVIVPKS 192

Query: 583  TLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDN--DGQYDVIVTTYNLASGNKYD 640
            TL+NW REF K+ P++      G++++R   +DIL++   + ++DV++T+Y +    K  
Sbjct: 193  TLDNWRREFFKWTPNVSTTVLQGTKEQR---QDILQNIVLEARFDVLITSYEMVIREK-- 247

Query: 641  VSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEF 700
              +LK   +  +V DE H +KN  S     +    +  RLL+TGTPLQNNL EL +LL F
Sbjct: 248  -GYLKRLAWEYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITGTPLQNNLHELWALLNF 306

Query: 701  IMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARA-KTMMKPFILRRRKDQVL 759
            ++P++F       S VF    + ++S++D      QE + +    ++ PF+LRR K  V 
Sbjct: 307  LLPDVFGD-----SEVFDDWFQQNNSDQD------QEVVVQQLHAVLNPFLLRRIKADVE 355

Query: 760  KHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXXPTKKNGGAQI 819
            K L  K     Y  M+D+Q   Y   +++ +D                    K+ G  ++
Sbjct: 356  KSLLPKIETNVYVGMTDMQVQWYKSLLEKDID-------------AVNGAVGKREGKTRL 402

Query: 820  SKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQEDMSYMNDFE 879
              N++M LRK   HP LF                    E AE G      E + +     
Sbjct: 403  L-NIVMQLRKCCNHPYLF--------------------EGAEPGPPYTTDEHLIF----- 436

Query: 880  LHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFSLFTQMLDILE 939
                                   N+GK+  L K+L+ + E K  +VL+FS  +++LDILE
Sbjct: 437  -----------------------NAGKMIVLDKLLKRLKE-KGSRVLIFSQMSRLLDILE 472

Query: 940  MALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIP-VFILSTKAGGFGINLVCANNVII 998
                  N N+ R+DGST   +R   ID+++  ++   VF+L+T+AGG GINLV A+ V++
Sbjct: 473  DYCYFRNYNYCRIDGSTSHEERIDAIDEYNKPNSEKFVFLLTTRAGGLGINLVTADTVVL 532

Query: 999  FDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLALDTYISEDDS 1058
            FD  +NP  D QA DR+HR+GQ K VH+   +T N+IEEK+L+ A  KL LD  + +  S
Sbjct: 533  FDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVLERAAQKLRLDQLVIQQGS 592

>CAGL0M04807g complement(514847..520039) similar to sp|P22082
            Saccharomyces cerevisiae YOR290c SNF2 or sp|P32597
            Saccharomyces cerevisiae YIL126w STH1, hypothetical start
          Length = 1730

 Score =  292 bits (748), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 205/576 (35%), Positives = 301/576 (52%), Gaps = 88/576 (15%)

Query: 505  HKNVKFFKQKPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLS 564
            H+  +  +Q+P +L    TLK+YQ  G+ W+  L+ N+L+ ILADEMGLGKT Q I+ L+
Sbjct: 784  HRIKEEVRQQPSILV-GGTLKEYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLT 842

Query: 565  YL-KQNNEPGPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQ 623
            YL +  N  GP L++VP STL NW  EF K+ P L+   Y GS  ER   +  ++   G+
Sbjct: 843  YLYEMKNIKGPFLIIVPLSTLPNWSSEFAKWAPKLRTISYKGSPNERKMKQAQIK--SGE 900

Query: 624  YDVIVTTYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKI-EANFRLLL 682
            +D ++TT+      +  +S +K   +  ++ DEGH +KN+ S+    L     +++RL+L
Sbjct: 901  FDAVITTFEYIIKERAILSKVK---WVHMIIDEGHRMKNAQSKLSLTLNTFYHSDYRLIL 957

Query: 683  TGTPLQNNLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSN---KDYNPLLAQEA- 738
            TGTPLQNNL EL +LL F++P +F S K+     F +   T  +N   +D   L  +E  
Sbjct: 958  TGTPLQNNLPELWALLNFVLPKIFNSAKS-----FDEWFNTPFANTGGQDKIELSEEETL 1012

Query: 739  --IARAKTMMKPFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRML 796
              I R   +++PF+LRR K  V K LP K  K+  C+MS +Q  +Y    QQ+L HK++ 
Sbjct: 1013 LIIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVIKCKMSALQHAMY----QQMLKHKQLF 1068

Query: 797  XXXXXXXXXXXXXPTKKNG--GAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAIL 854
                           KKN   G +   N +M L+K   HP +F    D +          
Sbjct: 1069 IGDQ-----------KKNKLVGLRGFNNQLMQLKKICNHPFVFEEVEDHI---------- 1107

Query: 855  KEPEYAENGNKEYIQEDMSYMNDFELHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKIL 914
              P    N N                                    W  +GK   L +IL
Sbjct: 1108 -NPTRDTNMNI-----------------------------------WRVAGKFELLERIL 1131

Query: 915  ENIIEHKKEKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDT- 973
               ++  + +VL+F   TQ++DI+E  L  ++I +LRLDG T+ ++R  L+  F+D ++ 
Sbjct: 1132 PK-LKASRHRVLIFFQMTQIMDIMEDFLRYIDIKYLRLDGHTRSDERGELLKLFNDPNSE 1190

Query: 974  IPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRN 1033
               FILST+AGG G+NL  A+ VIIFD  +NPH D QA DR+HR+GQ   V I  LIT N
Sbjct: 1191 YFCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRIIRLITTN 1250

Query: 1034 SIEEKILQLAKNKLALDTYISE----DDSKAAEALE 1065
            S+EE IL+ A  KL +D  + +    D+   AE  E
Sbjct: 1251 SVEEVILERAYKKLDIDGKVIQAGKFDNKSTAEEQE 1286

>Kwal_34.15925
          Length = 1025

 Score =  285 bits (729), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 190/534 (35%), Positives = 281/534 (52%), Gaps = 81/534 (15%)

Query: 523  TLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQ-NNEPGPHLVVVPS 581
             L+DYQ  G+NWL  L+ N LS ILADEMGLGKT Q IAFL YL+   +  GPH+V+VP 
Sbjct: 128  VLRDYQVQGLNWLLSLHDNRLSGILADEMGLGKTLQTIAFLGYLRYLKDIDGPHIVIVPK 187

Query: 582  STLENWLREFNKFCPDLKIEPYYGSQQERAE-LRDILEDNDGQYDVIVTTYNLASGNKYD 640
            STL NW REF+K+ P+++     G ++ER   L+DI+   + ++DV++T+Y +    K  
Sbjct: 188  STLNNWKREFSKWTPEVEAVVLSGDKEERQHLLKDIVL--ECKFDVLITSYEMVIKEK-- 243

Query: 641  VSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEF 700
             S LK   +  ++ DE H +KN  S     +    +  RLL+TGTPLQNNL EL +LL F
Sbjct: 244  -STLKRFMWQYIIVDEAHRIKNEQSTLSQIIRLFHSKSRLLITGTPLQNNLHELWALLNF 302

Query: 701  IMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMMKPFILRRRKDQVLK 760
            ++P++F       S  F +    SD+ KD + ++ Q       T++ PF+LRR K +V  
Sbjct: 303  LLPDVFGD-----SDAFDRWFEQSDTEKDQDVVVQQ-----LHTVLSPFLLRRLKSEVET 352

Query: 761  HLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXXPTKKNGGAQIS 820
             L  K     Y  M+D+Q   Y   +++ LD                    K+ G  ++ 
Sbjct: 353  SLLPKIETNLYVGMTDMQVQWYKSLLEKDLD-------------AVNGAIGKREGNTRLL 399

Query: 821  KNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQEDMSYMNDFEL 880
             N++M LRK   HP LF                    E AE G      E + +      
Sbjct: 400  -NIVMQLRKCCNHPYLF--------------------EGAEPGPPYTTDEHLIF------ 432

Query: 881  HRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFSLFTQMLDILEM 940
                                  N+GK+  L K+L+   E    +VL+FS  +++LDILE 
Sbjct: 433  ----------------------NAGKMIVLDKLLKKKKE-AGSRVLIFSQMSRLLDILED 469

Query: 941  ALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIP-VFILSTKAGGFGINLVCANNVIIF 999
                 + ++ R+DGST   +R   ID+F++  +   +F+L+T+AGG GINLV A+ V+I+
Sbjct: 470  YCFFRDYDYCRIDGSTAHEERIEAIDQFNEPGSEKFIFLLTTRAGGLGINLVTADTVVIY 529

Query: 1000 DQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLALDTYI 1053
            D  +NP  D QA DR+HR+GQ K VH+   +T N+IEEK+++ A  KL LD  +
Sbjct: 530  DSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIERAAQKLRLDQLV 583

>Scas_665.17
          Length = 1060

 Score =  285 bits (730), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 188/533 (35%), Positives = 281/533 (52%), Gaps = 81/533 (15%)

Query: 524  LKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQNNE-PGPHLVVVPSS 582
            L+DYQ  G+NWL  L+ N LS ILADEMGLGKT Q I+FL YL+   +  GP L+VVP S
Sbjct: 137  LRDYQVQGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRYVKKIDGPFLIVVPKS 196

Query: 583  TLENWLREFNKFCPDLKIEPYYGSQQERAE-LRDILEDNDGQYDVIVTTYNLASGNKYDV 641
            TL+NW REFNK+ P++     +G ++ER + L DI+   + ++DV++T+Y +    K   
Sbjct: 197  TLDNWRREFNKWTPEVNAIVLHGDKEERHKILYDIVL--EAKFDVLITSYEMVIKEK--- 251

Query: 642  SFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEFI 701
            + LK   +  +V DE H +KN  S+    +    +  RLL+TGTPLQNNL EL +LL F+
Sbjct: 252  NVLKKFAWQYIVIDEAHRIKNEQSQLSQIIRLFYSKNRLLITGTPLQNNLHELWALLNFL 311

Query: 702  MPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMMKPFILRRRKDQVLKH 761
            +P++F       S +F +    ++S +D   ++ Q       T++ PF+LRR K  V K 
Sbjct: 312  LPDVFGD-----SGIFDEWFEQNNSEQDQEIVVQQ-----LHTVLNPFLLRRIKADVEKS 361

Query: 762  LPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXXPTKKNGGAQISK 821
            L  K     Y  M+++Q   Y   +++ +D                    K+ G  ++  
Sbjct: 362  LLPKIETNVYVGMTEMQVKWYKSLLEKDID-------------AVNGAVGKREGKTRLL- 407

Query: 822  NLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQEDMSYMNDFELH 881
            N++M LRK   HP LF                    E AE G      E + +       
Sbjct: 408  NIVMQLRKCCNHPYLF--------------------EGAEPGPPYTTDEHLVF------- 440

Query: 882  RLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFSLFTQMLDILEMA 941
                                 N+GK+  L K+L+ + E K  +VL+FS  +++LDILE  
Sbjct: 441  ---------------------NAGKMIVLDKLLKRLKE-KGSRVLIFSQMSRLLDILEDY 478

Query: 942  LTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIP-VFILSTKAGGFGINLVCANNVIIFD 1000
                   + R+DGST   DR   ID+++  ++   VF+L+T+AGG GINLV A+ VI++D
Sbjct: 479  CFFRGYEYCRIDGSTAHEDRIEAIDEYNKPNSDKFVFLLTTRAGGLGINLVTADTVILYD 538

Query: 1001 QSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLALDTYI 1053
              +NP  D QA DR+HR+GQ K V +   +T N+IEEK+++ A  KL LD  +
Sbjct: 539  SDWNPQADLQAMDRAHRIGQKKQVTVYRFVTENAIEEKVIERAAQKLRLDQLV 591

>KLLA0B08327g 742205..746809 similar to sp|P22082 Saccharomyces
            cerevisiae YOR290c SNF2 component of SWI/SNF global
            transcription activator complex, hypothetical start
          Length = 1534

 Score =  289 bits (739), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 199/549 (36%), Positives = 291/549 (53%), Gaps = 81/549 (14%)

Query: 512  KQKPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQ-NN 570
            KQ+P +L    TLK+YQ  G+ W+  L+ N+L+ ILADEMGLGKT Q I+ L+YL +   
Sbjct: 673  KQQPSILVGG-TLKEYQLKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEAKG 731

Query: 571  EPGPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQYDVIVTT 630
              GP LV+VP STL NW  EF+K+ P L+   + G   ER   + ++++   ++DV++TT
Sbjct: 732  VHGPFLVIVPLSTLTNWNAEFDKWAPKLRKIAFKGPPMERKPKQALIKNR--EFDVVLTT 789

Query: 631  YNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSE-RFTKLMKIEANFRLLLTGTPLQN 689
            +      +  +S +K   +   + DEGH +KN+ S+   T      +++RL+LTGTPLQN
Sbjct: 790  FEYIIKERPLLSKIK---WVHTIIDEGHRMKNAQSKLSLTLNTYYHSDYRLILTGTPLQN 846

Query: 690  NLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSN---KDYNPLLAQE---AIARAK 743
            NL EL +LL F++P +F S K+     F +   T  +N   +D   L  +E    I R  
Sbjct: 847  NLPELWALLNFVLPKIFNSVKS-----FDEWFNTPFANTGGQDKIALSEEETLLVIRRLH 901

Query: 744  TMMKPFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXX 803
             +++PF+LRR K  V K LP K  K+  C+MS +Q  +Y    QQ+L H+R+        
Sbjct: 902  KVLRPFLLRRLKKDVEKDLPDKVEKVLKCKMSALQHKLY----QQMLKHRRLFIFDDSS- 956

Query: 804  XXXXXXPTKKNGGAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENG 863
                    +K   ++   N IM LRK   HP +F    D +                 N 
Sbjct: 957  -------NQKFSSSRGFNNQIMQLRKICNHPFVFEEVEDQI-----------------NP 992

Query: 864  NKEYIQEDMSYMNDFELHRLCTRFPDSLAKFQLKNDE-WMNSGKITALRKILENIIEHKK 922
             +E                               ND  W ++GK   L +IL    +   
Sbjct: 993  ARE------------------------------TNDTIWRSAGKFELLERILPK-FKATG 1021

Query: 923  EKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDT-IPVFILST 981
             +VL+F   TQ++DI+E  L  L++ +LRLDG T+ +DR AL++ F+  ++    F+LST
Sbjct: 1022 HRVLIFFQMTQVMDIMEDFLRYLDMKYLRLDGHTKSDDRTALLNTFNAPNSDYFCFLLST 1081

Query: 982  KAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQ 1041
            +AGG G+NL  A+ VIIFD  +NPH D QA DR+HR+GQ   V I  LIT NS+EE IL 
Sbjct: 1082 RAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITDNSVEEAILD 1141

Query: 1042 LAKNKLALD 1050
             A  KL +D
Sbjct: 1142 KAHAKLDID 1150

>YOR304W (ISW2) [5088] chr15 (884510..887872) Protein required for
            Ume6p-dependent transcriptional repression of several
            meiotic genes, has chromatin remodeling activity, has
            strong similarity to Drosophila nucleosome remodeling
            factor ISWI (Imitator SWI) [3363 bp, 1120 aa]
          Length = 1120

 Score =  286 bits (731), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 187/533 (35%), Positives = 282/533 (52%), Gaps = 81/533 (15%)

Query: 524  LKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQNNE-PGPHLVVVPSS 582
            L+DYQ  G+NWL  L+ N LS ILADEMGLGKT Q I+FL YL+   +  GP L++VP S
Sbjct: 184  LRDYQVQGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRYVKQIEGPFLIIVPKS 243

Query: 583  TLENWLREFNKFCPDLKIEPYYGSQQERAEL-RDILEDNDGQYDVIVTTYNLASGNKYDV 641
            TL+NW REF K+ P++ +   +G +  RA++ R+I+   + ++DV++T+Y +    K   
Sbjct: 244  TLDNWRREFLKWTPNVNVLVLHGDKDTRADIVRNIIL--EARFDVLITSYEMVIREK--- 298

Query: 642  SFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEFI 701
            + LK   +  +V DE H +KN  S     +    +  RLL+TGTPLQNNL EL +LL F+
Sbjct: 299  NALKRLAWQYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITGTPLQNNLHELWALLNFL 358

Query: 702  MPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMMKPFILRRRKDQVLKH 761
            +P++F       S +F +    ++S +D   ++ Q       +++ PF+LRR K  V K 
Sbjct: 359  LPDIFGD-----SELFDEWFEQNNSEQDQEIVIQQ-----LHSVLNPFLLRRVKADVEKS 408

Query: 762  LPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXXPTKKNGGAQISK 821
            L  K     Y  M+D+Q   Y   +++ +D                    K+ G  ++  
Sbjct: 409  LLPKIETNVYVGMTDMQIQWYKSLLEKDID-------------AVNGAVGKREGKTRLL- 454

Query: 822  NLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQEDMSYMNDFELH 881
            N++M LRK   HP LF                    E AE G      E + +       
Sbjct: 455  NIVMQLRKCCNHPYLF--------------------EGAEPGPPYTTDEHLIF------- 487

Query: 882  RLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFSLFTQMLDILEMA 941
                                 NSGK+  L K+L+ + E K  +VL+FS  +++LDILE  
Sbjct: 488  ---------------------NSGKMIILDKLLKRLKE-KGSRVLIFSQMSRLLDILEDY 525

Query: 942  LTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIP-VFILSTKAGGFGINLVCANNVIIFD 1000
                +  + R+DGST   +R   ID+++  ++   VF+L+T+AGG GINLV A+ VI+FD
Sbjct: 526  CYFRDFEYCRIDGSTSHEERIEAIDEYNKPNSEKFVFLLTTRAGGLGINLVTADTVILFD 585

Query: 1001 QSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLALDTYI 1053
              +NP  D QA DR+HR+GQ K VH+   +T N+IEEK+++ A  KL LD  +
Sbjct: 586  SDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIERAAQKLRLDQLV 638

>Kwal_23.4777
          Length = 1301

 Score =  288 bits (736), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 194/535 (36%), Positives = 277/535 (51%), Gaps = 68/535 (12%)

Query: 523  TLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQN-NEPGPHLVVVPS 581
            TLK+YQ  G+ W+  LY N+L+ ILADEMGLGKT Q I+ ++YL++  NEPGP LV+VP 
Sbjct: 455  TLKEYQIRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLRETKNEPGPFLVIVPL 514

Query: 582  STLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQYDVIVTTYNLASGNKYDV 641
            ST+ NW  EF K+ P L    Y G+  +R  ++  +    G ++V++TTY        D 
Sbjct: 515  STITNWTLEFEKWAPSLATIVYKGTPNQRKSMQHQI--RIGNFEVLLTTYEYIIK---DR 569

Query: 642  SFLKNRGFNVVVYDEGHMLKNSMSE-RFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEF 700
            S L    ++ ++ DEGH +KN+ S+  FT         RL+LTGTPLQNNL EL +LL F
Sbjct: 570  SLLAKHDWSHMIIDEGHRMKNAQSKLSFTLTRYYRTRNRLILTGTPLQNNLPELWALLNF 629

Query: 701  IMPNLFISKKNDLSAVFRQRARTSDSNK-DYNPLLAQEAIARAKTMMKPFILRRRKDQVL 759
            ++P +F S K          A T    K +         I R   +++PF+LRR K +V 
Sbjct: 630  VLPKIFNSAKTFDEWFNTPFANTGGQEKLELTEEETLLVIRRLHKVLRPFLLRRLKKEVE 689

Query: 760  KHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXXPTKKNGGAQI 819
            K LP K  K+  C++S +Q  +Y    QQ+L H  +                   GG + 
Sbjct: 690  KDLPDKVEKVVKCKLSGLQHQLY----QQMLKHNALFFGAGTEGAT--------KGGIKG 737

Query: 820  SKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQEDMSYMNDFE 879
              N IM LRK   HP +F         D++   I                 + S  N   
Sbjct: 738  LNNKIMQLRKICNHPFVF---------DEVEGII-----------------NPSRANSPL 771

Query: 880  LHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFSLFTQMLDILE 939
            L+R+  +F + L +  LK        K+T  R             VL+F   TQ++DI+E
Sbjct: 772  LYRVAGKF-ELLDRILLK-------FKVTGHR-------------VLMFFQMTQVMDIME 810

Query: 940  MALTTLNINFLRLDGSTQVNDRQALIDKFHDDDT-IPVFILSTKAGGFGINLVCANNVII 998
              L    + +LRLDG+T+  DR  ++  F+  ++    F+LST+AGG G+NL  A+ VII
Sbjct: 811  DFLRMRGLKYLRLDGATKTEDRTGMLKLFNAPNSEYFCFLLSTRAGGLGLNLQTADTVII 870

Query: 999  FDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLALDTYI 1053
            FD  +NPH D QA DR+HR+GQ   V I  LIT +S+EE IL+ A  KL +D  +
Sbjct: 871  FDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERALQKLDIDGKV 925

>Scas_662.7
          Length = 1342

 Score =  285 bits (730), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 188/532 (35%), Positives = 277/532 (52%), Gaps = 68/532 (12%)

Query: 523  TLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYL-KQNNEPGPHLVVVPS 581
            TLK+YQ  G+ W+  LY N+L+ ILADEMGLGKT Q I+ ++YL ++  +PGP+LV+VP 
Sbjct: 460  TLKEYQIRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLFEEKKDPGPYLVIVPL 519

Query: 582  STLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQYDVIVTTYNLASGNKYDV 641
            ST+ NW  EF K+ P L    Y G+  +R  L+  +    G +DV++TTY        D 
Sbjct: 520  STITNWTLEFEKWAPSLNTVIYKGTPNQRRNLQHQV--RIGNFDVLLTTYEYIIK---DR 574

Query: 642  SFLKNRGFNVVVYDEGHMLKNSMSE-RFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEF 700
            + L    +  ++ DEGH +KN+ S+  +T     +   RL+LTGTPLQNNL EL +LL F
Sbjct: 575  ALLAKHEWTHMIIDEGHRMKNAQSKLSYTITHYYKTRHRLILTGTPLQNNLPELWALLNF 634

Query: 701  IMPNLFISKKNDLSAVFRQRARTSDSNK-DYNPLLAQEAIARAKTMMKPFILRRRKDQVL 759
            ++P +F S K          A T    K +         I R   +++PF+LRR K +V 
Sbjct: 635  VLPKIFNSAKTFEDWFNTPFANTGTGEKLELTEEETLLVIRRLHKVLRPFLLRRLKKEVE 694

Query: 760  KHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXXPTKKNGGAQI 819
            K LP K  K+  C++S +Q+ +Y    +Q+L H  +                    G + 
Sbjct: 695  KDLPDKVEKVVKCKLSGLQQQLY----EQMLKHNALFLGEGTEGAT--------KSGIKG 742

Query: 820  SKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQEDMSYMNDFE 879
              N IM LRK   HP +F         D++   I                 + +  N   
Sbjct: 743  LNNKIMQLRKICNHPFVF---------DEVEGVI-----------------NPTRANSNL 776

Query: 880  LHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFSLFTQMLDILE 939
            L+R+                    SGK   L ++L    +    +VL+F   TQ++DI+E
Sbjct: 777  LYRV--------------------SGKFELLNRVLPK-FKAAGHRVLMFFQMTQVMDIME 815

Query: 940  MALTTLNINFLRLDGSTQVNDRQALIDKFHDDDT-IPVFILSTKAGGFGINLVCANNVII 998
              L   ++ ++RLDGST+ +DR  +++ F+  D+    F+LST+AGG G+NL  A+ VII
Sbjct: 816  DFLRMKDLKYMRLDGSTKADDRTGMLNDFNAPDSDYFCFLLSTRAGGLGLNLQTADTVII 875

Query: 999  FDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLALD 1050
            FD  +NPH D QA DR+HR+GQ   V I  LIT +S+EE IL+ A  KL +D
Sbjct: 876  FDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDID 927

>AER375C [2876] [Homologous to ScYIL126W (STH1) - SH]
            (1332505..1336371) [3867 bp, 1288 aa]
          Length = 1288

 Score =  283 bits (725), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 193/537 (35%), Positives = 277/537 (51%), Gaps = 78/537 (14%)

Query: 523  TLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQ-NNEPGPHLVVVPS 581
            TLK+YQ  G+ W+  LY N+L+ ILADEMGLGKT Q I+ ++YL +   + GP LV+VP 
Sbjct: 456  TLKEYQIRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEVKKDSGPFLVIVPL 515

Query: 582  STLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQYDVIVTTYNLASGNKYDV 641
            ST+ NW  EF K+ P L    Y G+  +R  L+   +   G +DV++TTY        D 
Sbjct: 516  STITNWTLEFEKWAPSLTTVIYKGTPNQRRSLQH--QVRIGDFDVLLTTYEYIIK---DR 570

Query: 642  SFLKNRGFNVVVYDEGHMLKNSMSE-RFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEF 700
            S L    ++ ++ DEGH +KN+ S+  +T     +   RL+LTGTPLQNNL EL +LL F
Sbjct: 571  SLLAKHEWSHMIIDEGHRMKNAQSKLSYTLTHYYKTRHRLILTGTPLQNNLPELWALLNF 630

Query: 701  IMPNLFISKKNDLSAVFRQRARTSDSN------KDYNPLLAQEAIARAKTMMKPFILRRR 754
            ++P +F S K      F +   T  SN       +     A   I R   +++PF+LRR 
Sbjct: 631  VLPKIFNSSK-----TFDEWFNTPFSNTGGQEKLELTEEEALLVIRRLHKVLRPFLLRRL 685

Query: 755  KDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXXPTKKN 814
            K +V K LP K  K+  C++S +Q  +Y    QQ+L H  +                   
Sbjct: 686  KKEVEKDLPDKVEKVVKCKLSGLQHQLY----QQMLKHNALFVGAGTEGAT--------K 733

Query: 815  GGAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQEDMSY 874
            GG +   N IM LRK   HP +F    D+V             E   N  +         
Sbjct: 734  GGIKGLNNKIMQLRKICNHPFVF----DEV-------------EGVVNPTR--------- 767

Query: 875  MNDFELHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFSLFTQM 934
             N   L+R+                    SGK   L ++L    +    +VL+F   TQ+
Sbjct: 768  TNSSLLYRV--------------------SGKFELLDRVLPK-FKATGHRVLMFFQMTQV 806

Query: 935  LDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDT-IPVFILSTKAGGFGINLVCA 993
            +DI+E  L   N+ ++RLDG+T+  +R  +++ F+  D+    F+LST+AGG G+NL  A
Sbjct: 807  MDIMEDFLQMKNLKYMRLDGATKAEERTGMLNAFNAPDSDYFCFLLSTRAGGLGLNLQTA 866

Query: 994  NNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLALD 1050
            + VIIFD  +NPH D QA DR+HR+GQ   V I  LIT +S+EE IL+ A  KL +D
Sbjct: 867  DTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDID 923

>Scas_652.17
          Length = 1025

 Score =  280 bits (717), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 192/546 (35%), Positives = 276/546 (50%), Gaps = 83/546 (15%)

Query: 511  FKQKPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLK-QN 569
            F++ PK +    TL+ YQ  G+NWL  L++N L+ ILADEMGLGKT Q IAFL YLK   
Sbjct: 102  FRESPKYIHG--TLRPYQIQGLNWLVSLHKNGLAGILADEMGLGKTLQTIAFLGYLKYME 159

Query: 570  NEPGPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAEL-RDILEDNDGQYDVIV 628
               GP LV+ P STL NWLRE NK+ PD+K     G +QERA L ++ L   D  +D++V
Sbjct: 160  GINGPFLVIAPKSTLNNWLREINKWTPDVKAFVLQGDKQERASLIKEKLMTCD--FDIVV 217

Query: 629  TTYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQ 688
             +Y +    K   +  K   +  ++ DE H +KN  S     L +  +  RLL+TGTPLQ
Sbjct: 218  ASYEIIIREK---AAFKKFNWEYIIIDEAHRIKNEESLLSQVLREFTSRNRLLITGTPLQ 274

Query: 689  NNLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMMKP 748
            NNL EL +LL F++P++F S   D    F       D +K          + +  T+++P
Sbjct: 275  NNLHELWALLNFLLPDIF-SSSQDFDDWFSSETTEEDQDK---------VVKQLHTVLQP 324

Query: 749  FILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXX 808
            F+LRR K+ V   L  K     Y  MS++Q+  Y + +++ LD                 
Sbjct: 325  FLLRRIKNDVETSLLPKKELNLYVGMSNMQKKWYKKILEKDLD-------------AVNG 371

Query: 809  XPTKKNGGAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYI 868
              + K    ++  N++M LRK   HP LF                    + AE G     
Sbjct: 372  ENSSKESKTRLL-NIVMQLRKCCNHPYLF--------------------DGAEPGPPYTT 410

Query: 869  QEDMSYMNDFELHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVF 928
             E + Y                            NS K+  L K+L+ + E    +VL+F
Sbjct: 411  DEHLVY----------------------------NSKKLQVLDKLLKKMKED-GSRVLIF 441

Query: 929  SLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIP-VFILSTKAGGFG 987
            S  +++LDILE         + R+DGST   DR   ID ++  D+   +F+L+T+AGG G
Sbjct: 442  SQMSRVLDILEDYCFFRGYKYCRIDGSTDHEDRIKSIDDYNAPDSDKFIFLLTTRAGGLG 501

Query: 988  INLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKL 1047
            INL  A+ V+++D  +NP  D QA DR+HR+GQ K V +   +T NS+EEKIL+ A  KL
Sbjct: 502  INLTSADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRFVTDNSVEEKILERATQKL 561

Query: 1048 ALDTYI 1053
             LD  +
Sbjct: 562  RLDQLV 567

>Kwal_14.1600
          Length = 1102

 Score =  280 bits (715), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 193/550 (35%), Positives = 280/550 (50%), Gaps = 91/550 (16%)

Query: 511  FKQKPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQ-N 569
            F++ P  +  +  L+ YQ  G+NWL  L+RNNL+ ILADEMGLGKT Q I+FL YL+   
Sbjct: 125  FRESPPFI--NGCLRPYQVQGVNWLVSLHRNNLAGILADEMGLGKTLQTISFLGYLRYVE 182

Query: 570  NEPGPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAEL-RDILEDNDGQYDVIV 628
             +PGP +V+ P STL NWLRE N++ PD++     G ++ERA+L  + L   D  +D++V
Sbjct: 183  KKPGPFVVIAPKSTLNNWLREINRWTPDVRAFILQGDKEERAKLVANKLMACD--FDIVV 240

Query: 629  TTYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQ 688
             +Y +    K   SF K   +  +V DE H +KN  S     L +  +  RLL+TGTPLQ
Sbjct: 241  ASYEIIIKEK--ASF-KKIAWEYIVIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPLQ 297

Query: 689  NNLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMMKP 748
            NNL EL +LL F++P++F       S  F     +  S  D   ++ Q       T+++P
Sbjct: 298  NNLHELWALLNFLLPDVFSD-----SQAFDDWFSSESSEDDKGKIVKQ-----LHTVLQP 347

Query: 749  FILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXX 808
            F+LRR K++V   L  K     Y  MS +Q+  Y + +++ +D                 
Sbjct: 348  FLLRRLKNEVETSLLPKKELNLYIGMSSMQKRWYKQILEKDID----------------- 390

Query: 809  XPTKKNGGAQISK----NLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGN 864
                   G + SK    N++M LRK   HP LF                    + AE G 
Sbjct: 391  -AVNGANGNKESKTRLLNVMMQLRKCCNHPYLF--------------------DGAEPGP 429

Query: 865  KEYIQEDMSYMNDFELHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKEK 924
                 E + Y                            NS K+  L K+L    E +  +
Sbjct: 430  PYTTDEHLVY----------------------------NSAKLKVLDKLLRKFKE-EGSR 460

Query: 925  VLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIP-VFILSTKA 983
            VL+FS  +++LDILE         + R+DGST   DR   ID+++  D+   VF+L+T+A
Sbjct: 461  VLIFSQMSRVLDILEDYCFFRQYEYCRIDGSTAHEDRIEAIDEYNAPDSKKFVFLLTTRA 520

Query: 984  GGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLA 1043
            GG GINL  A+ V+++D  +NP  D QA DR+HR+GQ K V +  L+T NS+EEKIL+ A
Sbjct: 521  GGLGINLTTADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVRVFRLVTDNSVEEKILERA 580

Query: 1044 KNKLALDTYI 1053
              KL LD  +
Sbjct: 581  TQKLRLDQLV 590

>KLLA0F04521g complement(435649..439683) similar to sp|P32597
            Saccharomyces cerevisiae YIL126w STH1 subunit of the RSC
            complex, start by similarity
          Length = 1344

 Score =  279 bits (713), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 190/537 (35%), Positives = 274/537 (51%), Gaps = 78/537 (14%)

Query: 523  TLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQ-NNEPGPHLVVVPS 581
            TLK+YQ  G+ W+  LY N+L+ ILADEMGLGKT Q I+ +SYL +  NE  P LV+VP 
Sbjct: 512  TLKEYQLKGLEWMVSLYNNHLNGILADEMGLGKTIQSISLISYLYEIKNERQPFLVIVPL 571

Query: 582  STLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQYDVIVTTYNLASGNKYDV 641
            ST+ NW  EF K+ P L+   Y G+  +R  L+  ++   G +DV++TTY        D 
Sbjct: 572  STITNWTIEFEKWAPSLRTIVYKGNPNQRKALQHTIK--MGNFDVVLTTYEYIIK---DR 626

Query: 642  SFLKNRGFNVVVYDEGHMLKNSMSE-RFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEF 700
              L    +  ++ DEGH +KN+ S+  +T     +   RL+LTGTPLQNNL EL +LL F
Sbjct: 627  PLLAKHDWAHMIIDEGHRMKNAQSKLSYTLTHYYKTKNRLILTGTPLQNNLPELWALLNF 686

Query: 701  IMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQE------AIARAKTMMKPFILRRR 754
            ++P +F S K      F +   T  +N      L          I R   +++PF+LRR 
Sbjct: 687  VLPKIFNSSK-----TFDEWFNTPFANTGTQEKLEMTEEETLLVIRRLHKVLRPFLLRRL 741

Query: 755  KDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXXPTKKN 814
            K +V K LP K  K+  C++S +Q+ +Y    +Q+L H                      
Sbjct: 742  KKEVEKDLPDKVEKVVKCKLSSLQQQLY----EQMLKHNAFFIGAGTEGAT--------K 789

Query: 815  GGAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQEDMSY 874
             G +   N +M LRK   HP +F         D++   I        N  +E        
Sbjct: 790  AGIKGLNNKVMQLRKICNHPFVF---------DEVENVI--------NPTRE-------- 824

Query: 875  MNDFELHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFSLFTQM 934
             N   L+R+                    SGK   L ++L    +    +VL+F   TQ+
Sbjct: 825  -NSSILYRV--------------------SGKFELLDRVLPK-FKASGHRVLMFFQMTQV 862

Query: 935  LDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDT-IPVFILSTKAGGFGINLVCA 993
            +DI+E  L   ++ ++RLDG T+  DR  ++  F+  D+    F+LST+AGG G+NL  A
Sbjct: 863  MDIMEDFLRMRDLKYMRLDGGTKAEDRTGMLKLFNAPDSEYFCFLLSTRAGGLGLNLQTA 922

Query: 994  NNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLALD 1050
            + VIIFD  +NPH D QA DR+HR+GQ   V I  LIT +S+EE IL+ A  KL +D
Sbjct: 923  DTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDID 979

>CAGL0C01683g 178695..182042 highly similar to sp|P38144 Saccharomyces
            cerevisiae YBR245c ISW1 or tr|Q08773 Saccharomyces
            cerevisiae YOR304w ISW2, hypothetical start
          Length = 1115

 Score =  276 bits (706), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 189/564 (33%), Positives = 280/564 (49%), Gaps = 91/564 (16%)

Query: 510  FFKQKPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQN 569
             F++ P  ++    L+DYQ  G+NWL  L +N ++ ILADEMGLGKT Q I+FL YL+  
Sbjct: 163  LFRESPAYING--QLRDYQVQGLNWLVSLDKNRIAGILADEMGLGKTLQTISFLGYLRYI 220

Query: 570  NE-PGPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAEL-RDILEDNDGQYDVI 627
             + PGP LV+ P STL NWLRE NK+ P++      G ++ERA L +D     D  +DV+
Sbjct: 221  KKIPGPFLVIAPKSTLNNWLREINKWTPEVNAFILQGDKEERARLIQDKFMACD--FDVV 278

Query: 628  VTTYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPL 687
            + +Y +    K   +  +   +  ++ DE H +KN  S     L +  +  RLL+TGTPL
Sbjct: 279  IASYEIIIREK---AAFRKMNWEYIMIDEAHRIKNEESMLSQVLREFHSKNRLLITGTPL 335

Query: 688  QNNLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMMK 747
            QNNL EL +LL F++P++F S   D    F +     D  K          + +  T+++
Sbjct: 336  QNNLHELWALLNFLLPDIF-SDSQDFDEWFSKETDEEDQEK---------IVKQLHTVLQ 385

Query: 748  PFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXX 807
            PF+LRR K  V   L  K     Y  MS +Q+  Y + +++ +D                
Sbjct: 386  PFLLRRIKSDVETSLLPKKELNVYVGMSPMQKKWYRQILEKDID---------------- 429

Query: 808  XXPTKKNGGAQISK----NLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENG 863
                  + G++ SK    N++M LRK   HP LF                    + AE G
Sbjct: 430  --AVNADSGSKESKTRLLNIVMQLRKCCNHPYLF--------------------DGAEPG 467

Query: 864  NKEYIQEDMSYMNDFELHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKE 923
                  E + Y                            NS K+  L K+L  + E    
Sbjct: 468  PPYTTDEHLVY----------------------------NSEKLKVLDKLLRKLKEAGS- 498

Query: 924  KVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIP-VFILSTK 982
            +VL+FS  +++LDILE         + R+DGST   DR   ID+++  D+   +F+L+T+
Sbjct: 499  RVLIFSQMSRVLDILEDYCYFREYEYCRIDGSTAHEDRIEAIDEYNAPDSKKFLFLLTTR 558

Query: 983  AGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQL 1042
            AGG GINL  A+ V++FD  +NP  D QA DR+HR+GQ K V +   +T NS+EEKIL+ 
Sbjct: 559  AGGLGINLTTADVVVLFDSDWNPQADLQAMDRAHRIGQKKQVRVFRFVTDNSVEEKILER 618

Query: 1043 AKNKLALDTYISEDDSKAAEALEN 1066
            A  KL LD  + + +    +  EN
Sbjct: 619  ATQKLRLDQLVIQQNRPTNKKKEN 642

>Scas_576.6
          Length = 1457

 Score =  278 bits (712), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 192/545 (35%), Positives = 285/545 (52%), Gaps = 92/545 (16%)

Query: 524  LKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYL----KQNNEPGPHLVVV 579
            L+D+Q TGINW+  L+  N + ILADEMGLGKT Q +AF+S+L    +QN   GPH+VVV
Sbjct: 382  LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQN---GPHIVVV 438

Query: 580  PSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDI--------LEDNDGQYDVIVTTY 631
            P ST+  W   F+K+ PDL +  Y G+Q+ R  +R+             + +++V++TTY
Sbjct: 439  PLSTMPAWQETFDKWAPDLNVICYMGNQRSRDAIREFEFYTNPYAKGKKNIKFNVLLTTY 498

Query: 632  NLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNL 691
                 ++ ++  +K   +  +  DE H LKN+ S  +  L   + N RLL+TGTPLQNN+
Sbjct: 499  EYILKDRSELGSIK---WQFLAVDEAHRLKNAESSLYESLNSFKVNNRLLITGTPLQNNI 555

Query: 692  KELMSLLEFIMPNLF-ISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMMKPFI 750
            KEL +L+ F+MP  F I ++ D              N+D      +E I      ++PFI
Sbjct: 556  KELAALINFLMPGRFTIDQEIDF------------ENQDEE---QEEYIRDLHKRLQPFI 600

Query: 751  LRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXXP 810
            LRR K  V K LP K  +I   E+SDVQ   Y          K +L              
Sbjct: 601  LRRLKKDVEKSLPSKTERILRVELSDVQTEYY----------KNILTKNYSAL------- 643

Query: 811  TKKNGGAQIS-KNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQ 869
            T  + G   S  N++  L+KA+ HP LF         D     +LK     + G+ +  +
Sbjct: 644  TAGSKGGHFSLLNIMSELKKASNHPYLF---------DNAEERVLK-----KFGDGQMSR 689

Query: 870  EDMSYMNDFELHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFS 929
            E++       L  L                  M+SGK+  L ++L N ++    +VL+FS
Sbjct: 690  ENV-------LRGLI-----------------MSSGKMVLLDQLL-NKLKKDGHRVLIFS 724

Query: 930  LFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFH-DDDTIPVFILSTKAGGFGI 988
               +MLDIL   L+   I F RLDG+     R+  ID F+  D T  VF+LST+AGG GI
Sbjct: 725  QMVRMLDILGDYLSIKGITFQRLDGTVPSAQRRISIDHFNAPDSTDDVFLLSTRAGGLGI 784

Query: 989  NLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLA 1048
            NL+ A+ VIIFD  +NP  D QA  R+HR+GQ   V +  L++++++EE++L+ A+ K+ 
Sbjct: 785  NLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMI 844

Query: 1049 LDTYI 1053
            L+  I
Sbjct: 845  LEYAI 849

>AFR537W [3729] [Homologous to ScYOR304W (ISW2) - SH]
            complement(1400495..1400512,1400676..1403735) [3078 bp,
            1025 aa]
          Length = 1025

 Score =  273 bits (698), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 184/534 (34%), Positives = 276/534 (51%), Gaps = 83/534 (15%)

Query: 524  LKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLK-QNNEPGPHLVVVPSS 582
            L+DYQ  G+NWL  L+ N LS ILADEMGLGKT Q I+FL YL+   +  GP +VVVP S
Sbjct: 128  LRDYQIYGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRFIKDIDGPFIVVVPKS 187

Query: 583  TLENWLREFNKFCPDLKIEPYYGSQQERAELRD--ILEDNDGQYDVIVTTYNLASGNKYD 640
            TL+NW REF K+ P++     +G ++ R +L +  IL  +   +DV++T+Y +    K  
Sbjct: 188  TLDNWKREFAKWTPEVNTIVLHGDRETRTQLIEERILTCD---FDVLITSYEMVIKEK-- 242

Query: 641  VSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEF 700
             + LK   +  +V DE H +KN  S     +    +  RLL+TGTPLQNNL EL +LL F
Sbjct: 243  -AILKKFAWQYIVIDEAHRIKNEQSTLSQIIRLFYSKSRLLITGTPLQNNLHELWALLNF 301

Query: 701  IMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMMKPFILRRRKDQVLK 760
            ++P++F       S VF +  + ++  +D   ++ Q        +++PF+LRR K  V K
Sbjct: 302  LLPDVFGE-----SEVFDEWFQQNEKAQDQEIVVQQ-----LHAVLQPFLLRRVKADVEK 351

Query: 761  HLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXXPTKKNGGAQIS 820
             L  K     Y  M+ +Q   Y   +++ +D                    K+ G  ++ 
Sbjct: 352  SLLPKIETNVYVGMTAMQLQWYRSLLEKDID-------------AVNGAVGKREGKTRLL 398

Query: 821  KNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQEDMSYMNDFEL 880
             N++M LRK   HP LF                    E AE G      E + Y      
Sbjct: 399  -NIVMQLRKCCNHPYLF--------------------EGAEPGPPYTTDEHLIY------ 431

Query: 881  HRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFSLFTQMLDILEM 940
                                  NSGK+  +   L    + +  +VL+FS  +++LDILE 
Sbjct: 432  ----------------------NSGKMI-VLDKLLKRKKKEGSRVLIFSQMSRLLDILED 468

Query: 941  ALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIP-VFILSTKAGGFGINLVCANNVIIF 999
                 +  + R+DG+T   +R A ID+F+  D+   +F+L+T+AGG GINLV A+ V+++
Sbjct: 469  YCYFRDFEYCRIDGATSHEERIAAIDEFNAHDSKKFIFLLTTRAGGLGINLVTADTVVLY 528

Query: 1000 DQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLALDTYI 1053
            D  +NP  D QA DR+HR+GQ K VH+  L+T N+IEEK+++ A  KL LD  +
Sbjct: 529  DSDWNPQADLQAMDRAHRIGQKKQVHVYRLVTENAIEEKVIERAAQKLRLDQLV 582

>CAGL0G08756g complement(829778..833842) highly similar to sp|P32597
            Saccharomyces cerevisiae YIL126w STH1 subunit of the RSC
            complex, hypothetical start
          Length = 1354

 Score =  275 bits (703), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 190/532 (35%), Positives = 278/532 (52%), Gaps = 68/532 (12%)

Query: 523  TLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQ-NNEPGPHLVVVPS 581
            TLK+YQ  G+ W+  LY N+L+ ILADEMGLGKT Q I+ ++YL +   EPGP+LV+VP 
Sbjct: 452  TLKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEVKQEPGPYLVIVPL 511

Query: 582  STLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQYDVIVTTYNLASGNKYDV 641
            ST+ NW  EF K+ P L    Y G+  +R  L+  +    G +DV++TTY     +K   
Sbjct: 512  STITNWTLEFEKWAPSLTTIIYKGTPNQRHALQHKI--RSGNFDVLLTTYEYIIKDK--- 566

Query: 642  SFLKNRGFNVVVYDEGHMLKNSMSE-RFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEF 700
            + L    ++ ++ DEGH +KN+ S+  FT         RL+LTGTPLQNNL EL +LL F
Sbjct: 567  ALLSKHEWSHMIIDEGHRMKNANSKLSFTITKYYRTRNRLILTGTPLQNNLPELWALLNF 626

Query: 701  IMPNLFISKKNDLSAVFRQRARTSDSNK-DYNPLLAQEAIARAKTMMKPFILRRRKDQVL 759
            ++P +F S K          A T    K +         I R   +++PF+LRR K +V 
Sbjct: 627  VLPKIFNSAKTFEDWFNTPFANTGTQEKLELTEEETLLVIRRLHKVLRPFLLRRLKKEVE 686

Query: 760  KHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXXPTKKNGGAQI 819
            K LP K  K+  C++S +Q+ +Y + ++    H  +                   GG + 
Sbjct: 687  KDLPDKVEKVVKCKLSGLQQQLYQQMLK----HNALFVGAGTEGAT--------KGGIKG 734

Query: 820  SKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQEDMSYMNDFE 879
              N IM LRK   HP +F    D+V       A++        GN +             
Sbjct: 735  LNNKIMQLRKICNHPFVF----DEV------EAVVN----PSRGNSDL------------ 768

Query: 880  LHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFSLFTQMLDILE 939
            L+R+                    +GK   L +IL    +    +VL+F   TQ++DI+E
Sbjct: 769  LYRV--------------------AGKFELLDRILPK-FKATGHRVLIFFQMTQVMDIME 807

Query: 940  MALTTLNINFLRLDGSTQVNDRQALIDKFH-DDDTIPVFILSTKAGGFGINLVCANNVII 998
              L   ++ ++RLDGST+  DR  ++ +F+ ++     F+LST+AGG G+NL  A+ VII
Sbjct: 808  DFLRMRDLKYMRLDGSTKAEDRNDMLKEFNVENSEYFCFLLSTRAGGLGLNLQSADTVII 867

Query: 999  FDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLALD 1050
            FD  +NPH D QA DR+HR+GQ   V I  LIT +S+EE IL+ A  KL +D
Sbjct: 868  FDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDID 919

>KLLA0E04048g 375999..378479 similar to sp|P43610 Saccharomyces
            cerevisiae YFR038w, start by similarity
          Length = 826

 Score =  267 bits (682), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 196/581 (33%), Positives = 297/581 (51%), Gaps = 89/581 (15%)

Query: 514  KPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQNNEPG 573
            +P  L  +  LK YQ+ G+NWL  LY N L+ ILADEMGLGKT Q IA L+++ + +  G
Sbjct: 188  QPSFLK-NCQLKPYQKEGLNWLITLYENGLNGILADEMGLGKTIQSIALLAFIYEMDTKG 246

Query: 574  PHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAE---LRDILEDNDGQYDVIVTT 630
            P L+  P ST+ENW+ EF +F PD+ +  YY S+ + A    +    ++N G+  VI+T+
Sbjct: 247  PFLIAAPLSTVENWMNEFARFAPDIPVLKYYNSEGQAARHAMMGKFFKNNKGE-GVIITS 305

Query: 631  YNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNN 690
            Y +      D+  + +  +  ++ DEGH LKN   +   +L +I  + RLLLTGTPLQNN
Sbjct: 306  YEIII---RDIELILSYQWKFLIVDEGHRLKNINCKLIRELKRINTSNRLLLTGTPLQNN 362

Query: 691  LKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSN---------KDYNPLLAQEAIAR 741
            L EL SLL FI+PN+F    +D   +F +    SD N         K  N  L +  I+ 
Sbjct: 363  LGELWSLLNFILPNIF----SDFE-IFNKWFDFSDLNLESSSEKLTKIINDELEKNLISN 417

Query: 742  AKTMMKPFILRRRKDQVLK-HLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXX 800
              T++KPF+LRR K  VL   LP K   I  C ++ +Q+  Y + ++             
Sbjct: 418  LHTILKPFLLRRLKKNVLAGSLPPKREYIITCPVTPLQKKYYKQALK------------- 464

Query: 801  XXXXXXXXXPTKKNGGAQISKNLIMSLRKAALHPLL-FRHHYDDVMLDKMSRAILKEPEY 859
                                 NL  +++K A+         Y   + +K  R  +   E+
Sbjct: 465  --------------------GNLKQTIQKQAIKDFFTLNAEYIGTVSNKSIRDFI---EW 501

Query: 860  AENGNKEYIQED----MSYMNDFELHR--LCTRFPDSLAKF-QLKNDEWM---------- 902
              + + + I  D    M  + D  +H+  L  R  + + +  Q+ N  ++          
Sbjct: 502  KLSADSQDIPNDNIGKMEKLYDMHIHKELLNKRLQNMMIQLRQIVNSTYLFYFPLLEPTD 561

Query: 903  ----NSGKITALRKILENIIEH---KKEKVLVFSLFTQMLDILEMALTTLNINFL--RLD 953
                N  K +   ++L+ ++     KK KVL+FS F  MLD++E   + LN NF+  R+D
Sbjct: 562  LTLENLLKTSGKLQVLQKLVPELIKKKHKVLIFSQFVSMLDLIE-DWSELN-NFISCRID 619

Query: 954  GSTQVNDRQALIDKFHDDDT-IPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAA 1012
            GS Q N R+  I++F    +   +F+LST+A G GINL  A++VIIFD  +NP  D QA 
Sbjct: 620  GSMQNNSRKEQIEEFSKKGSKANLFLLSTRAAGLGINLTAADSVIIFDSDWNPQVDLQAM 679

Query: 1013 DRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLALDTYI 1053
            DR+HR+GQTK V +  L   N+IE  I+  A NK  L+  +
Sbjct: 680  DRAHRIGQTKPVIVYRLYCDNTIENVIMTRAVNKRKLEKLV 720

>CAGL0L11770g 1254125..1258555 highly similar to sp|P32657
            Saccharomyces cerevisiae YER164w CHD1 transcriptional
            regulator, start by similarity
          Length = 1476

 Score =  272 bits (695), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 195/547 (35%), Positives = 280/547 (51%), Gaps = 96/547 (17%)

Query: 524  LKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYL----KQNNEPGPHLVVV 579
            L+D+Q TGINW+  L+  N + ILADEMGLGKT Q +AF+S+L    +QN   GPHLVVV
Sbjct: 391  LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQN---GPHLVVV 447

Query: 580  PSSTLENWLREFNKFCPDLKIEPYYGSQQERAELR--DILEDNDG------QYDVIVTTY 631
            P ST+  W+  F K+ PD+ +  Y G+Q+ R   R  +   +  G      +++V++TTY
Sbjct: 448  PLSTMPAWIETFEKWAPDIDVICYMGNQKSRDIEREYEFYSNPKGKGKKQIKFNVLMTTY 507

Query: 632  NLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNL 691
                 ++ ++  +K   +  +  DE H LKN+ S  +  L   +   RLL+TGTPLQNN+
Sbjct: 508  EYILKDRAELGSIK---WQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNI 564

Query: 692  KELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDY-NPLLAQEAIAR-AKTMMKPF 749
            KEL +L+ F+MP  F                T D   D+ N    QE   R     ++PF
Sbjct: 565  KELAALVNFLMPGRF----------------TIDQEIDFENQDEEQEQYIRDLHKRLQPF 608

Query: 750  ILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXX 809
            ILRR K  V K LP K  +I   E+SDVQ   Y          K +L             
Sbjct: 609  ILRRLKKDVEKSLPSKTERILRVELSDVQTEYY----------KNILTKNYSALTAGA-- 656

Query: 810  PTKKNGGAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQ 869
                 GG     N++ +L KA+ HP LF    + V L+K           A N ++E I 
Sbjct: 657  ----KGGRFSMLNIMNTLMKASNHPYLFDSAEEKV-LEKFG---------AGNMSRENI- 701

Query: 870  EDMSYMNDFELHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFS 929
                      L  L                  M+SGK+  L K+L   ++    +VL+FS
Sbjct: 702  ----------LRGLI-----------------MSSGKMVLLDKLLTR-LKKDGHRVLIFS 733

Query: 930  LFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFH---DDDTIPVFILSTKAGGF 986
               ++LDIL   L+   INF RLDG+   N R+  ID F+    DD   VF+LST+AGG 
Sbjct: 734  QMVRILDILGDYLSIKGINFQRLDGTVPSNQRRIAIDHFNAPGSDDF--VFLLSTRAGGL 791

Query: 987  GINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNK 1046
            GINL+ A+ VIIFD  +NP  D QA  R+HR+GQ   V +  L++++++EE++L+ A+ K
Sbjct: 792  GINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKK 851

Query: 1047 LALDTYI 1053
            + L+  I
Sbjct: 852  MILEYAI 858

>KLLA0F24838g complement(2309842..2313030) similar to sgd|S0005831
            Saccharomyces cerevisiae YOR304w ISW2, hypothetical start
          Length = 1062

 Score =  268 bits (684), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 188/549 (34%), Positives = 279/549 (50%), Gaps = 86/549 (15%)

Query: 524  LKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQ-NNEPGPHLVVVPSS 582
            L+DYQ  G+NWL  L+ + LS ILADEMGLGKT Q I+FL YL+      GP++V+VP S
Sbjct: 136  LRDYQVYGLNWLISLHESKLSGILADEMGLGKTLQSISFLGYLRYIKGIEGPYIVIVPKS 195

Query: 583  TLENWLREFNKFCPDLKIEPYYGSQQERAELRD--ILEDNDGQYDVIVTTYNLASGNKYD 640
            TL+NW REF K+ P++K     G +  R EL +  IL  N   +DV++T+Y +    K  
Sbjct: 196  TLDNWQREFAKWTPEVKTVILQGDKDFRKELIETKILTCN---FDVLITSYEMVLKEKLT 252

Query: 641  VSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEF 700
               LK   +  ++ DE H +KN  S     +    +  RLL+TGTPLQNNL EL +LL F
Sbjct: 253  ---LKRFAWEYILIDEAHRIKNEQSALSQVIRLFYSKNRLLITGTPLQNNLHELWALLNF 309

Query: 701  IMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARA-KTMMKPFILRRRKDQVL 759
            ++P++F          F+Q  +  D          QE + +   ++++PF+LRR K +V 
Sbjct: 310  LLPDVF-GDSEVFDEWFQQNGKEED----------QEVVVQQLHSVLQPFLLRRVKSEVE 358

Query: 760  KHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXXPTKKNGGAQI 819
            K L  K     Y  M+D+Q   Y   +++ +D                    K+ G  ++
Sbjct: 359  KSLLPKKEINLYVGMTDMQIEWYKSLLEKDID-------------AVNGAVGKREGKTRL 405

Query: 820  SKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQEDMSYMNDFE 879
              N++M LRK   HP LF                    E AE G      E + +     
Sbjct: 406  L-NIVMQLRKCCNHPYLF--------------------EGAEPGPPYTTDEHLVF----- 439

Query: 880  LHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFSLFTQMLDILE 939
                                   NSGK+  L K+L+   E +  +VL+FS  +++LDILE
Sbjct: 440  -----------------------NSGKMIVLDKLLKKKKE-QGSRVLIFSQMSRLLDILE 475

Query: 940  MALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIP-VFILSTKAGGFGINLVCANNVII 998
                     + R+DGST  ++R   ID+++  ++   +F+L+T+AGG GINLV A+ V++
Sbjct: 476  DYCYFRGYEYCRIDGSTSHDERVEAIDEYNKPNSEKFIFLLTTRAGGLGINLVTADTVVL 535

Query: 999  FDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLALDT-YISEDD 1057
            +D  +NP  D QA DR+HR+GQ K V +   +T N+IEEK+++ A  KL LD   I +  
Sbjct: 536  YDSDWNPQADLQAMDRAHRIGQKKQVFVYRFVTENAIEEKVIERAAQKLRLDQLVIQQGT 595

Query: 1058 SKAAEALEN 1066
             K   AL N
Sbjct: 596  GKKTSALTN 604

>Kwal_56.23442
          Length = 1435

 Score =  269 bits (687), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 185/547 (33%), Positives = 274/547 (50%), Gaps = 96/547 (17%)

Query: 524  LKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYL----KQNNEPGPHLVVV 579
            L+D+Q TGINW+  L+  N + ILADEMGLGKT Q +AF+S+L    +QN   GPHLVVV
Sbjct: 357  LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIYARRQN---GPHLVVV 413

Query: 580  PSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRD--------ILEDNDGQYDVIVTTY 631
            P ST+  W   F K+ PDL    + G+Q+ R  +R+               +++V++TTY
Sbjct: 414  PLSTMPAWQETFEKWAPDLNCIYFVGNQKSRDAIREGEFFTNPQAKTKKHAKFNVLLTTY 473

Query: 632  NLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNL 691
                 ++ ++  +K   +  +  DE H LKN+ S  +  L   +   RLL+TGTPLQNN+
Sbjct: 474  EYILKDRAELGAIK---WQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNI 530

Query: 692  KELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDY-NPLLAQEAIAR-AKTMMKPF 749
            KEL +L+ F+MP  F                T D   D+ N    QE   R   + ++PF
Sbjct: 531  KELAALVNFLMPGRF----------------TIDQEIDFENQDAEQETYIRDLHSRLQPF 574

Query: 750  ILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXX 809
            ILRR K  V K LP K  +I   E+SDVQ   Y          K +L             
Sbjct: 575  ILRRLKKDVEKSLPSKTERILRVELSDVQTDYY----------KNILTKNYSAL------ 618

Query: 810  PTKKNGGAQIS-KNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYI 868
             +  + GA  S  N++  L+KA+ HP LF                               
Sbjct: 619  -SAGSKGAHFSLLNIMNELKKASNHPYLF------------------------------- 646

Query: 869  QEDMSYMNDFELHRLCTRFPDS-LAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLV 927
                    D    R+  +F D  +++  +     M+SGK+  L ++L   ++    +VL+
Sbjct: 647  --------DMAEDRVLAKFGDGRMSRENILRGLIMSSGKMVLLDQLLTR-LKKDGHRVLI 697

Query: 928  FSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIP-VFILSTKAGGF 986
            FS   +MLDIL   L    I + RLDG+     R+  ID F+  D+   VF+LST+AGG 
Sbjct: 698  FSQMVRMLDILGDYLNIKGITYQRLDGTVPSAQRRISIDHFNAPDSNDFVFLLSTRAGGL 757

Query: 987  GINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNK 1046
            GINL+ A+ VIIFD  +NP  D QA  R+HR+GQ   V +   ++++++EE++L+ A+ K
Sbjct: 758  GINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKK 817

Query: 1047 LALDTYI 1053
            + L+  I
Sbjct: 818  MILEYAI 824

>YER164W (CHD1) [1592] chr5 (505387..509793) Protein involved in
            ATP-dependent nucleosome remodeling activity, member of
            the Chromodomain-Helicase-DNA-binding (CHD) family [4407
            bp, 1468 aa]
          Length = 1468

 Score =  266 bits (681), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 183/545 (33%), Positives = 274/545 (50%), Gaps = 92/545 (16%)

Query: 524  LKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYL----KQNNEPGPHLVVV 579
            L+D+Q TGINW+  L+    + ILADEMGLGKT Q +AF+S+L    +QN   GPH++VV
Sbjct: 376  LRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQN---GPHIIVV 432

Query: 580  PSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDI--------LEDNDGQYDVIVTTY 631
            P ST+  WL  F K+ PDL    Y G+Q+ R  +R+               +++V++TTY
Sbjct: 433  PLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTY 492

Query: 632  NLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNL 691
                 ++ ++  +K   +  +  DE H LKN+ S  +  L   +   R+L+TGTPLQNN+
Sbjct: 493  EYILKDRAELGSIK---WQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNI 549

Query: 692  KELMSLLEFIMPNLF-ISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMMKPFI 750
            KEL +L+ F+MP  F I ++ D              N+D      +E I      ++PFI
Sbjct: 550  KELAALVNFLMPGRFTIDQEIDF------------ENQDEE---QEEYIHDLHRRIQPFI 594

Query: 751  LRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXXP 810
            LRR K  V K LP K  +I   E+SDVQ   Y          K +L              
Sbjct: 595  LRRLKKDVEKSLPSKTERILRVELSDVQTEYY----------KNILTKNYSALTAGAK-- 642

Query: 811  TKKNGGAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQE 870
                GG     N++  L+KA+ HP LF                                 
Sbjct: 643  ----GGHFSLLNIMNELKKASNHPYLF--------------------------------- 665

Query: 871  DMSYMNDFELHRLCTRFPDS-LAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFS 929
                  D    R+  +F D  + +  +     M+SGK+  L ++L   ++    +VL+FS
Sbjct: 666  ------DNAEERVLQKFGDGKMTRENVLRGLIMSSGKMVLLDQLLTR-LKKDGHRVLIFS 718

Query: 930  LFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIP-VFILSTKAGGFGI 988
               +MLDIL   L+   INF RLDG+     R+  ID F+  D+   VF+LST+AGG GI
Sbjct: 719  QMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGI 778

Query: 989  NLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLA 1048
            NL+ A+ V+IFD  +NP  D QA  R+HR+GQ   V +  L++++++EE++L+ A+ K+ 
Sbjct: 779  NLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMI 838

Query: 1049 LDTYI 1053
            L+  I
Sbjct: 839  LEYAI 843

>KLLA0C17578g 1547890..1552467 similar to sp|P32657 Saccharomyces
            cerevisiae YER164w CHD1 transcriptional regulator, start
            by similarity
          Length = 1525

 Score =  266 bits (680), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 184/545 (33%), Positives = 273/545 (50%), Gaps = 92/545 (16%)

Query: 524  LKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYL----KQNNEPGPHLVVV 579
            L+D+Q TGINW+  L+  N + ILADEMGLGKT Q ++F+S+L    +QN   GPHLVVV
Sbjct: 388  LRDFQLTGINWMAFLWSKNDNGILADEMGLGKTVQTVSFISWLIYARRQN---GPHLVVV 444

Query: 580  PSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQ--------YDVIVTTY 631
            P ST+  W   F+K+ P L    Y G+Q  R  ++D     + Q        ++V++TTY
Sbjct: 445  PLSTMPAWQETFDKWAPGLNCVYYMGNQASRDLIQDYEFYTNPQAKGKKHLKFNVLLTTY 504

Query: 632  NLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNL 691
                 ++  +  +K   +  +  DE H LKN+ S  +  L   +   RLL+TGTPLQNN+
Sbjct: 505  EYILKDRSTLGSIK---WQFLAVDEAHRLKNAESSLYESLNSFKVANRLLITGTPLQNNI 561

Query: 692  KELMSLLEFIMPNLF-ISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMMKPFI 750
            KEL +L+ F+MP  F I ++ D      Q+               +E I      ++PFI
Sbjct: 562  KELAALVNFLMPGRFTIDQEIDFENQDEQQ---------------EEYIRDLHKRLQPFI 606

Query: 751  LRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXXP 810
            LRR K  V K LP K  +I   E+SDVQ   Y          K +L              
Sbjct: 607  LRRLKKDVEKSLPSKTERILRVELSDVQTEYY----------KNILTKNYSALTSGIK-- 654

Query: 811  TKKNGGAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQE 870
                GG     N++  L+KA+ HP LF                                 
Sbjct: 655  ----GGHVSLLNVMNELKKASNHPYLF--------------------------------- 677

Query: 871  DMSYMNDFELHRLCTRFPDS-LAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFS 929
                  D    R+ ++F D   ++  +     M+SGK+  L K+L   ++    +VL+FS
Sbjct: 678  ------DNAEERVLSKFGDGHKSRENILRGLIMSSGKMVLLDKLLTR-LKKDGHRVLIFS 730

Query: 930  LFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIP-VFILSTKAGGFGI 988
               ++LDIL   L+   INF RLDG+     R+  ID F+ +D+   VF+LST+AGG GI
Sbjct: 731  QMVRILDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNAEDSNDFVFLLSTRAGGLGI 790

Query: 989  NLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLA 1048
            NL+ A+ VIIFD  +NP  D QA  R+HR+GQ   V +   ++++++EE++L+ A+ K+ 
Sbjct: 791  NLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKKMI 850

Query: 1049 LDTYI 1053
            L+  I
Sbjct: 851  LEYAI 855

>YIL126W (STH1) [2550] chr9 (117992..122071) Component of abundant
            chromatin remodeling complex (RSC), involved in the
            response to DNA damage, DNA helicase of the Snf2p family,
            has a bromodomain [4080 bp, 1359 aa]
          Length = 1359

 Score =  264 bits (675), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 185/532 (34%), Positives = 272/532 (51%), Gaps = 68/532 (12%)

Query: 523  TLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQ-NNEPGPHLVVVPS 581
            TLK+YQ  G+ W+  LY N+L+ ILADEMGLGKT Q I+ ++YL +   + GP LV+VP 
Sbjct: 469  TLKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEVKKDIGPFLVIVPL 528

Query: 582  STLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQYDVIVTTYNLASGNKYDV 641
            ST+ NW  EF K+ P L    Y G+  +R  L+  +    G +DV++TTY     +K   
Sbjct: 529  STITNWTLEFEKWAPSLNTIIYKGTPNQRHSLQHQI--RVGNFDVLLTTYEYIIKDK--- 583

Query: 642  SFLKNRGFNVVVYDEGHMLKNSMSE-RFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEF 700
            S L    +  ++ DEGH +KN+ S+  FT         RL+LTGTPLQNNL EL +LL F
Sbjct: 584  SLLSKHDWAHMIIDEGHRMKNAQSKLSFTISHYYRTRNRLILTGTPLQNNLPELWALLNF 643

Query: 701  IMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIA-RAKTMMKPFILRRRKDQVL 759
            ++P +F S K          A T    K          I  R   +++PF+LRR K +V 
Sbjct: 644  VLPKIFNSAKTFEDWFNTPFANTGTQEKLELTEEETLLIIRRLHKVLRPFLLRRLKKEVE 703

Query: 760  KHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXXPTKKNGGAQI 819
            K LP K  K+  C++S +Q+ +Y + ++    H  +                   GG + 
Sbjct: 704  KDLPDKVEKVIKCKLSGLQQQLYQQMLK----HNALFVGAGTEGAT--------KGGIKG 751

Query: 820  SKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQEDMSYMNDFE 879
              N IM LRK   HP +F         D++   +         GN + +           
Sbjct: 752  LNNKIMQLRKICNHPFVF---------DEVEGVV-----NPSRGNSDLL----------- 786

Query: 880  LHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFSLFTQMLDILE 939
                          F++       +GK   L ++L    +    +VL+F   TQ++DI+E
Sbjct: 787  --------------FRV-------AGKFELLDRVLPK-FKASGHRVLMFFQMTQVMDIME 824

Query: 940  MALTTLNINFLRLDGSTQVNDRQALIDKFHDDDT-IPVFILSTKAGGFGINLVCANNVII 998
              L   ++ ++RLDGST+  +R  +++ F+  D+    F+LST+AGG G+NL  A+ VII
Sbjct: 825  DFLRMKDLKYMRLDGSTKTEERTEMLNAFNAPDSDYFCFLLSTRAGGLGLNLQTADTVII 884

Query: 999  FDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLALD 1050
            FD  +NPH D QA DR+HR+GQ   V I  LIT +S+EE IL+ A  KL +D
Sbjct: 885  FDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDID 936

>AGR123C [4434] [Homologous to ScYER164W (CHD1) - SH] (980963..985231)
            [4269 bp, 1422 aa]
          Length = 1422

 Score =  261 bits (667), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 186/547 (34%), Positives = 277/547 (50%), Gaps = 96/547 (17%)

Query: 524  LKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYL----KQNNEPGPHLVVV 579
            L+D+Q TGINW+  L+  + + ILADEMGLGKT Q ++F+S+L    +QN   GPHLVVV
Sbjct: 356  LRDFQLTGINWMAFLWSKSDNGILADEMGLGKTVQTVSFISWLIFARRQN---GPHLVVV 412

Query: 580  PSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRD--------ILEDNDGQYDVIVTTY 631
            P ST+  W   F K+ P+L    Y G+Q+ R  +R+             + +++V++TTY
Sbjct: 413  PLSTMPAWQETFEKWAPELNCVYYMGNQKSRDVIREYEFYTNPHTKGKKNIKFNVLLTTY 472

Query: 632  NLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNL 691
                 ++ ++  +K   +  +  DE H LKN+ S  +  L   +   R+L+TGTPLQNN+
Sbjct: 473  EYILKDRLELGAIK---WQFLAVDEAHRLKNAESSLYESLSSFKVANRMLITGTPLQNNI 529

Query: 692  KELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDY-NPLLAQEAIAR-AKTMMKPF 749
            KEL +L+ F+MP  F                T D   D+ N    QE   R     ++P+
Sbjct: 530  KELAALVNFLMPGKF----------------TIDQEIDFENQDEKQENYIRDLHKRLQPY 573

Query: 750  ILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXX 809
            ILRR K  V K LP K  +I   E+SDVQ   Y          K +L             
Sbjct: 574  ILRRLKKDVEKSLPSKTERILRVELSDVQTEYY----------KNILTKNYNAL------ 617

Query: 810  PTKKNGGAQIS-KNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYI 868
             T    G   S  N++  L+KA+ HP LF                         GN E  
Sbjct: 618  -TAGTKGTHFSLLNIMNELKKASNHPYLF-------------------------GNAE-- 649

Query: 869  QEDMSYMNDFELHRLCTRFPDS-LAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLV 927
                        +R+  +F D   ++  +     M+SGK+  L K+L   ++    +VL+
Sbjct: 650  ------------NRVLAKFGDGNRSRENILRGLIMSSGKMVLLDKLLTR-LKKDGHRVLI 696

Query: 928  FSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIP-VFILSTKAGGF 986
            FS   +MLDIL   L+   INF RLDG+   + R+  ID F+  D+   VF+LST+AGG 
Sbjct: 697  FSQMVRMLDILGDYLSIKGINFQRLDGTVPSSQRRISIDHFNAPDSNDFVFLLSTRAGGL 756

Query: 987  GINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNK 1046
            GINL+ A+ VIIFD  +NP  D QA  R+HR+GQ   V +   ++++++EE++L+ A+ K
Sbjct: 757  GINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVEEEVLERARKK 816

Query: 1047 LALDTYI 1053
            + L+  I
Sbjct: 817  MILEYAI 823

>CAGL0H05533g 538045..543759 highly similar to sp|P32333 Saccharomyces
            cerevisiae YPL082c MOT1, start by similarity
          Length = 1904

 Score =  247 bits (631), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 180/578 (31%), Positives = 290/578 (50%), Gaps = 99/578 (17%)

Query: 523  TLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLS---YLKQNN--------- 570
            TL+ YQQ GINWL  L + +L  IL D+MGLGKT Q I  ++   YL+Q           
Sbjct: 1312 TLRKYQQDGINWLAFLNKYHLHGILCDDMGLGKTLQTICIIASDQYLRQEEYKLSGNIEC 1371

Query: 571  EPGPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQYDVIVTT 630
             P P L+V P S   +W  EF ++ P LKI  Y G    R  LR  L       D+I+T+
Sbjct: 1372 RPLPSLIVCPPSLTGHWENEFEQYSPFLKIVVYAGGPSVRQPLRKQL----SSADIIITS 1427

Query: 631  YNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNN 690
            Y++A   + D+  + +  +N  V DEGH++KN+ S+    +  I+AN RL+LTGTP+QNN
Sbjct: 1428 YDVA---RNDLDTISSYDYNYCVLDEGHLIKNAQSKLAKAVKLIKANHRLILTGTPIQNN 1484

Query: 691  LKELMSLLEFIMPNLFISKKNDLSAVFRQR----------ARTSDSNKDYNPLLAQEAIA 740
            + EL SL +F+MP    ++K+     F++R          ++TS   ++   L A EA+ 
Sbjct: 1485 VVELWSLFDFLMPGFLGTEKS-----FQERFAKPIAASRNSKTSSKEQEAGAL-ALEALH 1538

Query: 741  RAKTMMKPFILRRRKDQVLKHLPHKHSKIEYCEMSDV-----------QRTIYNREIQQV 789
            +    + PF+LRR K+ VL  LP K  +  YCE+SD+           Q+ +  ++IQ  
Sbjct: 1539 K---QVLPFMLRRLKEDVLSDLPPKIIQDYYCELSDLQKQLYEDFAKKQKNVVEKDIQNT 1595

Query: 790  --LDHKRMLXXXXXXXXXXXXXPTKKNGGAQISKNLIMSLRKAALHPLLFRHHYDDVMLD 847
              +D K+ +                           +  +RK   HP L   +       
Sbjct: 1596 ADVDSKQHIFQA------------------------LQYMRKLCNHPALVLSN------- 1624

Query: 848  KMSRAILKEPEYAENGNKEYIQEDMSYMNDFELHRLCTRFPDSLAKFQLKNDEWMNSGKI 907
                     P+  +  N  Y+++    ++D       T     L  F+    E     K+
Sbjct: 1625 -------DHPQLKQIQN--YLKQTGCDLHDIRNAPKLTALRTLL--FECGIGEADMDKKV 1673

Query: 908  TALRKILENIIEHKKEKVLVFSLFTQMLDILEMAL---TTLNINFLRLDGSTQVNDRQAL 964
            T  + +  ++I   + + L+F     MLD++E  L      +++++RLDGS    DRQ +
Sbjct: 1674 TGEQLLTGSVIS--QHRALIFCQLKDMLDMIENDLFKRYMPSVSYMRLDGSVDPRDRQKV 1731

Query: 965  IDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTV 1024
            + KF++D +I   +L+TK GG G+NL  A+ VI  +  +NP +D QA DR+HR+GQ K V
Sbjct: 1732 VRKFNEDPSIDCLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQAMDRAHRLGQKKVV 1791

Query: 1025 HITTLITRNSIEEKILQLAKNKLAL-DTYISEDDSKAA 1061
            ++  ++T+ ++EEKI+ L K K+ +  T +++ +S  A
Sbjct: 1792 NVYRIVTKGTLEEKIMGLQKFKMNIASTVVNQQNSGLA 1829

>AEL256C [2250] [Homologous to ScYPL082C (MOT1) - SH] (156109..161709)
            [5601 bp, 1866 aa]
          Length = 1866

 Score =  240 bits (612), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 181/580 (31%), Positives = 279/580 (48%), Gaps = 121/580 (20%)

Query: 523  TLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLS---YLKQNN--------- 570
            TL+ YQQ GINWL  L   +L  IL D+MGLGKT Q I  ++   YL+Q +         
Sbjct: 1278 TLRKYQQEGINWLAFLNHYHLHGILCDDMGLGKTLQTICIIASDQYLRQEDYKTTKSVET 1337

Query: 571  EPGPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQYDVIVTT 630
             P P L+V P S   +W +EF ++ P L +  Y G    R  LR  L    G  D++VT+
Sbjct: 1338 RPLPSLIVCPPSLTGHWEQEFEQYAPFLTVLVYAGGPSTRYPLRGKL----GDADIVVTS 1393

Query: 631  YNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNN 690
            Y++A   + D+  +    +N  V DEGH++KNS S+    +  I AN RL+LTGTP+QNN
Sbjct: 1394 YDVA---RNDIDIISKHDYNYCVLDEGHIIKNSQSKLAKAVKSIRANHRLILTGTPIQNN 1450

Query: 691  LKELMSLLEFIMPNLFISKKNDLSAVFRQR----------ARTSDSNKDYNPLLAQEAIA 740
            + EL SL +F+MP    S+K      F++R          ++TS   ++   L A EA+ 
Sbjct: 1451 VVELWSLFDFLMPGFLGSEK-----AFQERFAKPIAASRNSKTSSKEQEAGAL-ALEALH 1504

Query: 741  RAKTMMKPFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXX 800
            +    + PF+LRR K+ V               +SD+   I      ++ D +R L    
Sbjct: 1505 K---QVLPFMLRRLKEDV---------------LSDLPPKIIQDYYCELSDLQRQLYKDF 1546

Query: 801  XXXXXXXXXPTKKNGGAQISKNLIMS----LRKAALHPLLFRHHYDDVMLDKMSRAILKE 856
                        +N     SKN I      +RK   HP L        +L K        
Sbjct: 1547 AKKQKNIVERDIENTMELESKNHIFQALQYMRKLCNHPSL--------VLSK------DH 1592

Query: 857  PEYAENGNKEYIQEDMSYMNDFELHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKIL-- 914
            P+Y  N  ++Y+ +        ++H +                   ++ K+ ALR +L  
Sbjct: 1593 PQY--NQVQDYLSQ-----TGMDIHDIA------------------HAPKLGALRNLLLE 1627

Query: 915  ------------------ENIIEHKKEKVLVFSLFTQMLDILEMAL---TTLNINFLRLD 953
                              EN+I   + + L+F     MLD++E  L      ++ ++RLD
Sbjct: 1628 CGIGVQDVDQNSISLPSSENVI--SQHRALIFCQLKDMLDMIENDLFKKYLPSVTYMRLD 1685

Query: 954  GSTQVNDRQALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAAD 1013
            GS +  DRQ ++ KF++D +I   +L+TK GG G+NL  A+ VI  +  +NP +D QA D
Sbjct: 1686 GSVESRDRQKVVRKFNEDPSIDCLLLTTKVGGLGLNLTGADTVIFIEHDWNPMNDLQAMD 1745

Query: 1014 RSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLALDTYI 1053
            R+HR+GQ K V++  +IT+ S+EEKI+ L K K+ + + +
Sbjct: 1746 RAHRLGQKKVVNVYRIITKGSLEEKIMGLQKFKMNIASTV 1785

>Kwal_14.1537
          Length = 842

 Score =  203 bits (517), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 167/548 (30%), Positives = 254/548 (46%), Gaps = 96/548 (17%)

Query: 540  RNNLSCILADEMGLGKTCQVIAFL-SYLKQNNEPGP----HLVVVPSSTLENWLREFNKF 594
            R    CI+ADEMGLGKT Q IA L + L+Q  +  P     ++V PSS + NW  E  K+
Sbjct: 354  RGAYGCIMADEMGLGKTLQCIALLWTLLRQGPQGKPTIDKCIIVCPSSLVNNWANEIVKW 413

Query: 595  CPD--LKIEPYYGSQQERAELRDILEDNDGQYDVIVTTYNLASGN--------------K 638
                 L   P  G +            N+G     V  + LA G               +
Sbjct: 414  LGKGTLASLPIDGKKSSL---------NNGTVAQAVRGWALARGRSVVKPVLIISYETLR 464

Query: 639  YDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLL 698
             +V  L N    +++ DEGH LKN+ S+ FT L  I    R++L+GTP+QN+L E  +LL
Sbjct: 465  RNVEHLNNCEIGLLLADEGHRLKNAESQTFTALDSINCPRRVILSGTPIQNDLSEYFALL 524

Query: 699  EFIMPNLFISKKNDLSAVFRQR-------ARTSDSNKDYNPLLAQEAIARAKTMMKPFIL 751
             F  P L  ++       FR+        +R +D+  D       E +    T++  FI+
Sbjct: 525  NFSNPGLLGTRSE-----FRRNFENPILLSRDADAT-DSEIAKGNEKLQALSTIVSKFII 578

Query: 752  RRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXXPT 811
            RR  D + K+LP K+  + +  +   QR++Y   ++   D K  +               
Sbjct: 579  RRTNDILSKYLPCKYEHVLFVNLKPFQRSVYELMLK-CRDVKLAV--------------- 622

Query: 812  KKNGGAQISKNL--IMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQ 869
                G   S+ L  I +L+K   HP L                 L+ PE  E G+++ I 
Sbjct: 623  --KDGTTPSQPLKHIGALKKLCNHPDL-----------------LQLPEDVE-GSEDVIP 662

Query: 870  EDMSYMNDFELHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFS 929
            ED  Y N             +L+K      +   SGK + L + L  I     +K+++ S
Sbjct: 663  ED--YRNS------------TLSKRGHAEVQTWYSGKFSILNRFLHKIKTESDDKIVIIS 708

Query: 930  LFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIP-VFILSTKAGGFGI 988
             +TQ LD++E    T +   +RLDG+  +N RQ L+D+F+D +    +F+LS+KAGG GI
Sbjct: 709  NYTQTLDVIERMCRTSSYPVVRLDGTMTINKRQKLVDRFNDVEGQEFIFLLSSKAGGCGI 768

Query: 989  NLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLA 1048
            NL+ AN +I+ D  +NP  D+QA  R  R GQ K   I   I   +IEEKI Q    K++
Sbjct: 769  NLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFICTGTIEEKIYQRQSMKMS 828

Query: 1049 LDTYISED 1056
            L + + ++
Sbjct: 829  LSSCVVDE 836

>AEL065C [2441] [Homologous to ScYJR035W (RAD26) - SH]
            (511520..514597) [3078 bp, 1025 aa]
          Length = 1025

 Score =  204 bits (520), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 169/601 (28%), Positives = 265/601 (44%), Gaps = 160/601 (26%)

Query: 513  QKPKLLSPDVTLKD--------------YQQTGINWLNLLYRNNLSCILADEMGLGKTCQ 558
            +KP    PD  L D              YQ+T + WL  L++ N   I+ DEMGLGKT Q
Sbjct: 238  EKPHPTLPDAKLYDDFKIPADIFDKLFSYQKTCVQWLYELHQQNCGGIVGDEMGLGKTIQ 297

Query: 559  VIAFLSYLKQNNE-PGPHLVVVPSSTLENWLREFNKFCP--------------------- 596
            +++FL+ L  + +  GP LVV P++ ++ W  EF  + P                     
Sbjct: 298  IVSFLASLHHSGKLKGPVLVVCPATVMKQWCSEFQTWWPPFRAVILHSIGAGMITRKKMT 357

Query: 597  --------------DLKIEPY--YGSQQERAELRDILED------NDGQYDVIVTTYNLA 634
                          +   E Y   G  +++ E R  +E       +DG   +++TTY   
Sbjct: 358  EEQLEELLMRDESNEFSYEQYANLGRTKKQLEARRGIESLVQKVVDDGH--ILITTY--- 412

Query: 635  SGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKEL 694
             G +     L +  ++  V DEGH ++N  +       ++    R++L+GTP+QNNL EL
Sbjct: 413  LGLQIHSDLLLHVNWDYAVLDEGHKIRNPDAGISLTCKRLRTPHRIILSGTPIQNNLTEL 472

Query: 695  MSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQ-----EAIARAKTMMKPF 749
             SL +FI P     K   L    +Q A   ++    N    Q     +     + ++ P+
Sbjct: 473  WSLFDFIFPG----KLGTLPVFQQQFANPINAGGYANATNIQVQTGYKCAVALRDLISPY 528

Query: 750  ILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXX 809
            +LRR K+ V K LP K+  + +C+M+  Q+  Y     Q L+ + M+             
Sbjct: 529  LLRRVKNDVAKDLPKKNEFVLFCKMTQFQKEKY----LQFLNSEDMIKI----------- 573

Query: 810  PTKKNGGAQISKNLIMSLRKAALHPLL----FRHHYDDVMLDKMSRAILKEPEYAENGNK 865
               KNG  Q+   + + LRK   HP L    FR H               EP + +    
Sbjct: 574  ---KNGRRQVLYGIDI-LRKICNHPDLLERDFRKH---------------EPSFGDP--- 611

Query: 866  EYIQEDMSYMNDFELHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKE-- 923
                                                  SGK+T ++++L   +  KK+  
Sbjct: 612  ------------------------------------RRSGKMTVIKQLL---LTWKKQGH 632

Query: 924  KVLVFSLFTQMLDILEMALT-----TLNINFLRLDGSTQVNDRQALIDKFHDDDTIPVFI 978
            K L+F+   QMLDILE  ++        + +LR+DG+T +  RQAL+D+F ++    +F+
Sbjct: 633  KALLFTQSRQMLDILEAYISHKDPELAGLQYLRMDGTTNIAHRQALVDRF-NNGPYHLFL 691

Query: 979  LSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEK 1038
            L+T+ GG G+NL  AN +IIFD  +NP  D QA +R+ R+GQ + V I  L+   SIEEK
Sbjct: 692  LTTRVGGLGVNLTGANRIIIFDPDWNPSTDLQARERAWRIGQKRDVTIYLLMVAGSIEEK 751

Query: 1039 I 1039
            I
Sbjct: 752  I 752

>KLLA0E22726g complement(2018248..2021349) similar to sp|P40352
            Saccharomyces cerevisiae YJR035w RAD26 DNA repair and
            recombination protein, start by similarity
          Length = 1033

 Score =  203 bits (517), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 162/576 (28%), Positives = 260/576 (45%), Gaps = 148/576 (25%)

Query: 527  YQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQNNE-PGPHLVVVPSSTLE 585
            YQ+T + WL  LY+     I+ DEMGLGKT Q+IAFL+ L  + +  GP LVV P++ ++
Sbjct: 268  YQKTCVQWLCELYQQGCGGIIGDEMGLGKTIQIIAFLATLHHSRKLNGPVLVVCPATVMK 327

Query: 586  NWLREFNKFCPDLK--------------------------IEPYYG-------------- 605
             W  EF+ + P  +                          +   YG              
Sbjct: 328  QWCNEFHTWWPPFRAVILHSIGAGMNKGTQIPEEELEKMLMTSNYGTFTYNDYEKKEKTR 387

Query: 606  -SQQERAELRDILEDNDGQYDVIVTTYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSM 664
             S + R  ++ +LE       +I+TTY    G +     L N  +   + DEGH ++N  
Sbjct: 388  TSLESRKSVKKLLEKVITDGHIIITTY---VGLRLHSEALLNVRWGYAILDEGHKIRNPD 444

Query: 665  SERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTS 724
            S+      +++   R++L+GTP+QNNL EL SL +F+ P      K     VF+Q+    
Sbjct: 445  SDISLTCKQLKTQNRIILSGTPIQNNLTELWSLFDFVYPG-----KLGTLPVFQQQFANP 499

Query: 725  DSNKDYNPLLAQEAIARAKT----------MMKPFILRRRKDQVLKHLPHKHSKIEYCEM 774
             +   Y    A  +  + KT          ++ P++LRR K  V K LP K+  + +C++
Sbjct: 500  INMGGY----ANASNIQVKTGYKCAVALRDLISPYLLRRVKSDVAKDLPKKNEMVLFCKL 555

Query: 775  SDVQRT-----IYNREIQQVLDHKRMLXXXXXXXXXXXXXPTKKNGGAQISKNLIMSLRK 829
            +  Q++     +++ E+ ++   KR +                   G  I       LRK
Sbjct: 556  TQYQKSKYLEFLHSDELMKIRKGKRQVLY-----------------GIDI-------LRK 591

Query: 830  AALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQEDMSYMNDFELHRLCTRFPD 889
               HP L            + R  + + E A+ GN                         
Sbjct: 592  ICNHPDLL----------DLKRKKMNDYEDADYGNP------------------------ 617

Query: 890  SLAKFQLKNDEWMNSGKITALRKILENIIEHKK-EKVLVFSLFTQMLDILEMALT----- 943
                          SGK+  ++++L  ++ H +  K L+F+   QMLDIL+  ++     
Sbjct: 618  ------------ARSGKMQVVKQLL--LLWHSQGHKTLLFTQSRQMLDILQEFISYKDPE 663

Query: 944  TLNINFLRLDGSTQVNDRQALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSF 1003
              ++ FLR+DG+T +  RQ+L+DKF +++   VF+L+T+ GG GINL  AN +IIFD  +
Sbjct: 664  LSDLKFLRMDGTTNIGSRQSLVDKF-NNEPYDVFLLTTRVGGLGINLTGANRIIIFDPDW 722

Query: 1004 NPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKI 1039
            NP  D QA +R+ R+GQ + V I  L+   SIEEKI
Sbjct: 723  NPSTDMQARERAWRIGQKREVTIYRLMIAGSIEEKI 758

>Scas_646.3*
          Length = 1456

 Score =  204 bits (519), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 128/328 (39%), Positives = 174/328 (53%), Gaps = 36/328 (10%)

Query: 523 TLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYL---KQNNEPGPHLVVV 579
           TL+ YQ+ G+NWL  L+ NN + ILADEMGLGKT Q I+ L+YL   KQN   GPHL+VV
Sbjct: 643 TLRTYQKQGLNWLASLFNNNTNGILADEMGLGKTIQTISLLAYLACEKQN--WGPHLIVV 700

Query: 580 PSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQYDVIVTTYNLASGNKY 639
           P+S L NW  EF +FCP LK+  YYGS Q+R E R      D  + V + +Y L   +++
Sbjct: 701 PTSVLLNWEMEFKRFCPGLKVLTYYGSPQQRKEKRKGWNKPDA-FHVCIVSYQLVVQDQH 759

Query: 640 DVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLE 699
             SF K + +  +V DE H +KN  S R+  L+      RLL+TGTPLQNNL EL SLL 
Sbjct: 760 --SF-KRKKWQYMVLDEAHNIKNFRSTRWQALLNFNTRRRLLVTGTPLQNNLAELWSLLY 816

Query: 700 FIMPNLFISKKN-----DLSAVFRQRARTSDSNKDYNPLLAQEA-----IARAKTMMKPF 749
           F+MP   I  K      DL A  +   R  D   +      Q+A     +++   +++P+
Sbjct: 817 FLMPQTVIDGKKVSGFADLDAFQQWFGRPVDKLIETGAGYQQDAETKKTVSKLHQVLRPY 876

Query: 750 ILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXX 809
           +LRR K  V K +P K+  I YC +S  QR +Y+  + +                     
Sbjct: 877 LLRRLKADVEKQMPAKYEHIVYCRLSKRQRFLYDDFMSR-----------------SQTK 919

Query: 810 PTKKNGGAQISKNLIMSLRKAALHPLLF 837
            T  +G      N +M LRK   HP LF
Sbjct: 920 ATLASGNFMSIVNCLMQLRKVCNHPDLF 947

 Score =  137 bits (344), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 127/217 (58%), Gaps = 29/217 (13%)

Query: 842  DDVMLDKMSRAILKEPEYAENGNKEYIQEDMSYMNDFELHRLCTR----FPD-SLAKFQL 896
            DD +LD+ +++ L             IQE     N F  H+L T+    FPD SL ++  
Sbjct: 1144 DDSLLDQAAKSTL-------------IQELHEVDNPF--HQLQTKLTIAFPDKSLLQY-- 1186

Query: 897  KNDEWMNSGKITALRKILENIIEHKKEKVLVFSLFTQMLDILEMALTTLNINFLRLDGST 956
                  + GK+  L K+L+++ ++   + L+F+  T++LD+LE  L      ++RLDG+T
Sbjct: 1187 ------DCGKLQKLAKLLQDLKDNG-HRALIFTQMTKVLDVLERFLNYHGYIYMRLDGAT 1239

Query: 957  QVNDRQALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSH 1016
            +V DRQ L ++F++D  + VFILS+++GG GINL  A+ VI +D  +NP  DKQ  DR H
Sbjct: 1240 KVEDRQILTERFNNDPRVTVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCH 1299

Query: 1017 RVGQTKTVHITTLITRNSIEEKILQLAKNKLALDTYI 1053
            R+GQT+ VHI   ++ ++IE  IL+ A  K  LD  +
Sbjct: 1300 RIGQTRDVHIYRFVSEHTIESNILKKANQKRQLDNVV 1336

>Scas_668.18
          Length = 875

 Score =  200 bits (509), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 159/543 (29%), Positives = 251/543 (46%), Gaps = 93/543 (17%)

Query: 540  RNNLSCILADEMGLGKTCQVIAFLSYLKQNNEPGPHLV-----VVPSSTLENWLREFNKF 594
            R    CI+ADEMGLGKT Q IA +  L +    G  L+     V PSS + NW  E  K+
Sbjct: 303  RGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELVKW 362

Query: 595  CPDLKIEPYYGSQQERAELRDILEDNDGQYDVIVTTYNLASGN--------------KYD 640
                 + P     ++ +     L   +      V ++  A+G               + +
Sbjct: 363  LGPGTLSPLAVDGKKSS-----LASGNSTVAEAVHSWAQATGRNIVKPVLIISYETLRRN 417

Query: 641  VSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEF 700
            V  L+N    +++ DEGH LKN  S  FT L  I    R++L+GTP+QN+L E  +LL F
Sbjct: 418  VDQLRNCDVGLMLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNF 477

Query: 701  IMPNLFISKKNDLSAVFRQ-------RARTSDSNKDYNPLLAQEAIARAKTMMKPFILRR 753
              P L  ++       FR+       R+R +DS  D      +E + +  T++  FI+RR
Sbjct: 478  SNPGLLGTRSE-----FRKNFELPILRSRDADST-DEEITKGEEQLQKLSTIVSKFIIRR 531

Query: 754  RKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXXPTKK 813
              D + K+LP K+  + +  +   Q+ +Y+R ++   D  +M+               K 
Sbjct: 532  TNDILSKYLPCKYEHVIFVNLKPFQKDVYHRLLKS-RDVNKMV---------------KG 575

Query: 814  NGGAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQEDMS 873
             GG Q  K  I  L+K   HP L                               + E++ 
Sbjct: 576  VGGTQPLK-AIGVLKKLCNHPNLIN-----------------------------LDEEID 605

Query: 874  YMNDFELHRLCTRFPD--SLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFSLF 931
              +D E+       PD  ++   + ++ +   SGK   L + L  I     +K+++ S +
Sbjct: 606  DFDDLEI-------PDEYNMQGSKSRDVQPQFSGKFAILERFLHKIKTESDDKIVLISNY 658

Query: 932  TQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIP-VFILSTKAGGFGINL 990
            TQ LD++E      + + +RLDG+  +N RQ L+D+F+D +    +F+LS+KAGG GINL
Sbjct: 659  TQTLDLIEKMCRNKHYSSVRLDGTMTINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINL 718

Query: 991  VCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLALD 1050
            + AN +I+ D  +NP  D+QA  R  R GQ K   I   I+  SIEEKI Q    K++L 
Sbjct: 719  IGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKIYQRQSMKMSLS 778

Query: 1051 TYI 1053
            + +
Sbjct: 779  SCV 781

>CAGL0I04224g complement(369858..372686) highly similar to sp|P32863
            Saccharomyces cerevisiae YGL163c RAD54, start by
            similarity
          Length = 942

 Score =  201 bits (511), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 159/548 (29%), Positives = 257/548 (46%), Gaps = 103/548 (18%)

Query: 540  RNNLSCILADEMGLGKTCQVIAFLSYLKQNNEPGPHLV-----VVPSSTLENWLREFNKF 594
            R    CI+ADEMGLGKT Q IA +  L +    G  L+     V PSS + NW  E  K+
Sbjct: 370  RGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKW 429

Query: 595  CPDLKIEPYYGSQQE------------------RAELRDILEDNDGQYDVIVTTYNLASG 636
                 + P     ++                  +A+ R+I++       V++ +Y+    
Sbjct: 430  LGPNTLSPLAVDGKKSSLASGATSVAEAIKNWAQAQGRNIVKP------VLIISYDTLRR 483

Query: 637  NKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMS 696
            N   V  L+N    +++ DEGH LKN  S  FT L  I    R++L+GTP+QN+L E  +
Sbjct: 484  N---VKQLQNTEVGLLLADEGHRLKNGDSLTFTALDSINCPRRVILSGTPIQNDLSEYFA 540

Query: 697  LLEFIMPNLFISKKNDLSAVFR---QRARTSDSNKDYNPLLAQEAIARAKTMMKPFILRR 753
            LL F  P L +  +N+    F     R+R +D+  D +    ++ +     ++  FI+RR
Sbjct: 541  LLNFSNPGL-LGTRNEFRRNFEIPILRSRDADAT-DNDVKSGEQKLQLLSNIVSKFIIRR 598

Query: 754  RKDQVLKHLPHKHSKIEYCEMSDVQRTIYN-----REIQQVLDHKRMLXXXXXXXXXXXX 808
              D + K+LP K+  + +  ++  Q+ +YN     R+I++V+                  
Sbjct: 599  TNDILSKYLPCKYEHVIFVNLTPFQKQVYNMLIKSRDIKKVV------------------ 640

Query: 809  XPTKKNGGAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYI 868
               K +GG+Q  K  I  L+K   HP L +                             +
Sbjct: 641  ---KGDGGSQPLK-AIGVLKKLCNHPDLIK-----------------------------L 667

Query: 869  QEDMSYMNDFELHRLCTRFPD--SLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVL 926
             E++   ND ++       PD  S+   + ++ +   SGK   L + L  I     +K++
Sbjct: 668  DEELDNYNDLDI-------PDDYSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIV 720

Query: 927  VFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIP-VFILSTKAGG 985
            + S +TQ LD++E      +   +RLDG+  +N RQ L+D+F+D +    +F+LS+KAGG
Sbjct: 721  LISNYTQTLDLIERMCRNRHYASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGG 780

Query: 986  FGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKN 1045
             GINL+ AN +I+ D  +NP  D+QA  R  R GQ K   I   I+  +IEEKI Q    
Sbjct: 781  CGINLIGANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSM 840

Query: 1046 KLALDTYI 1053
            K++L + +
Sbjct: 841  KMSLSSCV 848

>CAGL0E05038g 488549..493003 similar to sp|P53115 Saccharomyces
            cerevisiae YGL150c INO80, hypothetical start
          Length = 1484

 Score =  201 bits (510), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 124/335 (37%), Positives = 183/335 (54%), Gaps = 26/335 (7%)

Query: 513  QKPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQN-NE 571
            ++PK+L+   TLK+YQ  G+NWL  LY   ++ ILADEMGLGKT Q I+ L++L ++ N 
Sbjct: 713  EQPKMLA--CTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLAEHHNI 770

Query: 572  PGPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQYD------ 625
             GP LVV P+STL NW+ E +KF P  KI PY+GS  +R  LR   +  + +Y       
Sbjct: 771  WGPFLVVTPASTLHNWVNEISKFVPQFKILPYWGSANDRKVLRKFWDRKNLRYSEKSPFH 830

Query: 626  VIVTTYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGT 685
            V++T+Y +      D S+L+   +  ++ DE   +K+S S R+  L+      RLLLTGT
Sbjct: 831  VMITSYQMVVA---DASYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGT 887

Query: 686  PLQNNLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTM 745
            P+QNN++EL +LL FIMP+LF S  ++ +  F   +R  +S+ + N  L Q+ + R   +
Sbjct: 888  PIQNNMQELWALLHFIMPSLFDS-HDEFNEWF---SRDIESHAEGNSSLNQQQLRRLHMI 943

Query: 746  MKPFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXX 805
            +KPF+LRR K  V   L  K      C+++  Q  +Y     QVL  K  +         
Sbjct: 944  LKPFMLRRIKKNVQSELGDKIEIDVMCDLTQRQTKLY-----QVL--KSQMSSNYDAIEN 996

Query: 806  XXXXPTKKNGGAQISK---NLIMSLRKAALHPLLF 837
                 +   GG    +   N +M  RK   HP LF
Sbjct: 997  AAAEGSDIAGGGNSDQSIINAVMQFRKVCNHPDLF 1031

 Score =  123 bits (308), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 98/152 (64%), Gaps = 2/152 (1%)

Query: 910  LRKILENIIEHKK--EKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDK 967
            L+K+ E ++E KK   +VL++   T+M+D++E  LT    N +RLDGS+++ DR+ L+  
Sbjct: 1297 LKKLDELLVELKKNDHRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRRDLVHD 1356

Query: 968  FHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHIT 1027
            +  +  I +F+LST+AGG GINL  A+ VI +D  +NP  D QA DR+HR+GQTK V + 
Sbjct: 1357 WQTNPEIFIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTKQVTVY 1416

Query: 1028 TLITRNSIEEKILQLAKNKLALDTYISEDDSK 1059
             L+ R +IEE++   AK K  +   + E  +K
Sbjct: 1417 RLLVRGTIEERMRDRAKQKEQVQQVVMEGKTK 1448

>Kwal_55.20143
          Length = 1494

 Score =  200 bits (509), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 126/334 (37%), Positives = 170/334 (50%), Gaps = 34/334 (10%)

Query: 515 PKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLK-QNNEPG 573
           P LL    TL+ YQ+ G+NWL  LY NN + ILADEMGLGKT Q I+ L+YL  + +  G
Sbjct: 664 PSLLRG--TLRIYQKQGLNWLASLYNNNTNGILADEMGLGKTIQTISLLAYLACEKHNWG 721

Query: 574 PHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQYDVIVTTYNL 633
           PHL++VP+S L NW  EF +F P  K+  YYGS Q+R E R      D  + V +T+Y L
Sbjct: 722 PHLIIVPTSVLLNWEMEFKRFAPGFKVLTYYGSPQQRKEKRKGWNRPDA-FHVCITSYQL 780

Query: 634 ASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKE 693
                +D    K + +  ++ DE H +KN  S R+  L+      RLLLTGTPLQNNL E
Sbjct: 781 VV---HDQHSFKRKKWQYMILDEAHNIKNFRSTRWQALLNFNTERRLLLTGTPLQNNLAE 837

Query: 694 LMSLLEFIMP-----NLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQE-----AIARAK 743
           L SLL F+MP     N  I    DL A  +   R  D         AQ+      + +  
Sbjct: 838 LWSLLYFLMPQTAGTNGGIQGFADLEAFQQWFGRPVDKIIQTGEGYAQDEETRKTVTKLH 897

Query: 744 TMMKPFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXX 803
            +++P++LRR K  V K +P KH  + YC +S  QR +Y+  + +               
Sbjct: 898 QVLRPYLLRRLKADVEKQMPAKHEHVVYCRLSKRQRFLYDDFMSRA-------------- 943

Query: 804 XXXXXXPTKKNGGAQISKNLIMSLRKAALHPLLF 837
                  T  +G      N +M LRK   HP LF
Sbjct: 944 ---QTKETLSSGNFMSIINCLMQLRKVCNHPDLF 974

 Score =  129 bits (325), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 106/173 (61%), Gaps = 10/173 (5%)

Query: 882  RLCTRFPD-SLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFSLFTQMLDILEM 940
            +L   FPD SL ++        + GK+  L  +L ++ ++   + L+F+  T++LD+LE 
Sbjct: 1201 KLAIAFPDKSLLQY--------DCGKLQKLATLLRDL-KNGGHRALIFTQMTKVLDVLEQ 1251

Query: 941  ALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFD 1000
             L      ++RLDG+T++ +RQ L ++F+ D+ I  FILS+++GG GINL  A+ VI +D
Sbjct: 1252 FLNYHGYLYMRLDGATKIEERQILTERFNTDNRITAFILSSRSGGLGINLTGADTVIFYD 1311

Query: 1001 QSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLALDTYI 1053
              +NP  DKQ  DR HR+GQT+ VHI   ++ ++IE  IL+ A  K  LD  +
Sbjct: 1312 SDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNILKKANQKRQLDNVV 1364

>YDR334W (SWR1) [1163] chr4 (1135923..1140467) Member of the Snf2p
           DNA helicase ATPase family [4545 bp, 1514 aa]
          Length = 1514

 Score =  200 bits (509), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 127/334 (38%), Positives = 173/334 (51%), Gaps = 34/334 (10%)

Query: 515 PKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQNNEP-G 573
           P LL  +  L+ YQ+ G+NWL  LY N+ + ILADEMGLGKT Q I+ L+YL    E  G
Sbjct: 689 PSLLRGN--LRTYQKQGLNWLASLYNNHTNGILADEMGLGKTIQTISLLAYLACEKENWG 746

Query: 574 PHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQYDVIVTTYNL 633
           PHL+VVP+S L NW  EF +F P  K+  YYGS Q+R E R      D  + V + +Y L
Sbjct: 747 PHLIVVPTSVLLNWEMEFKRFAPGFKVLTYYGSPQQRKEKRKGWNKPDA-FHVCIVSYQL 805

Query: 634 ASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKE 693
              +++  SF + R +  +V DE H +KN  S R+  L+      RLLLTGTPLQNNL E
Sbjct: 806 VVQDQH--SFKRKR-WQYMVLDEAHNIKNFRSTRWQALLNFNTQRRLLLTGTPLQNNLAE 862

Query: 694 LMSLLEFIMPNLFISKKN-----DLSAVFRQRARTSDSNKDYNPLLAQE-----AIARAK 743
           L SLL F+MP   I  K      DL A  +   R  D   +      Q+      +A+  
Sbjct: 863 LWSLLYFLMPQTVIDGKKVSGFADLDAFQQWFGRPVDKIIETGQNFGQDKETKKTVAKLH 922

Query: 744 TMMKPFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXX 803
            +++P++LRR K  V K +P K+  I YC++S  QR +Y+  + +               
Sbjct: 923 QVLRPYLLRRLKADVEKQMPAKYEHIVYCKLSKRQRFLYDDFMSRA-------------- 968

Query: 804 XXXXXXPTKKNGGAQISKNLIMSLRKAALHPLLF 837
                  T  +G      N +M LRK   HP LF
Sbjct: 969 ---QTKATLASGNFMSIVNCLMQLRKVCNHPNLF 999

 Score =  132 bits (331), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 71/179 (39%), Positives = 110/179 (61%), Gaps = 14/179 (7%)

Query: 880  LHRLCTR----FPD-SLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFSLFTQM 934
            LH+L T+    FPD SL ++        + GK+  L  +L+ + ++   + L+F+  T++
Sbjct: 1224 LHQLQTKLTIAFPDKSLLQY--------DCGKLQKLAILLQQLKDNG-HRALIFTQMTKV 1274

Query: 935  LDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIPVFILSTKAGGFGINLVCAN 994
            LD+LE  L      ++RLDG+T++ DRQ L ++F+ D  I VFILS+++GG GINL  A+
Sbjct: 1275 LDVLEQFLNYHGYLYMRLDGATKIEDRQILTERFNTDSRITVFILSSRSGGLGINLTGAD 1334

Query: 995  NVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLALDTYI 1053
             VI +D  +NP  DKQ  DR HR+GQT+ VHI   ++ ++IE  IL+ A  K  LD  +
Sbjct: 1335 TVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNILKKANQKRQLDNVV 1393

>AEL297W [2208] [Homologous to ScYGL163C (RAD54) - SH]
            complement(83368..86055) [2688 bp, 895 aa]
          Length = 895

 Score =  198 bits (503), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 165/545 (30%), Positives = 254/545 (46%), Gaps = 88/545 (16%)

Query: 540  RNNLSCILADEMGLGKTCQVIAFL-SYLKQNNEPGP----HLVVVPSSTLENWLREFNKF 594
            R    CI+ADEMGLGKT Q IA + + L+Q ++  P     ++V PSS + NW  E  K+
Sbjct: 321  RGAYGCIMADEMGLGKTLQCIALMWTLLRQGSQGRPTIEKCIIVCPSSLVNNWANEIVKW 380

Query: 595  CPDLKIEPYY----------GSQQERAELRDILEDNDGQYDVIVTTYNLASGNKYDVSFL 644
                 + P            GS  +      I +  +    V++ +Y     N   V  L
Sbjct: 381  LGPDALSPLAIDGRKSSLSNGSVAQSVRQWAIAQGRNVVKPVLIISYETLRRN---VENL 437

Query: 645  KNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEFIMPN 704
            K     +++ DEGH LKN  S  FT L  I    R++L+GTP+QN+L E  +LL F  P 
Sbjct: 438  KGCKVGLMLADEGHRLKNGDSLTFTSLDSINCPRRVILSGTPIQNDLSEYFALLNFSNPG 497

Query: 705  LFISKKNDLSAVFRQ-------RARTSDSNKDYNPLLAQEAIARAKTMMKPFILRRRKDQ 757
            L  ++     A FR+       R R +D+  D      +  +     ++  FI+RR  D 
Sbjct: 498  LLGTR-----AQFRKNFEIPILRGRDADAT-DKEIAAGEVKLHELSQIVSKFIIRRTNDI 551

Query: 758  VLKHLPHKHSKIEYCEMSDVQRTIY-----NREIQQVLDHKRMLXXXXXXXXXXXXXPTK 812
            + K+LP K+  I +  +S +Q+ IY     +RE+ +++                      
Sbjct: 552  LSKYLPCKYEHILFVNLSPMQKAIYEHFVRSREVAKLM---------------------- 589

Query: 813  KNGGAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQEDM 872
            K  G+Q  K + + L+K   HP L        + D+++            G+   I +D 
Sbjct: 590  KGTGSQPLKAIGL-LKKLCNHPDLLD------LPDEIA------------GSTNLIPDD- 629

Query: 873  SYMNDFELHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFSLFT 932
             Y +    +   +R   S  + Q       +S K   L + L  I     +K+++ S +T
Sbjct: 630  -YQSAMTHN---SRGGRSHVEVQT-----THSSKFAILERFLFKIKHESNDKIVLISNYT 680

Query: 933  QMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIP-VFILSTKAGGFGINLV 991
            Q LD++E      +   LRLDG+  +N RQ L+DKF+D      +F+LS+KAGG GINL+
Sbjct: 681  QTLDLIEKMCRYNHYGVLRLDGTMTINKRQKLVDKFNDPSGEEFIFLLSSKAGGCGINLI 740

Query: 992  CANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLALDT 1051
             AN +I+ D  +NP  D+QA  R  R GQ K   I   IT  SIEEKI Q    K++L +
Sbjct: 741  GANRLILMDPDWNPAADQQALARVWRDGQKKDCFIYRFITTGSIEEKISQRPSMKMSLSS 800

Query: 1052 YISED 1056
             + E+
Sbjct: 801  CVVEE 805

>ADR309W [2050] [Homologous to ScYDR334W (SWR1) - SH]
           complement(1244005..1248465) [4461 bp, 1486 aa]
          Length = 1486

 Score =  199 bits (507), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 123/325 (37%), Positives = 169/325 (52%), Gaps = 31/325 (9%)

Query: 523 TLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQNNEP-GPHLVVVPS 581
           TL+ YQ+ G+NWL  LY NN + ILADEMGLGKT Q IA L+YL    E  GPHL++VP+
Sbjct: 670 TLRTYQKQGLNWLASLYNNNTNGILADEMGLGKTIQTIALLAYLACEKENWGPHLIIVPT 729

Query: 582 STLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQYDVIVTTYNLASGNKYDV 641
           S L NW  EF +F P  K+  YYGS Q+R E R      D  + V +T+Y L     +D 
Sbjct: 730 SVLLNWEMEFKRFAPGFKVLSYYGSPQQRKEKRRGWNKLDA-FHVCITSYQLVV---HDQ 785

Query: 642 SFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEFI 701
              K + +  ++ DE H +KN  S R+  L+      RLLLTGTPLQNN+ EL SLL F+
Sbjct: 786 HSFKRKKWQYMILDEAHNIKNFKSTRWQALLNFNTRRRLLLTGTPLQNNIAELWSLLYFL 845

Query: 702 MP-----NLFISKKNDLSAVFRQRARTSD----SNKDYNPLLAQEAIARAKTMMKPFILR 752
           MP     N  IS   DL A  +   +  D    +N   +    +  +++   +++P++LR
Sbjct: 846 MPQTALENGKISGFADLDAFQQWFGKPVDKIIAANDSEHDDETRRTVSKLHQVLRPYLLR 905

Query: 753 RRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXXPTK 812
           R K  V K +P K+  I YC +S  QR +Y+  + +                      T 
Sbjct: 906 RLKADVEKQMPAKYEHILYCRLSKRQRFLYDDFMSRA-----------------QTKATL 948

Query: 813 KNGGAQISKNLIMSLRKAALHPLLF 837
            +G      N +M LRK   HP LF
Sbjct: 949 ASGNFMSIINCLMQLRKVCNHPDLF 973

 Score =  132 bits (331), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 105/173 (60%), Gaps = 10/173 (5%)

Query: 882  RLCTRFPD-SLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFSLFTQMLDILEM 940
            +L   FPD SL ++        + GK+ +L  +L  + E +  + L+F+  T++LDILE 
Sbjct: 1201 KLSIAFPDKSLLQY--------DCGKLQSLAVLLRRLKE-EGHRALIFTQMTKVLDILEQ 1251

Query: 941  ALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFD 1000
             L      ++RLDG+T++ DRQ L ++F+ D  I VFILS+++GG GINL  A+ VI +D
Sbjct: 1252 FLNYHGYLYMRLDGATKIEDRQILTERFNTDPRITVFILSSRSGGLGINLTGADTVIFYD 1311

Query: 1001 QSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLALDTYI 1053
              +NP  DKQ  DR HR+GQT+ VHI    + ++IE  IL+ A  K  LD  +
Sbjct: 1312 SDWNPAMDKQCQDRCHRIGQTRDVHIYRFASEHTIESNILKKANQKRQLDNIV 1364

>Scas_669.20
          Length = 1397

 Score =  198 bits (504), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 119/332 (35%), Positives = 180/332 (54%), Gaps = 27/332 (8%)

Query: 513 QKPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYL-KQNNE 571
           ++PK+L+   TLK+YQ  G+NWL  LY   ++ ILADEMGLGKT Q I+ L++L +++N 
Sbjct: 636 EQPKMLA--CTLKEYQLKGLNWLASLYDQGINGILADEMGLGKTVQSISVLAHLAEKHNI 693

Query: 572 PGPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDILE------DNDGQYD 625
            GP+LVV P+STL NW+ E  KF P  KI PY+G+  +R  LR   +        D  + 
Sbjct: 694 WGPYLVVTPASTLHNWVNEITKFVPQFKILPYWGNAADRKVLRKFWDRKNLRYTKDSPFH 753

Query: 626 VIVTTYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGT 685
           V++T+Y +      DV++L+   +  ++ DE   +K+S S R+  L+      RLLLTGT
Sbjct: 754 VMITSYQMVVS---DVTYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGT 810

Query: 686 PLQNNLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTM 745
           P+QNN++EL +LL FIMP+LF S  ++ S  F   A+  +S+ + N  L  + + R   +
Sbjct: 811 PIQNNMQELWALLHFIMPSLFDS-HDEFSEWF---AKDIESHAEANTQLNHQQLRRLHMI 866

Query: 746 MKPFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXX 805
           +KPF+LRR K  V   L  K      C+++  Q  +Y           ++L         
Sbjct: 867 LKPFMLRRVKKNVQSELGDKIEIDVLCDLTQRQAKLY-----------QVLKSTSNYDAI 915

Query: 806 XXXXPTKKNGGAQISKNLIMSLRKAALHPLLF 837
                + +    Q   N +M  RK   HP LF
Sbjct: 916 ENAAGSDEFSSDQNLVNTVMQFRKVCNHPDLF 947

 Score =  120 bits (300), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 64/161 (39%), Positives = 102/161 (63%), Gaps = 7/161 (4%)

Query: 910  LRKILENIIEHKKE--KVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDK 967
            L+K+ E +++ K+E  +VL++   T+M+D++E  LT    N +RLDGS+++ DR+ L+  
Sbjct: 1222 LKKLDELLVQLKREGHRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRRDLVHD 1281

Query: 968  FHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHIT 1027
            +     I VF+LST+AGG GINL  A+ VI +D  +NP  D QA DR+HR+GQT+ V + 
Sbjct: 1282 WQTKPEIFVFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQVTVY 1341

Query: 1028 TLITRNSIEEKILQLAKNK-----LALDTYISEDDSKAAEA 1063
             L+ R +IEE++   AK K     + ++    E++ K  EA
Sbjct: 1342 RLLIRGTIEERMRDRAKQKEQVQQVVMEGKTQENNVKTIEA 1382

>Kwal_27.11388
          Length = 1334

 Score =  198 bits (504), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 123/331 (37%), Positives = 179/331 (54%), Gaps = 25/331 (7%)

Query: 514 KPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQN-NEP 572
           +PKLL+   TLK+YQ  G+NWL  LY   ++ ILADEMGLGKT Q I+ L++L +N N  
Sbjct: 586 QPKLLT--CTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLAENYNIW 643

Query: 573 GPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDILE------DNDGQYDV 626
           GP +VV P+STL NW+ E +KF PD KI PY+G+  +R  LR   +        D  + V
Sbjct: 644 GPFIVVTPASTLHNWVNEISKFLPDFKILPYWGNGNDRKILRRFWDRKQFRYGKDAPFHV 703

Query: 627 IVTTYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTP 686
           +VT+Y +      D ++L+   +  ++ DE   +K+S S R+  L+      RLLLTGTP
Sbjct: 704 MVTSYQMVVS---DAAYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTP 760

Query: 687 LQNNLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMM 746
           +QNN++EL +LL FIMP+LF S  ++ S  F   ++  +S+   N  L Q+ + R   ++
Sbjct: 761 IQNNMQELWALLHFIMPSLFDS-HDEFSDWF---SKDIESHAQSNTKLNQQQLRRLHMIL 816

Query: 747 KPFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXX 806
           KPF+LRR K  V   L  K      C+++  Q  +Y     QVL  +             
Sbjct: 817 KPFMLRRIKKNVQSELGEKIEIDVMCDLTRRQHKLY-----QVLKSQ----MSAAYDAIE 867

Query: 807 XXXPTKKNGGAQISKNLIMSLRKAALHPLLF 837
               + +    Q   N +M  RK   HP LF
Sbjct: 868 NAAGSDEASSDQNIVNTVMQFRKVCNHPDLF 898

 Score =  115 bits (289), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 94/150 (62%), Gaps = 2/150 (1%)

Query: 908  TALRKILENIIEHKK--EKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALI 965
            T L+K+ E ++  KK   +VL++   T+M+D++E  L+      +RLDGS+++ DR+ L+
Sbjct: 1170 TKLKKLDELLVNLKKNDHRVLIYFQMTKMMDLMEEYLSFRQYKHIRLDGSSKLEDRRDLV 1229

Query: 966  DKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVH 1025
              +     I +F+LST+AGG GINL  A+ VI +D  +NP  D QA DR+HR+GQT+ V 
Sbjct: 1230 HDWQTKPEIFIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQVT 1289

Query: 1026 ITTLITRNSIEEKILQLAKNKLALDTYISE 1055
            +  L+ R +IEE++   AK K  +   + E
Sbjct: 1290 VYRLLIRGTIEERMRDRAKQKEQVQQVVME 1319

>YFR038W (YFR038W) [1720] chr6 (229367..231928) Member of the
           Snf2/Rad54 subfamily of NTP-dependent DNA helicases
           [2562 bp, 853 aa]
          Length = 853

 Score =  195 bits (496), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 115/280 (41%), Positives = 164/280 (58%), Gaps = 15/280 (5%)

Query: 513 QKPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQNNEP 572
           ++P+LL  +  LK YQ  G+NWL  LY N L+ ILADEMGLGKT Q IA L+++ + +  
Sbjct: 212 KQPRLLK-NCILKPYQLEGLNWLITLYENGLNGILADEMGLGKTVQSIALLAFIYEMDTK 270

Query: 573 GPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGS---QQERAELRDILEDNDGQYDVIVT 629
           GP LV  P STL+NW+ EF KF PDL +  YYG+   ++  A+L++  + + G   +++T
Sbjct: 271 GPFLVTAPLSTLDNWMNEFAKFAPDLPVLKYYGTNGYKERSAKLKNFFKQHGGT-GIVIT 329

Query: 630 TYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQN 689
           +Y +      D   + ++ +  ++ DEGH LKN       +L KI  + RLLLTGTPLQN
Sbjct: 330 SYEIIL---RDTDLIMSQNWKFLIVDEGHRLKNINCRLIKELKKINTSNRLLLTGTPLQN 386

Query: 690 NLKELMSLLEFIMPNLF-----ISKKNDLSAVFRQRARTSDS-NKDYNPLLAQEAIARAK 743
           NL EL SLL FIMP++F      +K  D  ++       S++ NK  N  L +  I+   
Sbjct: 387 NLAELWSLLNFIMPDIFADFEIFNKWFDFDSLNLGSGSNSEALNKLINDELQKNLISNLH 446

Query: 744 TMMKPFILRRRKDQVLKH-LPHKHSKIEYCEMSDVQRTIY 782
           T++KPF+LRR K  VL + LP K   I  C M+  Q   Y
Sbjct: 447 TILKPFLLRRLKKVVLANILPPKREYIINCPMTSAQEKFY 486

 Score =  104 bits (259), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 60/151 (39%), Positives = 88/151 (58%), Gaps = 2/151 (1%)

Query: 904  SGKITALRKILENIIEHKKEKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQA 963
            SGK+  L+K++  +I  +  KVL++S F  MLD++E      +    R+DGS     R+ 
Sbjct: 602  SGKLQILQKLIPPLIS-EGHKVLIYSQFVNMLDLIEDWCDLNSFATFRIDGSVNNETRKD 660

Query: 964  LIDKFHDD-DTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTK 1022
             ++KF+   D   +F+LST+A G GINLV A+ V++FD  +NP  D QA DR HR+GQ  
Sbjct: 661  QLEKFNSSKDKHNIFLLSTRAAGLGINLVGADTVVLFDSDWNPQVDLQAMDRCHRIGQES 720

Query: 1023 TVHITTLITRNSIEEKILQLAKNKLALDTYI 1053
             V +  L   N+IE  IL  A NK  L+  +
Sbjct: 721  PVIVYRLCCDNTIEHVILTRAANKRNLERMV 751

>Sklu_2125.3 YJR035W, Contig c2125 6474-9632
          Length = 1052

 Score =  196 bits (498), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 164/571 (28%), Positives = 259/571 (45%), Gaps = 136/571 (23%)

Query: 524  LKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQNNE-PGPHLVVVPSS 582
            L +YQ+T + WL  LY+ N   I+ DEMGLGKT Q+I+FL+ L  +    GP L+V P++
Sbjct: 285  LFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQIISFLASLHHSGMLDGPILIVCPAT 344

Query: 583  TLENWLREFNKFCPDLK--IEPYYGSQQERAE--LRDILED------------------- 619
             ++ W  EF+ + P  +  I    GS     E    D LE+                   
Sbjct: 345  VMKQWCNEFHTWWPPFRAVILHSIGSGMSNKEKLSEDRLEEMLMNSNPEEFSYVDYTDSK 404

Query: 620  --------------------NDGQYDVIVTTYNLASGNKYDVSFLKNRGFNVVVYDEGHM 659
                                NDG   V++TTY    G +     L    +   V DEGH 
Sbjct: 405  KTKSTMESKLNLTKLVDKVVNDGH--VLITTY---VGLRLHADELLKVKWGYAVLDEGHK 459

Query: 660  LKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEFIMPNLFISKKNDLSAVFRQ 719
            ++N  S+      +++ + R++L+GTP+QNNL EL SL +FI P    +       VF+Q
Sbjct: 460  IRNPDSDISLTCKQLKTSNRVILSGTPIQNNLTELWSLFDFIFPGRLGT-----LPVFQQ 514

Query: 720  RARTSDSNKDY---NPLLAQEAIARA---KTMMKPFILRRRKDQVLKHLPHKHSKIEYCE 773
            +     +   Y     +  Q     A   + ++ P++LRR K  V K LP K+  + +C+
Sbjct: 515  QFAIPINMGGYANATNIQVQTGYKCAVALRDLISPYLLRRVKTDVAKDLPKKNEMVLFCK 574

Query: 774  MSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXXPTKKNGGAQISKNLIMSLRKAALH 833
            ++  QR  Y     Q L+   ++                KNG  Q+   + + LRK   H
Sbjct: 575  LTQYQRNKY----LQFLNSGDLVKI--------------KNGKRQVLYGIDI-LRKICNH 615

Query: 834  PLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQEDMSYMNDFELHRLCTRFPDSLAK 893
            P        D+++  M  +   E  Y +                          P    K
Sbjct: 616  P--------DILVRDMRHS---EESYGD--------------------------PKRSGK 638

Query: 894  FQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFSLFTQMLDILEMALTTLN-----IN 948
             Q+             ++++L+ + + +  K L+F+   QMLDILE  ++  +     + 
Sbjct: 639  MQV-------------VKQLLK-LWKEQGHKTLLFTQSRQMLDILEKFISYRDPELSSLT 684

Query: 949  FLRLDGSTQVNDRQALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDD 1008
            +LR+DG+T +  RQ L+DKF +++   VF+L+T+ GG G+NL  AN +IIFD  +NP  D
Sbjct: 685  YLRMDGTTNIAARQHLVDKF-NNELYDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTD 743

Query: 1009 KQAADRSHRVGQTKTVHITTLITRNSIEEKI 1039
             QA +R+ R+GQ + V I  L+   SIEEKI
Sbjct: 744  LQARERAWRIGQKREVTIYRLMIAGSIEEKI 774

>KLLA0F21758g complement(2023805..2028523) similar to sp|Q05471
            Saccharomyces cerevisiae YDR334w SWR1 DEAH-box protein,
            putative RNA helicase, hypothetical start
          Length = 1572

 Score =  196 bits (499), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 126/334 (37%), Positives = 170/334 (50%), Gaps = 34/334 (10%)

Query: 515  PKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQNNEP-G 573
            P LL    TL+ YQ+ G+NWL  LY N  + ILADEMGLGKT Q I+ L+YL    E  G
Sbjct: 758  PSLLRG--TLRIYQKQGLNWLASLYNNKTNGILADEMGLGKTIQTISLLAYLACEKENWG 815

Query: 574  PHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQYDVIVTTYNL 633
            PHL+VVP+S L NW  EF +F P  K+  YYGS Q+R E R      D  + V +T+Y L
Sbjct: 816  PHLIVVPTSVLLNWEMEFKRFAPGFKVLTYYGSPQQRREKRKGWNKPDA-FHVCITSYQL 874

Query: 634  ASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKE 693
                 +D    K + +  ++ DE H +KN  S R+  L+      RLLLTGTPLQNNL E
Sbjct: 875  VV---HDQHSFKRKKWQYMILDEAHNIKNFRSTRWQALLNFNTERRLLLTGTPLQNNLAE 931

Query: 694  LMSLLEFIMP-----NLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQE-----AIARAK 743
            L SLL F+MP     N  +S   DL A  +   R  D   +      Q+      +++  
Sbjct: 932  LWSLLYFLMPQTALENGKVSGFADLDAFQQWFGRPVDKIVETGENYEQDEETKKTVSKLH 991

Query: 744  TMMKPFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXX 803
             +++P++LRR K  V K +P K+  I YC +S  QR +Y+  + +               
Sbjct: 992  QVLRPYLLRRLKADVEKQMPGKYEHIIYCRLSKRQRFLYDDFMSRA-------------- 1037

Query: 804  XXXXXXPTKKNGGAQISKNLIMSLRKAALHPLLF 837
                   T  +G      N +M LRK   HP LF
Sbjct: 1038 ---QTKETLASGNFMSIINCLMQLRKVCNHPDLF 1068

 Score =  135 bits (339), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 108/173 (62%), Gaps = 10/173 (5%)

Query: 882  RLCTRFPD-SLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFSLFTQMLDILEM 940
            +L   FPD SL ++        + GK+  L ++L+N+ ++   + L+F+  T++LDILE 
Sbjct: 1294 KLSVAFPDKSLLQY--------DCGKLQKLAQLLQNLKDNG-HRALIFTQMTKVLDILEQ 1344

Query: 941  ALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFD 1000
             L      ++RLDG+T++ DRQ L ++F+ D  I VFILS+++GG GINL  A+ VI +D
Sbjct: 1345 FLNFHGYLYMRLDGATKIEDRQILTERFNSDPRITVFILSSRSGGLGINLTGADTVIFYD 1404

Query: 1001 QSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLALDTYI 1053
              +NP  DKQ  DR HR+GQT+ VHI   ++ ++IE  IL+ A  K  LD  +
Sbjct: 1405 SDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSDHTIESNILKKANQKRHLDNVV 1457

>Scas_520.5
          Length = 863

 Score =  194 bits (492), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 113/290 (38%), Positives = 170/290 (58%), Gaps = 15/290 (5%)

Query: 507 NVKFFKQKPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYL 566
           +V   +++P +L  +  LK YQ  G+NWL  LY N L+ ILAD+MGLGKT Q IA L+++
Sbjct: 255 DVTISQEQPSMLK-NCVLKPYQLEGLNWLITLYENGLNGILADDMGLGKTIQSIALLAFI 313

Query: 567 KQNNEPGPHLVVVPSSTLENWLREFNKFCPDLKIEPYY--GSQQERAEL-RDILEDNDGQ 623
            + +  GP L+  P ST++NW+ EF KF PDL +  YY  G + ER +L R+  +  +G 
Sbjct: 314 YEMDTKGPFLIAAPLSTVDNWMNEFEKFAPDLPVLKYYHPGGKNERNKLMRNFFKKTNGT 373

Query: 624 YDVIVTTYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLT 683
             ++VT+Y +      D  ++ ++ +  ++ DEGH LKN       +L +I  + RLLLT
Sbjct: 374 -GIVVTSYEIII---RDADYIMSKQWKFLIVDEGHRLKNVNCRLIQELKRINTSNRLLLT 429

Query: 684 GTPLQNNLKELMSLLEFIMPNLF-----ISKKNDLSAVFRQRARTSDSNKDYNPLLAQEA 738
           GTPLQNNL EL SLL FIMP++F      +K  D   +    + +S  NK  N  L +  
Sbjct: 430 GTPLQNNLAELWSLLNFIMPDIFTDFEIFNKWFDFKDL-EMESNSSKLNKVINEELQKNL 488

Query: 739 IARAKTMMKPFILRRRKDQVLKH-LPHKHSKIEYCEMSDVQRTIYNREIQ 787
           I+   T++KPF+LRR K  VL + LP K   +  C ++ +Q+  Y R ++
Sbjct: 489 ISNLHTILKPFLLRRLKKTVLANILPPKREYVVNCPLTPIQKKFYKRGLE 538

 Score =  107 bits (268), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 60/151 (39%), Positives = 90/151 (59%), Gaps = 2/151 (1%)

Query: 904  SGKITALRKILENIIEHKKEKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQA 963
            SGK+  L++++  +I  K  K+L+FS F  MLD+LE      ++   R+DG+     R+ 
Sbjct: 650  SGKLKTLQRLVIPLIA-KGHKILIFSQFVNMLDLLEDWCDLNSLAAFRIDGTIDNESRKE 708

Query: 964  LIDKFHDD-DTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTK 1022
             + KF+D  +   VF+LST+A G G+NLV A+ V++FD  +NP  D QA DR HR+GQTK
Sbjct: 709  QLSKFNDKKNKHMVFLLSTRAAGLGVNLVGADTVVLFDSDWNPQVDLQAMDRCHRIGQTK 768

Query: 1023 TVHITTLITRNSIEEKILQLAKNKLALDTYI 1053
             V +      N++E  IL  A NK  L+  +
Sbjct: 769  PVIVYRFCCDNTLEHVILTRAANKRKLERLV 799

>CAGL0M01188g complement(132330..136682) similar to sp|Q05471
           Saccharomyces cerevisiae YDR334w, start by similarity
          Length = 1450

 Score =  196 bits (498), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 124/334 (37%), Positives = 173/334 (51%), Gaps = 34/334 (10%)

Query: 515 PKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLK-QNNEPG 573
           P LL    TL+ YQ+ G+NWL  LY NN + ILADEMGLGKT Q I+ LSYL  + +  G
Sbjct: 621 PSLLRG--TLRTYQKQGLNWLASLYNNNTNGILADEMGLGKTIQTISLLSYLACEKHNWG 678

Query: 574 PHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQYDVIVTTYNL 633
           PHL+VVP+S L NW  EF +F P  K+  YYG+ Q+R E R      D  + V + +Y L
Sbjct: 679 PHLIVVPTSVLLNWEMEFKRFAPGFKVLTYYGNPQQRKEKRKGWNKPDA-FHVCIVSYQL 737

Query: 634 ASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKE 693
              +++  SF K + +  +V DE H +KN  S R+  L+      R+LLTGTPLQNN+ E
Sbjct: 738 IVQDQH--SF-KRKKWQYMVLDEAHNIKNFRSTRWQALLNFNTQRRILLTGTPLQNNIAE 794

Query: 694 LMSLLEFIMPNLFISKKN-----DLSAVFRQRARTSDSNKDYNPLLAQE-----AIARAK 743
           L SLL F+MP   I  +      DL A  +   R  D   +      Q+      + +  
Sbjct: 795 LWSLLYFLMPQTVIDGQKVSGFADLDAFQQWFGRPVDKLIETGGTYEQDNETKRTVEKLH 854

Query: 744 TMMKPFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXX 803
            +++P++LRR K  V K +P K+  I YC++S  QR +Y+  + +               
Sbjct: 855 QVLRPYLLRRLKADVEKQIPGKYEHIVYCKLSKRQRFLYDDFMSRA-------------- 900

Query: 804 XXXXXXPTKKNGGAQISKNLIMSLRKAALHPLLF 837
                  T  +G      N +M LRK   HP LF
Sbjct: 901 ---QTKATLASGNFMSIVNCLMQLRKVCNHPDLF 931

 Score =  130 bits (328), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 105/173 (60%), Gaps = 10/173 (5%)

Query: 882  RLCTRFPD-SLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFSLFTQMLDILEM 940
            +L   FPD SL ++        + GK+  L  +L+ + +    + L+F+  T++LDILE 
Sbjct: 1162 KLTIAFPDKSLLQY--------DCGKLQKLAILLQQL-KDGGHRALIFTQMTKVLDILEQ 1212

Query: 941  ALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFD 1000
             L      ++RLDG+T++ DRQ L ++F+ D  I VFILS+++GG GINL  A+ VI +D
Sbjct: 1213 FLNYHGYLYMRLDGATKIEDRQILTERFNSDPKITVFILSSRSGGLGINLTGADTVIFYD 1272

Query: 1001 QSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLALDTYI 1053
              +NP  DKQ  DR HR+GQT+ VHI   ++ ++IE  IL+ A  K  LD  I
Sbjct: 1273 SDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNILKKANQKRQLDDVI 1325

>YGL150C (INO80) [1838] chr7 complement(221107..225576) Member of the
            Snf2p-like family of probable DNA helicases [4470 bp,
            1489 aa]
          Length = 1489

 Score =  196 bits (497), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 119/332 (35%), Positives = 182/332 (54%), Gaps = 18/332 (5%)

Query: 513  QKPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQN-NE 571
            ++PK+L+   TLK+YQ  G+NWL  LY   ++ ILADEMGLGKT Q I+ L++L +N N 
Sbjct: 697  EQPKILA--CTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLAENHNI 754

Query: 572  PGPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQYD------ 625
             GP LVV P+STL NW+ E +KF P  KI PY+G+  +R  LR   +  + +Y+      
Sbjct: 755  WGPFLVVTPASTLHNWVNEISKFLPQFKILPYWGNANDRKVLRKFWDRKNLRYNKNAPFH 814

Query: 626  VIVTTYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGT 685
            V+VT+Y +      D ++L+   +  ++ DE   +K+S S R+  L+      RLLLTGT
Sbjct: 815  VMVTSYQMVVT---DANYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGT 871

Query: 686  PLQNNLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTM 745
            P+QN+++EL +LL FIMP+LF S  ++ +  F   ++  +S+ + N  L Q+ + R   +
Sbjct: 872  PIQNSMQELWALLHFIMPSLFDS-HDEFNEWF---SKDIESHAEANTKLNQQQLRRLHMI 927

Query: 746  MKPFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXX 805
            +KPF+LRR K  V   L  K      C+++  Q  +Y     Q+  +   +         
Sbjct: 928  LKPFMLRRVKKNVQSELGDKIEIDVLCDLTQRQAKLYQVLKSQISTNYDAI--ENAATND 985

Query: 806  XXXXPTKKNGGAQISKNLIMSLRKAALHPLLF 837
                    +G  Q   N +M  RK   HP LF
Sbjct: 986  STSNSASNSGSDQNLINAVMQFRKVCNHPDLF 1017

 Score =  121 bits (303), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 102/164 (62%), Gaps = 7/164 (4%)

Query: 910  LRKILENIIEHKKE--KVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDK 967
            LRK+ E +++ K E  +VL++   T+M+D++E  LT    N +RLDGS+++ DR+ L+  
Sbjct: 1301 LRKLDELLVKLKSEGHRVLIYFQMTKMMDLMEEYLTYRQYNHIRLDGSSKLEDRRDLVHD 1360

Query: 968  FHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHIT 1027
            +  +  I VF+LST+AGG GINL  A+ VI +D  +NP  D QA DR+HR+GQT+ V + 
Sbjct: 1361 WQTNPEIFVFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQVTVY 1420

Query: 1028 TLITRNSIEEKILQLAKNK-----LALDTYISEDDSKAAEALEN 1066
             L+ R +IEE++   AK K     + ++    E + K  E  EN
Sbjct: 1421 RLLVRGTIEERMRDRAKQKEQVQQVVMEGKTQEKNIKTIEVGEN 1464

>KLLA0E08965g complement(797861..802330) similar to sp|P53115
            Saccharomyces cerevisiae YGL150c INO80, hypothetical
            start
          Length = 1489

 Score =  194 bits (493), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 126/339 (37%), Positives = 180/339 (53%), Gaps = 27/339 (7%)

Query: 514  KPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQN-NEP 572
            +PK+L+   TLK+YQ  G+NWL  LY   ++ ILADEMGLGKT Q I+ L++L    N  
Sbjct: 738  QPKMLA--CTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLADRYNIW 795

Query: 573  GPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDILE------DNDGQYDV 626
            GP +VV P+STL NW+ E ++F P  KI PY+G+  +R  LR   +        D  + V
Sbjct: 796  GPFIVVTPASTLHNWVNEISRFVPQFKILPYWGNANDRKTLRKFWDRKHLRYGRDAPFHV 855

Query: 627  IVTTYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTP 686
            +VT+Y +      D S+L+   +  ++ DE   +K+S S R+  L+      RLLLTGTP
Sbjct: 856  MVTSYQMVVS---DASYLQKMKWQYMILDEAQAIKSSQSSRWKTLLSFHCRNRLLLTGTP 912

Query: 687  LQNNLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMM 746
            +QNN++EL +LL FIMP+LF S  ++ S  F   ++  +S+ + N  L QE + R   ++
Sbjct: 913  IQNNMQELWALLHFIMPSLFDSH-DEFSDWF---SKDIESHAESNTELNQEQLRRLHMVL 968

Query: 747  KPFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXX 806
            KPF+LRR K  V   L  K      C+++  Q  +Y     QVL  +             
Sbjct: 969  KPFMLRRIKKNVQSELGDKIEIDVLCDLTFRQAKLY-----QVLKSQVSGGYDAIENAAG 1023

Query: 807  XXXPTKKNGGAQISKNLIMSLRKAALHPLLFRHHYDDVM 845
                T      Q   NL+M  RK   HP LF     DVM
Sbjct: 1024 NDDVT----SDQKLVNLVMEFRKVCNHPDLFERA--DVM 1056

 Score =  118 bits (295), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 98/152 (64%), Gaps = 2/152 (1%)

Query: 910  LRKILENIIEHKKE--KVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDK 967
            L+K+ E +++ K+E  +VL++   T+M+D++E  LT      +RLDGS++++DR+ L+  
Sbjct: 1321 LKKLDELLVKLKEEDHRVLIYFQMTKMMDLMEEYLTYRQYTHIRLDGSSKLDDRRDLVHD 1380

Query: 968  FHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHIT 1027
            +     I +F+LST+AGG GINL  A+ VI +D  +NP  D QA DR+HR+GQT+ V + 
Sbjct: 1381 WQTKPDIFIFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQVTVY 1440

Query: 1028 TLITRNSIEEKILQLAKNKLALDTYISEDDSK 1059
             L+ R +IEE++   AK K  +   + E  +K
Sbjct: 1441 RLLIRGTIEERMRDRAKQKEHVQQVVMEGKAK 1472

>KLLA0A03069g complement(271516..274203) similar to sp|P32863
            Saccharomyces cerevisiae YGL163c RAD54 DNA-dependent
            ATPase of the SNF2P family, start by similarity
          Length = 895

 Score =  190 bits (482), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 162/552 (29%), Positives = 255/552 (46%), Gaps = 104/552 (18%)

Query: 540  RNNLSCILADEMGLGKTCQVIAFL-SYLKQNNEPGPH--------LVVVPSSTLENWLRE 590
            R    CI+ADEMGLGKT Q +A + + LKQ    GP         ++V PSS + NW  E
Sbjct: 323  RGAYGCIMADEMGLGKTLQCLALMWTMLKQ----GPQGRRSIDKCIIVCPSSLVNNWANE 378

Query: 591  FNKFC-----PDLKIEPYYGS-----------QQERAELRDILEDNDGQYDVIVTTYNLA 634
             +K+        L I+    S               A+ R+I++       V++ +Y+  
Sbjct: 379  IDKWLGPGSLSSLAIDGKKSSLNNGNVADSVSHWASAQGRNIVKP------VLIISYDTL 432

Query: 635  SGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKEL 694
              N   V  LKN    +++ DEGH LKN+ S  FT L  I    R++L+GTP+QN+L E 
Sbjct: 433  RRN---VEQLKNCEVGLMLADEGHRLKNADSLTFTALDSIRCPRRVILSGTPIQNDLSEY 489

Query: 695  MSLLEFIMPNLFISKKNDLSAVFRQ---RARTSDSNKDYNPLLAQEAIARAKTMMKPFIL 751
             +LL F  P L  S+ ND    F     ++R S +  D    L ++ + +   ++  FI+
Sbjct: 490  FALLNFSNPGLLGSR-NDFRKNFELPILQSRDSLAT-DEEVTLGKDRLRQLSNIVSKFII 547

Query: 752  RRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXXPT 811
            RR  + + K+LP K+  + +  ++  Q+++Y   I+     K +                
Sbjct: 548  RRTNNILAKYLPCKYEHVIFINLTPFQQSLYQHFIESRAVKKIV---------------- 591

Query: 812  KKNGGAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAEN--GNKEYIQ 869
               G +      I  L+K   HP L                     E +E+  G++E I 
Sbjct: 592  --KGDSNQPLKAIGLLKKLCNHPDLL--------------------ELSEDIPGSEELIP 629

Query: 870  EDMSYMNDFELHR----LCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKV 925
            +D     D    R    + T F                S K + L + L  I     +K+
Sbjct: 630  DDYQSSVDSRTSRNRSVIQTAF----------------SSKFSVLARFLYKIKTESNDKI 673

Query: 926  LVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIP-VFILSTKAG 984
            ++ S +TQ LD++E    + +   LRLDG+  +N RQ L+D+F+D +    +F+LS+KAG
Sbjct: 674  VLISNYTQTLDLIEKMCFSNHYGVLRLDGTMNINKRQKLVDRFNDPEGQEFIFLLSSKAG 733

Query: 985  GFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAK 1044
            G GINL+ AN +I+ D  +NP  D+QA  R  R GQ K   I   I+  +IEEKI Q   
Sbjct: 734  GCGINLIGANRLILLDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQS 793

Query: 1045 NKLALDTYISED 1056
             K++L + + ++
Sbjct: 794  MKMSLSSCVVDE 805

>CAGL0J02662g 261909..264443 similar to sp|P43610 Saccharomyces
           cerevisiae YFR038w, hypothetical start
          Length = 844

 Score =  189 bits (479), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 115/279 (41%), Positives = 158/279 (56%), Gaps = 13/279 (4%)

Query: 512 KQKPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQNNE 571
           K++P  L  +  LK YQ  G+NWL  LY N L+ ILADEMGLGKT Q IA LS++ + + 
Sbjct: 208 KEQPSYLK-NCVLKPYQMEGLNWLITLYENGLNGILADEMGLGKTIQSIALLSFIYEMDT 266

Query: 572 PGPHLVVVPSSTLENWLREFNKFCPDLKIEPYYG--SQQERAELRDILEDNDGQYDVIVT 629
            GP L+  P ST++NW+ EF KF P++ I  YY    Q  R +L      N+ +  VIVT
Sbjct: 267 KGPFLIAAPLSTVDNWMNEFAKFAPEIPILKYYSQNGQDARQKLLKKFFKNNNREGVIVT 326

Query: 630 TYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQN 689
           +Y +      D + +    +  ++ DEGH LKN       +L +I  + RLLLTGTPLQN
Sbjct: 327 SYEMII---RDANIIMGEQWKFLIVDEGHRLKNINCRLIQELKRINTSNRLLLTGTPLQN 383

Query: 690 NLKELMSLLEFIMPNLF-----ISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKT 744
           NL EL SLL FI+P++F      +K  D   +  Q + ++  NK  N  L +  I+   T
Sbjct: 384 NLSELWSLLNFILPDIFADFEIFNKWFDFKDLDLQ-SNSAKLNKLINDELEKNLISNLHT 442

Query: 745 MMKPFILRRRKDQVLKH-LPHKHSKIEYCEMSDVQRTIY 782
           ++KPF+LRR K  VLK  LP K   I  C +S +Q   Y
Sbjct: 443 ILKPFLLRRLKSVVLKDVLPPKREYIVNCPLSPIQTKFY 481

 Score =  115 bits (287), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 91/152 (59%), Gaps = 2/152 (1%)

Query: 903  NSGKITALRKILENIIEHKKEKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQ 962
            +SGK+  L+K+   +I+ K  K+L+FS F  MLD+LE      + N LR+DG      R+
Sbjct: 593  SSGKLQMLQKLAIPLIK-KGHKILIFSQFVGMLDLLEDWSELNSFNSLRIDGGVDNESRK 651

Query: 963  ALIDKFHD-DDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQT 1021
              ID+F+   D   +F+LST+A G GINLV A+ VIIFD  +NP  D QA DR HR+GQT
Sbjct: 652  EYIDEFNKKGDDHQIFLLSTRAAGLGINLVAADTVIIFDSDWNPQVDLQAMDRCHRIGQT 711

Query: 1022 KTVHITTLITRNSIEEKILQLAKNKLALDTYI 1053
            K V +      N+IE  IL  A NK  L+  +
Sbjct: 712  KPVIVYRFCCDNTIEHVILTRAVNKRKLERMV 743

>AGR379W [4690] [Homologous to ScYGL150C (INO80) - SH]
           complement(1426843..1431087) [4245 bp, 1414 aa]
          Length = 1414

 Score =  191 bits (484), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 119/336 (35%), Positives = 180/336 (53%), Gaps = 26/336 (7%)

Query: 513 QKPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQN-NE 571
           ++PK+L+   TLK+YQ  G+NWL  LY   ++ ILADEMGLGKT Q I+ L++L +  N 
Sbjct: 646 EQPKILA--CTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLAERYNI 703

Query: 572 PGPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDILE------DNDGQYD 625
            GP +VV P+STL NW+ E  KF PD KI PY+G+  +R  LR   +        D  + 
Sbjct: 704 WGPFIVVTPASTLHNWVNEIQKFVPDFKILPYWGNGNDRKILRRFWDRKHLRYSKDAPFH 763

Query: 626 VIVTTYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGT 685
           V++T+Y +      D ++L+   +  ++ DE   +K+S S R+  L+      RLLLTGT
Sbjct: 764 VMITSYQMIVS---DAAYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGT 820

Query: 686 PLQNNLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTM 745
           P+QN+++EL +LL FIMP+LF S  ++ +  F   ++  +S+   N  L Q+ + R   +
Sbjct: 821 PIQNSMQELWALLHFIMPSLFDS-HDEFNDWF---SKDIESHAQSNTQLNQQQLRRLHMI 876

Query: 746 MKPFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXX 805
           +KPF+LRR K  V   L  K      C+++  Q  +Y     QVL   ++          
Sbjct: 877 LKPFMLRRIKKNVQSELGDKIEIDVMCDLTHRQAKLY-----QVL-KSQVSASYDAIENA 930

Query: 806 XXXXPTKKNGGAQISK----NLIMSLRKAALHPLLF 837
                   +G   +S     N +M  RK   HP LF
Sbjct: 931 ASNSSGDDSGNMSLSDSKIMNTVMEFRKVCNHPDLF 966

 Score =  115 bits (287), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/152 (38%), Positives = 95/152 (62%), Gaps = 2/152 (1%)

Query: 910  LRKILENIIEHK--KEKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDK 967
            L+K+ E ++  K  + +VL++   T+M+D++E  LT      +RLDGS+++ DR+ L+  
Sbjct: 1242 LKKLDELLVRLKAGEHRVLIYFQMTRMMDLIEEYLTYRQYKHIRLDGSSKLEDRRDLVHD 1301

Query: 968  FHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHIT 1027
            +     I +F+LST+AGG GINL  A+ VI +D  +NP  D QA DR+HR+GQTK V + 
Sbjct: 1302 WQTKSDIFIFLLSTRAGGLGINLTSADTVIFYDSDWNPTIDSQAMDRAHRLGQTKQVTVY 1361

Query: 1028 TLITRNSIEEKILQLAKNKLALDTYISEDDSK 1059
             L+ + +IEE++   AK K  +   + E  +K
Sbjct: 1362 RLLIKGTIEERMRDRAKQKEHVQQVVMEGKTK 1393

>YBR073W (RDH54) [263] chr2 (383172..385946) Protein required for
            mitotic diploid-specific recombination and repair and for
            meiosis [2775 bp, 924 aa]
          Length = 924

 Score =  184 bits (466), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 165/540 (30%), Positives = 245/540 (45%), Gaps = 106/540 (19%)

Query: 544  SCILADEMGLGKTCQVIAFLSYL------------KQNNEPGPHL-----VVVPSSTLEN 586
             C+LAD+MGLGKT   I  +  L             Q+  P   L     VV P + + N
Sbjct: 307  GCLLADDMGLGKTLMSITLIWTLIRQTPFASKVSCSQSGIPLTGLCKKILVVCPVTLIGN 366

Query: 587  WLREFNKF-----CPDLKIEPYYGSQQERAELRDILEDNDGQYDVIVTTYN--LASGNKY 639
            W REF K+        L +        ++  +R+ L+     Y V++  Y   L+   + 
Sbjct: 367  WKREFGKWLNLSRIGVLTLSSRNSPDMDKMAVRNFLKVQR-TYQVLIIGYEKLLSVSEEL 425

Query: 640  DVSFLKNRGF-NVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLL 698
            +    KN+   +++V DEGH LKN  S+    L  ++   +LLLTGTP+QN+L E  +++
Sbjct: 426  E----KNKHLIDMLVCDEGHRLKNGASKILNTLKSLDIRRKLLLTGTPIQNDLNEFFTII 481

Query: 699  EFIMPNLFISKKNDLSAVFRQR-----ARTSDSNKDYNPLLAQEAIARAKTMM---KPFI 750
            +FI P +  S      A F++R      R  D+   YN  L ++   R+K M+   K FI
Sbjct: 482  DFINPGILGS-----FASFKRRFIIPITRARDTANRYNEELLEKGEERSKEMIEITKRFI 536

Query: 751  LRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXXP 810
            LRR    + K+LP K   I +C+             QQ+L  K +L              
Sbjct: 537  LRRTNAILEKYLPPKTDIILFCKPYS----------QQILAFKDILQGARLDFGQLTFSS 586

Query: 811  TKKNGGAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQE 870
                     S  LI  L+K    P L                +  +P Y     K +I++
Sbjct: 587  ---------SLGLITLLKKVCNSPGL----------------VGSDPYY-----KSHIKD 616

Query: 871  DMSYMNDFELHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFSL 930
                          T+  DS ++        +NSGK+  L  +LE I +  KEKV+V S 
Sbjct: 617  --------------TQSQDSYSR-------SLNSGKLKVLMTLLEGIRKGTKEKVVVVSN 655

Query: 931  FTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIPVFILSTKAGGFGINL 990
            +TQ LDI+E  +    ++  RLDGS     R +++  F+ +  I  F+LS K+GG G+NL
Sbjct: 656  YTQTLDIIENLMNMAGMSHCRLDGSIPAKQRDSIVTSFNRNPAIFGFLLSAKSGGVGLNL 715

Query: 991  VCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKIL--QLAKNKLA 1048
            V  + +I+FD  +NP  D QA  R HR GQ K   I  L+T   I+EKIL  QL KN L+
Sbjct: 716  VGRSRLILFDNDWNPSVDLQAMSRIHRDGQKKPCFIYRLVTTGCIDEKILQRQLMKNSLS 775

>Kwal_47.18077
          Length = 809

 Score =  182 bits (462), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 107/279 (38%), Positives = 161/279 (57%), Gaps = 15/279 (5%)

Query: 513 QKPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQNNEP 572
           Q+P LL  +  LK YQ  G+NWL  LY N L+ ILADEMGLGKT Q IA L+++ + +  
Sbjct: 170 QQPSLLK-NCQLKPYQLEGVNWLITLYENGLNGILADEMGLGKTLQSIALLAFITEMDTG 228

Query: 573 GPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQE---RAELRDILEDNDGQYDVIVT 629
           GP L+  P STL+ W+ EF++F PD+++  YY +Q +   ++ L+   +   GQ  V++T
Sbjct: 229 GPFLIAAPLSTLDTWVNEFSRFAPDIQVLKYYSTQGQSYRQSLLKKFFKSTKGQ-GVVIT 287

Query: 630 TYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQN 689
           +Y +      D+  + +  +  ++ DEGH +KN   +   +L +I    RLL+TGT LQN
Sbjct: 288 SYEIII---RDIELILSYQWKFLIVDEGHRIKNINCKLIRELKRINTLNRLLITGTALQN 344

Query: 690 NLKELMSLLEFIMPNLF-----ISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKT 744
           NL EL SLL FIMP++F       K  D S +   ++ +   N+  N  L +  I+    
Sbjct: 345 NLSELWSLLNFIMPDIFADFEIFHKWFDFSDL-ELKSSSQGLNRLINDELEKNLISNLHA 403

Query: 745 MMKPFILRRRKDQVLK-HLPHKHSKIEYCEMSDVQRTIY 782
           ++KPF+LRR K  VL   LP K   I  C ++ VQ+ +Y
Sbjct: 404 ILKPFLLRRLKKVVLAGSLPPKREYIVNCPLTSVQKKLY 442

 Score =  119 bits (299), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 97/152 (63%), Gaps = 2/152 (1%)

Query: 903  NSGKITALRKILENIIEHKKEKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQ 962
            +SGK+  L++++  +I+ K  KVL+F+ F  MLD++E      ++   R+DGS     RQ
Sbjct: 553  SSGKLQILQQLVPPLIK-KGHKVLIFTQFVGMLDLIEDWCELNDVRVCRIDGSMGNETRQ 611

Query: 963  ALIDKFHD-DDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQT 1021
              I++F+D DD+   F++ST+AGG GINL  A++VI+FD  +NP  D QA DR+HR+GQT
Sbjct: 612  EHIERFNDPDDSFDAFLISTRAGGLGINLTAADSVILFDSDWNPQVDLQATDRTHRIGQT 671

Query: 1022 KTVHITTLITRNSIEEKILQLAKNKLALDTYI 1053
            K V +  L   N+IE  IL  A +K  L+  +
Sbjct: 672  KPVIVYRLCCDNTIEHVILTRAASKRKLEKMV 703

>YBR245C (ISW1) [424] chr2 complement(708107..711496) Putative
           ATP-dependent chromatin remodeling factor, has strong
           similarity to Drosophila nucleosome remodeling factor
           ISWI [3390 bp, 1129 aa]
          Length = 1129

 Score =  183 bits (464), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 119/334 (35%), Positives = 176/334 (52%), Gaps = 43/334 (12%)

Query: 511 FKQKPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQNN 570
           F++ P  ++    L+ YQ  G+NWL  L++N ++ ILADEMGLGKT Q I+FL YL+   
Sbjct: 185 FRESPAYVNG--QLRPYQIQGVNWLVSLHKNKIAGILADEMGLGKTLQTISFLGYLRYIE 242

Query: 571 E-PGPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAEL--RDILEDNDGQYDVI 627
           + PGP LV+ P STL NWLRE N++ PD+      G ++ERAEL  + +L      +DV+
Sbjct: 243 KIPGPFLVIAPKSTLNNWLREINRWTPDVNAFILQGDKEERAELIQKKLL---GCDFDVV 299

Query: 628 VTTYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPL 687
           + +Y +    K   S LK   +  ++ DE H +KN  S     L +  +  RLL+TGTPL
Sbjct: 300 IASYEIIIREK---SPLKKINWEYIIIDEAHRIKNEESMLSQVLREFTSRNRLLITGTPL 356

Query: 688 QNNLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMMK 747
           QNNL EL +LL F++P++F S   D    F   +   D +K          + +  T+++
Sbjct: 357 QNNLHELWALLNFLLPDIF-SDAQDFDDWFSSESTEEDQDK---------IVKQLHTVLQ 406

Query: 748 PFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXX 807
           PF+LRR K  V   L  K     Y  MS +Q+  Y + +++ LD                
Sbjct: 407 PFLLRRIKSDVETSLLPKKELNLYVGMSSMQKKWYKKILEKDLD---------------- 450

Query: 808 XXPTKKNGGAQISK----NLIMSLRKAALHPLLF 837
                 + G++ SK    N++M LRK   HP LF
Sbjct: 451 --AVNGSNGSKESKTRLLNIMMQLRKCCNHPYLF 482

 Score =  122 bits (307), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 63/144 (43%), Positives = 92/144 (63%), Gaps = 1/144 (0%)

Query: 924  KVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIP-VFILSTK 982
            +VL+FS  +++LDILE      N  + R+DGST   DR   ID ++  D+   VF+L+T+
Sbjct: 520  RVLIFSQMSRLLDILEDYCYFRNYEYCRIDGSTAHEDRIQAIDDYNAPDSKKFVFLLTTR 579

Query: 983  AGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQL 1042
            AGG GINL  A+ V+++D  +NP  D QA DR+HR+GQ K V +  L+T NS+EEKIL+ 
Sbjct: 580  AGGLGINLTSADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILER 639

Query: 1043 AKNKLALDTYISEDDSKAAEALEN 1066
            A  KL LD  + + +  + +  EN
Sbjct: 640  ATQKLRLDQLVIQQNRTSLKKKEN 663

>Scas_597.8
          Length = 1065

 Score =  182 bits (462), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 117/336 (34%), Positives = 178/336 (52%), Gaps = 47/336 (13%)

Query: 511 FKQKPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQNN 570
           F++ P  ++   TL++YQ  G+NWL  L+++ L+ ILADEMGLGKT Q I+FL YL+   
Sbjct: 121 FRESPGFING--TLRNYQIQGLNWLVSLHKSKLAGILADEMGLGKTLQTISFLGYLRYVE 178

Query: 571 E-PGPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAEL-RDILEDNDGQYDVIV 628
           + PGP LV+ P STL NWLRE NK+ P++      G ++ERA+L +D L   D  +D++V
Sbjct: 179 KIPGPFLVIAPKSTLNNWLREINKWTPEVNAFILQGDKEERAQLVKDKLLACD--FDIVV 236

Query: 629 TTYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQ 688
            +Y +    K   S  +   +  ++ DE H +KN  S     L +  ++ RLL+TGTPLQ
Sbjct: 237 ASYEIIIREK---SAFRKIDWQYIIIDEAHRIKNEESLLSQVLREFTSSNRLLITGTPLQ 293

Query: 689 NNLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMMKP 748
           NNL EL +LL F++P++F S   D    F       D  K          + +  T+++P
Sbjct: 294 NNLHELWALLNFLLPDIF-SDSQDFDDWFSSETTEEDQEK---------VVKQLHTVLQP 343

Query: 749 FILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXX 808
           F+LRR K+ V   L  K     Y  MS++Q+  Y + +++ +D                 
Sbjct: 344 FLLRRLKNDVETSLLPKQELNLYVGMSNMQKKWYKQILEKDIDAV--------------- 388

Query: 809 XPTKKNGGAQISK-------NLIMSLRKAALHPLLF 837
                  G+ ++K       N++M LRK   HP LF
Sbjct: 389 ------NGSNVNKESKTRLLNIVMQLRKCCNHPYLF 418

 Score =  118 bits (296), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 86/131 (65%), Gaps = 1/131 (0%)

Query: 924  KVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIP-VFILSTK 982
            +VL+FS  +++LDILE         + R+DGST   DR   ID++++  +   +F+L+T+
Sbjct: 456  RVLIFSQMSRVLDILEDYCFFRGYEYCRIDGSTDHEDRIRAIDEYNEPGSKKFIFLLTTR 515

Query: 983  AGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQL 1042
            AGG GINL  AN V++FD  +NP  D QA DR+HR+GQ + V +  L+T NS+EEKIL+ 
Sbjct: 516  AGGLGINLTSANIVVLFDSDWNPQADLQAMDRAHRIGQKRQVKVFRLVTDNSVEEKILER 575

Query: 1043 AKNKLALDTYI 1053
            A  KL LD  +
Sbjct: 576  ATQKLRLDQLV 586

>ADL098C [1643] [Homologous to ScYFR038W (MEI4) - SH]
           (508448..510862) [2415 bp, 804 aa]
          Length = 804

 Score =  180 bits (456), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 110/283 (38%), Positives = 160/283 (56%), Gaps = 23/283 (8%)

Query: 513 QKPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQNNEP 572
           Q+P L+  + TLK YQ  G+NWL  LY N L+ ILADEMGLGKT Q IA L+++ + +  
Sbjct: 177 QQPTLVR-NCTLKPYQVEGVNWLITLYENGLNGILADEMGLGKTIQSIALLAFIYEMDTR 235

Query: 573 GPHLVVVPSSTLENWLREFNKFCPDLKIEPYY---GSQQERAELRDILEDNDGQYDVIVT 629
           GP LV  P S ++NW+ EF KF P + +  YY   G  +  A L++    N G+  V+VT
Sbjct: 236 GPFLVTAPLSVVDNWITEFEKFAPSIPVLKYYSADGPGKRHAILKEFFRKNSGE-GVVVT 294

Query: 630 TYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQN 689
           +Y +      D++ + +  +  ++ DEGH LKN   +   +L +I    RLLLTGTPLQN
Sbjct: 295 SYEIV---MRDMNVILSHQWKFLIVDEGHRLKNINCKLIRELKRINTFNRLLLTGTPLQN 351

Query: 690 NLKELMSLLEFIMPNLF-----ISKKNDLSAVFRQRARTSDSNKDYNPLLAQE----AIA 740
           NL EL SLL FI+P++F      SK  D S +         S++ ++ ++ +E     + 
Sbjct: 352 NLAELWSLLNFILPDVFADFEIFSKWFDFSDL-----DLKTSSQRWDKIIGEELEKNLVT 406

Query: 741 RAKTMMKPFILRRRKDQVLK-HLPHKHSKIEYCEMSDVQRTIY 782
              T++KPF+LRR K  VL   LP K   I  C ++ +Q   Y
Sbjct: 407 NLHTILKPFLLRRLKRVVLADALPPKREYIINCPLTPLQTRFY 449

 Score =  106 bits (265), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 89/151 (58%), Gaps = 2/151 (1%)

Query: 904  SGKITALRKILENIIEHKKEKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQA 963
            SGK+  L+++L  ++   K KVL+FS F  MLD++E      N +  R+DGS     R+ 
Sbjct: 560  SGKLQILQQLLPRLLA-AKHKVLIFSQFVSMLDLIEDWCELNNYSACRIDGSMDNETRRE 618

Query: 964  LIDKFHDDDTI-PVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTK 1022
             I+ F +  +   +F+LST+AGG GINL  A++VI+FD  +NP  D QA DRSHR+GQ  
Sbjct: 619  QINSFSEKGSPHSLFLLSTRAGGLGINLTAADSVILFDNDWNPQVDLQAMDRSHRIGQQH 678

Query: 1023 TVHITTLITRNSIEEKILQLAKNKLALDTYI 1053
             V +  L    ++E  IL  A NK  L+  +
Sbjct: 679  PVIVYRLYCDKTVESVILARATNKRKLEQLV 709

>AFL040W [3153] [Homologous to ScYBR245C (ISW1) - SH]
           complement(363162..366422) [3261 bp, 1086 aa]
          Length = 1086

 Score =  180 bits (456), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 123/334 (36%), Positives = 175/334 (52%), Gaps = 43/334 (12%)

Query: 511 FKQKPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQ-N 569
           F++ P  +  D  L+ YQ  G+NWL  L++NNL+ ILADEMGLGKT Q I FL YL+   
Sbjct: 133 FRESPGFV--DGRLRPYQVQGVNWLVSLHKNNLAGILADEMGLGKTLQTITFLGYLRYIE 190

Query: 570 NEPGPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAEL--RDILEDNDGQYDVI 627
            + GP LV+ P STL NW RE N++ PD+      G ++ERA L    +L  N   +DV 
Sbjct: 191 KKRGPFLVIAPKSTLNNWQREINRWTPDVDAFILQGDKEERARLCQERLLACN---FDVA 247

Query: 628 VTTYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPL 687
           + +Y +    K   SF K   +  +V DE H +KN  S     L +  +  RLL+TGTPL
Sbjct: 248 IASYEIIIREK--ASF-KKIDWEYIVIDEAHRIKNEESMLSQVLREFSSRNRLLITGTPL 304

Query: 688 QNNLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMMK 747
           QNNL EL +LL F++P++F       SA F +   +  S+ D + ++ Q       T+++
Sbjct: 305 QNNLHELWALLNFLLPDIFSD-----SAAFDEWFSSEASDDDKDKIVKQ-----LHTILQ 354

Query: 748 PFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXX 807
           PF+LRR K  V   L  K     Y  MS +QR  Y + +++ LD                
Sbjct: 355 PFLLRRIKSDVETSLLPKKELNLYVGMSSMQRKWYKQILEKDLD---------------- 398

Query: 808 XXPTKKNGGAQISK----NLIMSLRKAALHPLLF 837
                 + G++ SK    N++M LRK   HP LF
Sbjct: 399 --AVNGSNGSKESKTRLLNIMMQLRKCCNHPYLF 430

 Score =  120 bits (301), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 86/131 (65%), Gaps = 1/131 (0%)

Query: 924  KVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIP-VFILSTK 982
            +VL+FS  +++LDILE         + R+DGST   DR   ID+++  D+   +F+L+T+
Sbjct: 468  RVLIFSQMSRLLDILEDYCYFRGYEYCRIDGSTAHEDRIEAIDEYNAPDSRKFIFLLTTR 527

Query: 983  AGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQL 1042
            AGG GINL  A+ V+++D  +NP  D QA DR+HR+GQ K V +  L+T NS+EEKIL+ 
Sbjct: 528  AGGLGINLTTADVVVLYDSDWNPQADLQAMDRAHRIGQKKQVKVFRLVTDNSVEEKILER 587

Query: 1043 AKNKLALDTYI 1053
            A  KL LD  +
Sbjct: 588  ATQKLRLDQLV 598

>Scas_664.9
          Length = 1859

 Score =  177 bits (450), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 106/276 (38%), Positives = 153/276 (55%), Gaps = 26/276 (9%)

Query: 523  TLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLS---------YLKQNNEPG 573
            TL+ YQQ G+NWL  L +  L  IL D+MGLGKT Q I  ++         Y K N+   
Sbjct: 1266 TLRKYQQDGVNWLAFLNKYRLHGILCDDMGLGKTLQTICIIASDQYLRAEDYKKTNSVET 1325

Query: 574  ---PHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQYDVIVTT 630
               P L+V P S   +W  EF ++ P LKI  Y G    R  LRD L    G  D+++T+
Sbjct: 1326 RKLPSLIVCPPSLTGHWENEFEQYAPFLKIIVYAGGPSMRIPLRDEL----GSADIVITS 1381

Query: 631  YNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNN 690
            Y++A   + D+S +    FN  V DEGH++KN+ S+    + +I AN RL+LTGTP+QNN
Sbjct: 1382 YDVA---RNDLSIITKYDFNYCVLDEGHIIKNAQSKLAKAVKQISANHRLILTGTPIQNN 1438

Query: 691  LKELMSLLEFIMPNLFISKK----NDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMM 746
            + EL SL +F+MP    ++K         +   R   + S +    +LA EA+ +    +
Sbjct: 1439 VVELWSLFDFLMPGFLGTEKMFQEKFAKPIAASRNSKTSSKEQEAGVLALEALHK---QV 1495

Query: 747  KPFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIY 782
             PF+LRR K+ VL  LP K  +  YCE+SD+Q+ +Y
Sbjct: 1496 LPFMLRRLKEDVLSDLPPKIIQDYYCELSDLQKQLY 1531

 Score =  109 bits (273), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 74/233 (31%), Positives = 123/233 (52%), Gaps = 37/233 (15%)

Query: 864  NKEYIQEDMSYMNDFELHRLCTRFPD--SLAKFQ--LKND-----EWMNSGKITALRKIL 914
            N ++I + + YM     H      P+   LA+ Q  LK       + +N+ K+ ALR +L
Sbjct: 1554 NSQHIFQALQYMRKLCNHPALVLSPNHPQLAQVQDYLKQTGIDLHDVINAPKLNALRTLL 1613

Query: 915  ----------------------ENIIEHKKEKVLVFSLFTQMLDILEMAL---TTLNINF 949
                                  +N+I   + + L+F     MLD++E  L      ++ +
Sbjct: 1614 FECGIGEEDMERKSNPNQYLTGQNVIS--QHRALIFCQLKDMLDMVENDLFKRYMPSVTY 1671

Query: 950  LRLDGSTQVNDRQALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDK 1009
            +RLDGS    DRQ ++ KF++D +I   +L+TK GG G+NL  A+ VI  +  +NP +D 
Sbjct: 1672 MRLDGSVDPRDRQKVVRKFNEDPSIDCLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDL 1731

Query: 1010 QAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLAL-DTYISEDDSKAA 1061
            QA DR+HR+GQ K V++  +IT+ ++EEKI+ L K K+ +  T +++ +S  A
Sbjct: 1732 QAMDRAHRLGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTVVNQQNSGLA 1784

>KLLA0E23804g 2108059..2113680 similar to sp|P32333 Saccharomyces
            cerevisiae YPL082c MOT1 transcriptional accessory
            protein, start by similarity
          Length = 1873

 Score =  177 bits (449), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 107/286 (37%), Positives = 161/286 (56%), Gaps = 44/286 (15%)

Query: 523  TLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLS---YLK---------QNN 570
            TL+ YQQ G+NWL  L + +L  IL D+MGLGKT Q I  ++   YL+         +  
Sbjct: 1286 TLRKYQQDGVNWLAFLNKYHLHGILCDDMGLGKTLQTICIIASDQYLRSEDYKKTQSEKT 1345

Query: 571  EPGPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQY---DVI 627
             P P L++ P S   +W +EF ++ P L +  Y G    R  L+       GQ    D++
Sbjct: 1346 RPLPSLIICPPSLTGHWEQEFQQYSPTLNVLVYAGGPSVRYPLQ-------GQVPTADIV 1398

Query: 628  VTTYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPL 687
            VT+Y++A   + DV FLK   +N  V DEGH++KNS S+    +  I +N RL+LTGTP+
Sbjct: 1399 VTSYDVA---RNDVDFLKKYDYNYCVLDEGHIIKNSQSKLAKAVKLINSNHRLVLTGTPI 1455

Query: 688  QNNLKELMSLLEFIMPNLFISKKNDLSAVFRQR----------ARTSDSNKDYNPLLAQE 737
            QNN+ EL SL +F+MP    ++K     +F++R          ++TS   ++    LA E
Sbjct: 1456 QNNVVELWSLFDFLMPGFLGTEK-----MFQERFAKPIASSRNSKTSSKEQEAGA-LALE 1509

Query: 738  AIARAKTMMKPFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYN 783
            A+ +    + PF+LRR K++VL  LP K  +  YCE+SD+Q+ +YN
Sbjct: 1510 ALHK---QVLPFMLRRLKEEVLSDLPPKIIQDYYCELSDLQKQLYN 1552

 Score =  113 bits (282), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 57/143 (39%), Positives = 92/143 (64%), Gaps = 5/143 (3%)

Query: 914  LENIIEHKKEKVLVFSLFTQMLDILEMALT---TLNINFLRLDGSTQVNDRQALIDKFHD 970
            ++N+I   + +VL+F     MLD++E  L      ++ F+RLDGS    DRQ ++ KF++
Sbjct: 1653 IDNVIS--QHRVLIFCQLKDMLDMVENDLLKKHLPSVTFMRLDGSVDSRDRQKVVRKFNE 1710

Query: 971  DDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLI 1030
            D +I   +L+TK GG G+NL  A+ VI  +  +NP +D QA DR+HR+GQ K V++  +I
Sbjct: 1711 DPSIDCLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQAMDRAHRLGQKKVVNVYRII 1770

Query: 1031 TRNSIEEKILQLAKNKLALDTYI 1053
            T+ ++EEKI+ L K K+ + + I
Sbjct: 1771 TKGTLEEKIMGLQKFKMNIASTI 1793

>Scas_718.40
          Length = 926

 Score =  175 bits (444), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 152/527 (28%), Positives = 239/527 (45%), Gaps = 94/527 (17%)

Query: 544  SCILADEMGLGKTCQVIAFL-SYLKQN--------NEPGPHL--------VVVPSSTLEN 586
             C+LADEMGLGKT   I  + + LKQ+        ++ G  L        VV P + + N
Sbjct: 303  GCLLADEMGLGKTLMTITLIWTLLKQSPSLKNIACSQSGVPLHGLCRKILVVCPVTLIGN 362

Query: 587  WLREFNKFCPDLKIEPYYGSQQERAELRDILEDN----DGQYDVIVTTYNLASGNKYDVS 642
            W REF K+    +I     S +   E+      N       + V+V  Y        ++ 
Sbjct: 363  WKREFAKWLNLNRIGILTLSSRNTPEMDKTAVKNFLRVQRTFQVLVIGYEKLLSVSEELH 422

Query: 643  FLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEFIM 702
              ++   ++++ DEGH LKN  S+    L  +E   ++LL+GTP+QN+L E  ++++F+ 
Sbjct: 423  GSRDL-IDLLICDEGHRLKNGSSKVLNVLKNLEIKRKILLSGTPIQNDLNEFYTIIDFLN 481

Query: 703  PNLFIS----KKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMM---KPFILRRRK 755
            P +  S    KK  ++ + R R    D+   +N  + +    R+K M+   + F LRR  
Sbjct: 482  PGILGSYPYFKKRFIAPITRGR----DTENRHNEDIIELGEGRSKEMIDITRKFTLRRTN 537

Query: 756  DQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXXPTKKNG 815
              + K+LP K   I +C+ +  Q   +N     +L   R+                  N 
Sbjct: 538  AILSKYLPPKTDIILFCKPTQSQLLAFN----DILSRSRI---------------DFANL 578

Query: 816  GAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAILKEPEYAENGNKEYIQEDMSYM 875
                S  LI   +K    P L                          G+  Y Q  +   
Sbjct: 579  SFNSSLGLITLFKKICNSPTLI-------------------------GDDSYYQSKIR-- 611

Query: 876  NDFELHRLCTRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEH-KKEKVLVFSLFTQM 934
                        PD +   Q + D  +NSGK+  L  +LE I  +   EKV++ S +TQ 
Sbjct: 612  ------------PDGV--IQERYDRSLNSGKLKILMTLLEKIKGNTNNEKVVIVSNYTQT 657

Query: 935  LDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIPVFILSTKAGGFGINLVCAN 994
            LDI++  + +  +   RLDGST    R ++++ F+ + +I  F+LS K+GG G+NL+ A+
Sbjct: 658  LDIIQNLMNSAQMVSCRLDGSTPAKQRDSIVNTFNRNPSIFAFLLSAKSGGVGLNLIGAS 717

Query: 995  NVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQ 1041
             +I+FD  +NP  D QA  R HR GQ K  +I  LIT   I+EKILQ
Sbjct: 718  RLILFDNDWNPSIDLQAMSRIHRDGQKKHCYIYRLITTGCIDEKILQ 764

>YPL082C (MOT1) [5362] chr16 complement(398475..404078)
            Transcriptional Accessory Protein (TAF) involved in RNA
            polymerase II transcriptional repression through
            interaction with TATA-binding protein (TBP), member of
            the Snf2p family of DNA helicases [5604 bp, 1867 aa]
          Length = 1867

 Score =  174 bits (440), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 105/282 (37%), Positives = 160/282 (56%), Gaps = 38/282 (13%)

Query: 523  TLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLS---YLKQNN--------- 570
            TL+ YQQ G+NWL  L + +L  IL D+MGLGKT Q I  ++   YL++ +         
Sbjct: 1271 TLRKYQQDGVNWLAFLNKYHLHGILCDDMGLGKTLQTICIIASDQYLRKEDYEKTRSVES 1330

Query: 571  EPGPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAELRDILEDNDGQYDVIVTT 630
               P L++ P S   +W  EF+++ P LK+  Y G    R  LR  L D     D+IVT+
Sbjct: 1331 RALPSLIICPPSLTGHWENEFDQYAPFLKVVVYAGGPTVRLTLRPQLSD----ADIIVTS 1386

Query: 631  YNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNN 690
            Y++A   + D++ L    +N  V DEGH++KNS S+    + +I AN RL+LTGTP+QNN
Sbjct: 1387 YDVA---RNDLAVLNKTEYNYCVLDEGHIIKNSQSKLAKAVKEITANHRLILTGTPIQNN 1443

Query: 691  LKELMSLLEFIMPNLFISKKNDLSAVFRQR----------ARTSDSNKDYNPLLAQEAIA 740
            + EL SL +F+MP    ++K     +F++R          ++TS   ++   +LA EA+ 
Sbjct: 1444 VLELWSLFDFLMPGFLGTEK-----MFQERFAKPIAASRNSKTSSKEQEAG-VLALEALH 1497

Query: 741  RAKTMMKPFILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIY 782
            +    + PF+LRR K+ VL  LP K  +  YCE+ D+Q+ +Y
Sbjct: 1498 K---QVLPFMLRRLKEDVLSDLPPKIIQDYYCELGDLQKQLY 1536

 Score =  111 bits (277), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 72/233 (30%), Positives = 121/233 (51%), Gaps = 37/233 (15%)

Query: 864  NKEYIQEDMSYMNDFELHRLCTRFP---------DSLAKFQLKNDEWMNSGKITALRKIL 914
             K++I + + YM     H      P         D L +  L   + +N+ K++ALR +L
Sbjct: 1559 GKQHIFQALQYMRKLCNHPALVLSPNHPQLAQVQDYLKQTGLDLHDIINAPKLSALRTLL 1618

Query: 915  ----------------------ENIIEHKKEKVLVFSLFTQMLDILEMAL---TTLNINF 949
                                  +N+I   + + L+F     MLD++E  L      ++ +
Sbjct: 1619 FECGIGEEDIDKKASQDQNFPIQNVI--SQHRALIFCQLKDMLDMVENDLFKKYMPSVTY 1676

Query: 950  LRLDGSTQVNDRQALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDK 1009
            +RLDGS    DRQ ++ KF++D +I   +L+TK GG G+NL  A+ VI  +  +NP +D 
Sbjct: 1677 MRLDGSIDPRDRQKVVRKFNEDPSIDCLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDL 1736

Query: 1010 QAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLAL-DTYISEDDSKAA 1061
            QA DR+HR+GQ K V++  +IT+ ++EEKI+ L K K+ +  T +++ +S  A
Sbjct: 1737 QAMDRAHRIGQKKVVNVYRIITKGTLEEKIMGLQKFKMNIASTVVNQQNSGLA 1789

>KLLA0F06710g 645650..648940 similar to sp|P38144 Saccharomyces
           cerevisiae YBR245c ISW1, start by similarity
          Length = 1096

 Score =  170 bits (430), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 121/333 (36%), Positives = 175/333 (52%), Gaps = 41/333 (12%)

Query: 511 FKQKPKLLSPDVTLKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQ-N 569
           F++ P  ++    L+ YQ  G+NWL  L++N L+ ILADEMGLGKT Q IAFL YL+   
Sbjct: 130 FRESPAYVNG--QLRPYQIQGLNWLVALHKNQLAGILADEMGLGKTLQTIAFLGYLRYIE 187

Query: 570 NEPGPHLVVVPSSTLENWLREFNKFCPDLKIEPYYGSQQERAEL-RDILEDNDGQYDVIV 628
            + GP LV+ P STL NWLRE N++ P++      G ++ER++L  D L   D  +D+ V
Sbjct: 188 KKNGPFLVIAPKSTLNNWLREINRWTPEVSAFILQGDKEERSKLCHDKLLACD--FDICV 245

Query: 629 TTYNLASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQ 688
            +Y +    K   SF K   +  VV DE H +KN  S     L +  +  RLL+TGTPLQ
Sbjct: 246 ASYEIIIREK--ASF-KKIDWEYVVIDEAHRIKNEESMLSQVLREFSSRNRLLITGTPLQ 302

Query: 689 NNLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMMKP 748
           NNL EL +LL F++P++F       SA F +   +  S +D   ++ Q       T++ P
Sbjct: 303 NNLHELWALLNFLLPDIFAD-----SATFDEWFSSESSEEDKEKVVKQ-----LHTVLSP 352

Query: 749 FILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXX 808
           F+LRR K+ V   L  K     Y  MS +Q+  Y + +++ +D                 
Sbjct: 353 FLLRRIKNDVEGSLLPKKELNVYVGMSSMQKKWYKQILEKDID----------------- 395

Query: 809 XPTKKNGGAQISK----NLIMSLRKAALHPLLF 837
                + G + SK    N++M LRK   HP LF
Sbjct: 396 -AVNGSNGQKESKTRLLNIVMQLRKCCNHPYLF 427

 Score =  116 bits (291), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 84/131 (64%), Gaps = 1/131 (0%)

Query: 924  KVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIP-VFILSTK 982
            +VL+FS  +++LDILE         + R+DGST   DR   ID ++  D+   +F+L+T+
Sbjct: 465  RVLIFSQMSRVLDILEDYCYFREYEYCRIDGSTAHEDRINAIDDYNAPDSKKFIFLLTTR 524

Query: 983  AGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQL 1042
            AGG GINL  A+ V+++D  +NP  D QA DR+HR+GQ K V +   +T NS+EEKIL+ 
Sbjct: 525  AGGLGINLTTADIVVLYDSDWNPQADLQAMDRAHRIGQKKQVRVFRFVTDNSVEEKILER 584

Query: 1043 AKNKLALDTYI 1053
            A  KL LD  +
Sbjct: 585  ATQKLKLDQLV 595

>Scas_591.10
          Length = 772

 Score =  147 bits (372), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 159/606 (26%), Positives = 256/606 (42%), Gaps = 107/606 (17%)

Query: 522  VTLKDYQQTGINWL----NLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQNNEPGPHLV 577
            + L  +Q  G++WL      +++     +LADEMG+GKT Q IA L     +    P LV
Sbjct: 164  IKLLPFQLEGLHWLIQQEEGIFKGG---VLADEMGMGKTIQTIALL---MNDLTKRPSLV 217

Query: 578  VVPSSTLENWLREFNKFCPD-LKIEPYYGSQQERAELRDILEDNDGQYDVIVTTYNLAS- 635
            V P+  L  W  E N+     LK+  ++G+       ++I      +YDV++TTY +   
Sbjct: 218  VAPTVALMQWKNEINQHTDGKLKVYMFHGTS------KNIDIKTLSEYDVVLTTYAVLES 271

Query: 636  -------------GNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLL 682
                         G   ++S L N  F  V+ DE H +K+  S     +  ++   R  L
Sbjct: 272  VFRKQNYGFKRKHGVVKELSVLHNIEFYRVILDEAHNIKDRQSNTARAVNNLKTQKRWCL 331

Query: 683  TGTPLQNNLKELMSLLEFI----MPNLFISKK--NDLSAVFRQRARTSDSNKD------- 729
            TGTPLQN + E+ SL+ F+        F +K   N     F         N         
Sbjct: 332  TGTPLQNRIGEMYSLIRFLNIEPFSKYFCTKCDCNSKEWHFSDNMHCDSCNHVLMQHTNF 391

Query: 730  YNPLLAQ------------EAIARAKTMMKPFILRRRKDQVLKHL--PHKHSKIEYCEMS 775
            +N  + +            E+    +T++K  +LRR K +    L  P +        + 
Sbjct: 392  FNHFMLKNIQKFGVEGPGLESFQNIQTLLKNIMLRRTKVERADDLGLPPR--------IV 443

Query: 776  DVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXXPTKKNGGAQISKNLIMSLRKAALHPL 835
             V+R  +N E + +  ++ +                  N  A I  +LI  +R+ A HP 
Sbjct: 444  TVRRDFFNEEEKDL--YRSLYSDSQRKYNSYVEEGVVLNNYANIF-SLITRMRQLADHPD 500

Query: 836  LFRHHYDD------VMLDKMSRAILKEP-------EYAENGNKEYIQEDMSYMNDFELHR 882
            L    + D      V++ ++   + +EP       ++     KEYI+   S+M + +   
Sbjct: 501  LVLKRFHDQANVTGVIVCQLCDDVAEEPIASKCHHKFCRMCIKEYIE---SFMENNDSKL 557

Query: 883  LC----TRFPDSLAKFQLKND-----------------EWMNSGKITALRKILENIIEHK 921
             C          L++  L+ D                  W +S KI AL + L  +    
Sbjct: 558  TCPVCHIGLSIDLSQPSLEIDLDSFKKQSIVSRLNMKGTWQSSTKIEALVEELYKLRSPV 617

Query: 922  KE-KVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIPVFILS 980
            +  K +VFS FT MLD++E  L       ++L GS     R   I  F ++    VF++S
Sbjct: 618  RTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSPTQRDETIKYFMNNIECEVFLVS 677

Query: 981  TKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKIL 1040
             KAGG  +NL  A+ V I D  +NP  + Q+ DR HR+GQ + V IT     +SIE +I+
Sbjct: 678  LKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQFRPVKITRFCIEDSIESRII 737

Query: 1041 QLAKNK 1046
            +L + K
Sbjct: 738  ELQEKK 743

>Kwal_34.16082
          Length = 726

 Score =  124 bits (311), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 108/423 (25%), Positives = 182/423 (43%), Gaps = 92/423 (21%)

Query: 524 LKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQNNE-PGPHLVVVPSS 582
           L +YQ+T + WL  L++     I+ DEMGLGKT Q+IAFL+ L  + +  GP L+V P++
Sbjct: 263 LFNYQKTCVQWLYELFQQQCGGIIGDEMGLGKTIQIIAFLASLHHSGKLDGPVLIVCPAT 322

Query: 583 TLENWLREFNKFCP-----------------------------------DLKIEPYYGSQ 607
            L  W +EF+ + P                                   +L  + Y  S+
Sbjct: 323 VLRQWCKEFHTWWPPFRTVILHSIGAGMTQKDTISEEKLEELFMNSNPEELSYDAYMDSK 382

Query: 608 QERAELRD------ILEDNDGQYDVIVTTYNLASGNKYDVSFLKNRGFNVVVYDEGHMLK 661
           + ++ L        ++     +  +++TTY    G +     L N  ++  V DEGH ++
Sbjct: 383 RTKSTLESGMARSKLINKVVSEGHILITTY---VGLRIHADNLLNVRWSYAVLDEGHKIR 439

Query: 662 NSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEFIMPNLFISKKNDLSAVFRQRA 721
           N  ++      K++   R++L+GTP+QNNL EL SL +FI P    +       VF+Q+ 
Sbjct: 440 NPDADISLTCKKLKTKNRIILSGTPIQNNLTELWSLFDFIYPGRLGT-----LPVFQQQF 494

Query: 722 RTSDSNKDY---NPLLAQEAIARA---KTMMKPFILRRRKDQVLKHLPHKHSKIEYCEMS 775
               +   Y     +  Q     A   + ++ P++LRR K  V K LP K+  + +C+++
Sbjct: 495 SIPINVGGYANATNIQVQTGYKCAIALRNLISPYLLRRIKADVAKDLPKKNEMVLFCKLT 554

Query: 776 DVQRTIY----NRE------------------IQQVLDHKRMLXXXXXXXXXXXXXPTKK 813
             QR  Y    N E                  ++++ +H  +L             P K+
Sbjct: 555 QFQRRKYLQFLNSEDLTKIKNGKRQVLFGIDILRKICNHPDLLEKDKRENESSYGDP-KR 613

Query: 814 NGGAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAI-LKEPEYAENGNKEYIQEDM 872
           +G  Q+ K L+          LLF       MLD + + I  K+PE           ED+
Sbjct: 614 SGKMQVVKQLLRLWHSQGHKTLLFTQSRQ--MLDILEKFISYKDPEL----------EDL 661

Query: 873 SYM 875
           +Y+
Sbjct: 662 TYL 664

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 52/141 (36%), Positives = 83/141 (58%), Gaps = 12/141 (8%)

Query: 880  LHRLCTRFPDSLAKFQLKNDEWMN----SGKITALRKILENIIEHKKEKVLVFSLFTQML 935
            L ++C   PD L K + +N+        SGK+  ++++L  +   +  K L+F+   QML
Sbjct: 587  LRKICNH-PDLLEKDKRENESSYGDPKRSGKMQVVKQLLR-LWHSQGHKTLLFTQSRQML 644

Query: 936  DILEMALT-----TLNINFLRLDGSTQVNDRQALIDKFHDDDTIPVFILSTKAGGFGINL 990
            DILE  ++       ++ +LR+DG+T +  RQAL+D F ++    VF+L+T+ GG G+NL
Sbjct: 645  DILEKFISYKDPELEDLTYLRMDGTTNIGSRQALVDSF-NNGLYDVFLLTTRVGGLGVNL 703

Query: 991  VCANNVIIFDQSFNPHDDKQA 1011
              AN +IIFD  +NP  D QA
Sbjct: 704  TGANRIIIFDPDWNPSTDMQA 724

>Scas_549.4
          Length = 1079

 Score =  124 bits (312), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 112/402 (27%), Positives = 172/402 (42%), Gaps = 85/402 (21%)

Query: 524 LKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQNNE-PGPHLVVVPSS 582
           L +YQ+T + WL  LY+ N   I+ DEMGLGKT Q+IAFL+ L  +    GP L+V P++
Sbjct: 304 LFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQIIAFLASLHHSGLLNGPVLIVCPAT 363

Query: 583 TLENWLREFNKFCPDLK--IEPYYGSQ-----------------------------QERA 611
            ++ W  E + + P L+  I    GS                              Q R+
Sbjct: 364 VMKQWCNELHHWWPPLRTIILHSTGSGMSTKKNFSEEELEQAMMNANPNELTCEDFQNRS 423

Query: 612 ELRDILED------------NDGQYDVIVTTYNLASGNKYDVSFLKNRGFNVVVYDEGHM 659
           + +  LE             NDG   +I+TTY    G +     L    +   V DEGH 
Sbjct: 424 KTKASLESTFNIQSLIDKVINDGH--IIITTY---VGLRIHSEQLLKVNWAYAVLDEGHK 478

Query: 660 LKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEFIMPNLFISKKNDLSAVFRQ 719
           ++N  S+      KI+   R++L+GTP+QNNL EL SL +FI P      K     VF+Q
Sbjct: 479 IRNPDSDISLTCKKIKTPNRIILSGTPIQNNLIELWSLFDFIYPG-----KLGTLPVFQQ 533

Query: 720 RARTSDSNKDY---NPLLAQEAIARA---KTMMKPFILRRRKDQVLKHLPHKHSKIEYCE 773
           +     +   Y     +  Q  +  A   + ++ P++LRR K  V K LP K   + +C+
Sbjct: 534 QFVMPINAGGYANATNIQVQTGVKCATALRNLISPYLLRRVKSDVAKDLPEKKEMVLFCK 593

Query: 774 MSDVQRTIY-----NREIQQ-----------------VLDHKRMLXXXXXXXXXXXXXPT 811
           ++  Q+  Y     + E+ Q                 + +H  +L             P 
Sbjct: 594 LTQYQKNRYLEFLNSNELTQIRGGRRHVLYGIDILRKICNHPDLLEREERQYETDYGNP- 652

Query: 812 KKNGGAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAI 853
           K++G  Q+ K L++   K     LLF       MLD + + I
Sbjct: 653 KRSGKMQVVKQLLLLWHKEGHKTLLFTQSRQ--MLDILEQFI 692

 Score =  110 bits (276), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 62/159 (38%), Positives = 99/159 (62%), Gaps = 15/159 (9%)

Query: 904  SGKITALRKILENIIEHKK-EKVLVFSLFTQMLDILEMALTTLN-----INFLRLDGSTQ 957
            SGK+  ++++L  ++ HK+  K L+F+   QMLDILE  +   +     + +LR+DG++ 
Sbjct: 655  SGKMQVVKQLL--LLWHKEGHKTLLFTQSRQMLDILEQFIQFKDSDLSVLKYLRMDGTSN 712

Query: 958  VNDRQALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHR 1017
            ++ RQ L+D+F+++D   VF+L+T+ GG G+NL  AN +II+D  +NP  D QA +R+ R
Sbjct: 713  ISKRQGLVDQFNNED-YDVFLLTTRVGGLGVNLTGANRIIIYDPDWNPSTDMQARERAWR 771

Query: 1018 VGQTKTVHITTLITRNSIEEKIL------QLAKNKLALD 1050
            +GQ + V I  L+   SIEEKI       Q   NK+  D
Sbjct: 772  IGQKREVSIYRLMVSGSIEEKIYHRQIFKQFLTNKILTD 810

>CAGL0I01694g complement(141422..144637) similar to sp|P40352
           Saccharomyces cerevisiae YJR035w RAD26 DNA repair and
           recombination protein, start by similarity
          Length = 1071

 Score =  124 bits (310), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 109/414 (26%), Positives = 173/414 (41%), Gaps = 92/414 (22%)

Query: 524 LKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQNNE-PGPHLVVVPSS 582
           L +YQ+TG+ WL  L++     I+ DEMGLGKT QV AFL+ L  +N   GP L+V P++
Sbjct: 297 LFNYQKTGVQWLYELFQQRRGGIIGDEMGLGKTIQVTAFLAALHHSNLLSGPVLIVCPAT 356

Query: 583 TLENWLREFNKFCPDLKIEPYYG-------------SQQERAELRDILEDND-------- 621
            ++ W  E +++ P  +    +               + E   ++  LE+ D        
Sbjct: 357 VMKQWCNEIHQWWPPFRAVILHSIGAGMNDKSNLTEDEIENMIIKSELENTDFHDYENAS 416

Query: 622 --------------------GQYDVIVTTYNLASGNKYDVSFLKNRGFNVVVYDEGHMLK 661
                                   +I+TTY    G +     L N  ++  V DEGH ++
Sbjct: 417 KLKSKVETGMHMQNLISKVVADGHIIITTY---VGLRIHSDKLLNVNWSYCVLDEGHKIR 473

Query: 662 NSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEFIMPNLFISKKNDLSAVFRQR- 720
           N  SE      K++   R++L+GTP+QNNL EL SL +FI P    +       VF+Q+ 
Sbjct: 474 NPDSEISLTCKKLKCKNRIILSGTPIQNNLVELWSLFDFIYPGRLGT-----LPVFQQQF 528

Query: 721 -----------ARTSDSNKDYNPLLAQEAIARAKTMMKPFILRRRKDQVLKHLPHKHSKI 769
                      A  +     Y   +A       + ++ P++LRR K  V K LP K   +
Sbjct: 529 VQPINMGGYANATNTQVQTGYRCAVA------LRDLISPYLLRRVKADVAKDLPKKKEMV 582

Query: 770 EYCEMSDVQRTIY-----NREIQQVLDHKRMLXXXXXXXXXXXXXPT------------- 811
            +C++++ QR  Y     + E+ Q+   KR +             P              
Sbjct: 583 LFCKLTEFQRRKYLEFLSSDELSQIKGGKRHVLYGIDILRKICNHPDLLDRDYIKNTSGY 642

Query: 812 ---KKNGGAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAI-LKEPEYAE 861
              K++G  Q+ K L+   +      LLF       MLD +   I  KEPE ++
Sbjct: 643 GDPKRSGKMQVVKQLLKLWKSEGHKTLLFTQSRQ--MLDILEEFIKFKEPELSD 694

 Score =  110 bits (274), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 103/169 (60%), Gaps = 12/169 (7%)

Query: 880  LHRLCTRFPDSLAKFQLKNDEWMN----SGKITALRKILENIIEHKKEKVLVFSLFTQML 935
            L ++C   PD L +  +KN         SGK+  ++++L+ + + +  K L+F+   QML
Sbjct: 621  LRKICNH-PDLLDRDYIKNTSGYGDPKRSGKMQVVKQLLK-LWKSEGHKTLLFTQSRQML 678

Query: 936  DILEMAL-----TTLNINFLRLDGSTQVNDRQALIDKFHDDDTIPVFILSTKAGGFGINL 990
            DILE  +        +I +LR+DG+T +  RQ L+D+F ++++  VF+L+T+ GG G+NL
Sbjct: 679  DILEEFIKFKEPELSDIRYLRMDGTTSIQVRQTLVDRF-NNESYDVFLLTTRVGGLGVNL 737

Query: 991  VCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKI 1039
              AN +II+D  +NP  D QA +R+ R+GQ + V I  L+   +IEEKI
Sbjct: 738  TGANRIIIYDPDWNPSTDLQARERAWRIGQKREVSIYRLMISGTIEEKI 786

>YJR035W (RAD26) [2931] chr10 (497269..500526) Putative helicase
           involved in transcription-coupled repair in some strain
           backgrounds, may have a role in chromatin remodeling,
           homolog of Cockayne syndrome B gene ERCC-6 [3258 bp,
           1085 aa]
          Length = 1085

 Score =  124 bits (310), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 112/411 (27%), Positives = 174/411 (42%), Gaps = 86/411 (20%)

Query: 524 LKDYQQTGINWLNLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQNNE-PGPHLVVVPSS 582
           L +YQ+T + WL  LY+ N   I+ DEMGLGKT QVIAF++ L  +    GP L+V P++
Sbjct: 297 LFNYQKTCVQWLYELYQQNCGGIIGDEMGLGKTIQVIAFIAALHHSGLLTGPVLIVCPAT 356

Query: 583 TLENWLREFNKFCP-------------------------------------DLKIEPYYG 605
            ++ W  EF  + P                                     D   E +  
Sbjct: 357 VMKQWCNEFQHWWPPLRTVILHSMGSGMASDQKFKMDENDLENLIMNSKPSDFSYEDWKN 416

Query: 606 SQQERAELR-----DILED---NDGQYDVIVTTYNLASGNKYDVSFLKNRGFNVVVYDEG 657
           S + +  L      D L D    DG   +++TTY    G +     L    +   V DEG
Sbjct: 417 STRTKKALESSYHLDKLIDKVVTDGH--ILITTY---VGLRIHSDKLLKVKWQYAVLDEG 471

Query: 658 HMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEFIMPNLFISKKNDLSAVF 717
           H ++N  SE      K++ + R++L+GTP+QNNL EL SL +FI P      K     VF
Sbjct: 472 HKIRNPDSEISLTCKKLKTHNRIILSGTPIQNNLTELWSLFDFIFPG-----KLGTLPVF 526

Query: 718 RQRARTSDSNKDY---NPLLAQEAIARA---KTMMKPFILRRRKDQVLKHLPHKHSKIEY 771
           +Q+     +   Y     +  Q     A   + ++ P++LRR K  V K LP K   + +
Sbjct: 527 QQQFVIPINIGGYANATNIQVQTGYKCAVALRDLISPYLLRRVKADVAKDLPQKKEMVLF 586

Query: 772 CEMSDVQRTIY-----NREIQQVLDHKRMLXXXXXXXXXXXXXPT--------------- 811
           C+++  QR+ Y     + ++ Q+ + KR +             P                
Sbjct: 587 CKLTKYQRSKYLEFLHSSDLNQIQNGKRNVLFGIDILRKICNHPDLLDRDTKRHNPDYGD 646

Query: 812 -KKNGGAQISKNLIMSLRKAALHPLLFRHHYDDVMLDKMSRAI-LKEPEYA 860
            K++G  Q+ K L++   K     LLF       MLD +   I  K+P+ +
Sbjct: 647 PKRSGKMQVVKQLLLLWHKQGYKALLFTQSRQ--MLDILEEFISTKDPDLS 695

 Score =  117 bits (293), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 61/142 (42%), Positives = 97/142 (68%), Gaps = 9/142 (6%)

Query: 904  SGKITALRKILENIIEHKKE-KVLVFSLFTQMLDILEMALTTLN-----INFLRLDGSTQ 957
            SGK+  ++++L  ++ HK+  K L+F+   QMLDILE  ++T +     +N+LR+DG+T 
Sbjct: 650  SGKMQVVKQLL--LLWHKQGYKALLFTQSRQMLDILEEFISTKDPDLSHLNYLRMDGTTN 707

Query: 958  VNDRQALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHR 1017
            +  RQ+L+D+F ++++  VF+L+T+ GG G+NL  AN +IIFD  +NP  D QA +R+ R
Sbjct: 708  IKGRQSLVDRF-NNESFDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPSTDMQARERAWR 766

Query: 1018 VGQTKTVHITTLITRNSIEEKI 1039
            +GQ + V I  L+   SIEEKI
Sbjct: 767  IGQKREVSIYRLMVGGSIEEKI 788

>AGL212W [4100] [Homologous to ScYBR073W (RDH54) - SH]
            complement(295808..298519) [2712 bp, 903 aa]
          Length = 903

 Score =  117 bits (292), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 65/148 (43%), Positives = 92/148 (62%), Gaps = 3/148 (2%)

Query: 904  SGKITALRKILENIIEHK-KEKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQ 962
            SGK+  L  +L  I      EKV+V S +TQ LDI+   +++ ++++LRLDGST   +R 
Sbjct: 615  SGKLKVLMSLLHQIAHRSDNEKVVVISNYTQTLDIIGNLMSSASLSYLRLDGSTPAKERD 674

Query: 963  ALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTK 1022
            A+++ F+   TI  F+LS K+GG G+NLV A+ +I+FD  +NP  D QA  R HR GQ K
Sbjct: 675  AIVNDFNRSQTIFGFLLSAKSGGVGLNLVGASRLILFDNDWNPSVDLQAMSRIHRDGQKK 734

Query: 1023 TVHITTLITRNSIEEKIL--QLAKNKLA 1048
               I  L+T   I+EKI   QL KN L+
Sbjct: 735  PCFIYRLVTTGCIDEKIFQRQLMKNNLS 762

 Score =  105 bits (261), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 74/266 (27%), Positives = 129/266 (48%), Gaps = 27/266 (10%)

Query: 544 SCILADEMGLGKTCQVIAFL-SYLKQNNEPGPH----------------LVVVPSSTLEN 586
            C+LADEMGLGKTC  IA + + LKQ+  P                   LVV P + + N
Sbjct: 293 GCLLADEMGLGKTCMTIALIWTLLKQHPRPSSVPCSQLGVALQGICQKVLVVCPVTLIGN 352

Query: 587 WLREFNKFCP-----DLKIEPYYGSQQERAELRDILEDNDGQYDVIVTTYNLASGNKYDV 641
           W +EF K+ P      L +      ++++ ++R+ L      Y V++  Y        ++
Sbjct: 353 WKKEFIKWLPMNRIGILTLSSKNTPEKDKNDVRNFLRVQR-TYQVLILGYEKLLNVFSEL 411

Query: 642 SFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEFI 701
              K++  ++++ DEGH LKNS S+    L  +E   +++LTGTP+QN+L E  +++ FI
Sbjct: 412 DQAKSK-LDLLICDEGHRLKNSSSKILKCLTDLEIERKVILTGTPIQNDLNEFYTIINFI 470

Query: 702 MPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMM---KPFILRRRKDQV 758
            P +  +  +          R  D N  +N  +     +R++ ++   K FILRR    +
Sbjct: 471 NPGILGTFAHFKRVYITPITRARDVNNKHNDQIVSLGESRSQDLIEITKKFILRRTSSII 530

Query: 759 LKHLPHKHSKIEYCEMSDVQRTIYNR 784
             +LP +   + +C+ +  Q   +N+
Sbjct: 531 ADYLPPRTDIVVFCKPTQHQLDAFNQ 556

>Sklu_1582.2 , Contig c1582 197-1048
          Length = 283

 Score =  107 bits (267), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 91/154 (59%), Gaps = 5/154 (3%)

Query: 904  SGKITALRKILENIIEHKKEKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQA 963
            SGK+  L++++  +I ++  KVL+FS F  MLD++E      +    R+DGS     RQ 
Sbjct: 33   SGKLQILQQLVPKLI-NEGHKVLIFSQFVNMLDLIEDWCELNDFQACRIDGSMDNEVRQE 91

Query: 964  LIDKFH----DDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVG 1019
             I KF+    D     VF+LST+AGG GINL  A++V+IFD  +NP  D QA DR+HR+G
Sbjct: 92   QIGKFNSKTTDSHANDVFLLSTRAGGLGINLTAADSVVIFDSDWNPQVDLQAMDRTHRIG 151

Query: 1020 QTKTVHITTLITRNSIEEKILQLAKNKLALDTYI 1053
            Q + V +  L   N++E  IL  A +K  L+  +
Sbjct: 152  QDRPVIVYRLCCDNTVEHVILTRAVSKRKLEKLV 185

>YGL163C (RAD54) [1826] chr7 complement(193711..196407)
           DNA-dependent ATPase of the Snf2p family, required for
           mitotic recombination and DNA repair of X-ray damage
           [2697 bp, 898 aa]
          Length = 898

 Score =  113 bits (283), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 85/278 (30%), Positives = 131/278 (47%), Gaps = 45/278 (16%)

Query: 540 RNNLSCILADEMGLGKTCQVIAFLSYLKQNNEPGPHLV-----VVPSSTLENWLREFNKF 594
           R    CI+ADEMGLGKT Q IA +  L +    G  L+     V PSS + NW  E  K+
Sbjct: 326 RGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANELIKW 385

Query: 595 CPDLKIEPYYGSQQE------------------RAELRDILEDNDGQYDVIVTTYNLASG 636
                + P     ++                  +A+ R+I++       V++ +Y     
Sbjct: 386 LGPNTLTPLAVDGKKSSMGGGNTTVSQAIHAWAQAQGRNIVKP------VLIISYETLRR 439

Query: 637 NKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMS 696
           N   V  LKN    +++ DEGH LKN  S  FT L  I    R++L+GTP+QN+L E  +
Sbjct: 440 N---VDQLKNCNVGLMLADEGHRLKNGDSLTFTALDSISCPRRVILSGTPIQNDLSEYFA 496

Query: 697 LLEFIMPNLFISKKNDLSAVFRQ-------RARTSDSNKDYNPLLAQEAIARAKTMMKPF 749
           LL F  P L  S+     A FR+       R R +D+  D      +  + +  T++  F
Sbjct: 497 LLSFSNPGLLGSR-----AEFRKNFENPILRGRDADAT-DKEITKGEAQLQKLSTIVSKF 550

Query: 750 ILRRRKDQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQ 787
           I+RR  D + K+LP K+  + +  +  +Q  +YN+ I+
Sbjct: 551 IIRRTNDILAKYLPCKYEHVIFVNLKPLQNELYNKLIK 588

 Score =  110 bits (274), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 90/151 (59%), Gaps = 1/151 (0%)

Query: 904  SGKITALRKILENIIEHKKEKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQA 963
            S K + L + L  I     +K+++ S +TQ LD++E      + + +RLDG+  +N RQ 
Sbjct: 654  SAKFSILERFLHKIKTESDDKIVLISNYTQTLDLIEKMCRYKHYSAVRLDGTMSINKRQK 713

Query: 964  LIDKFHDDDTIP-VFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTK 1022
            L+D+F+D +    +F+LS+KAGG GINL+ AN +I+ D  +NP  D+QA  R  R GQ K
Sbjct: 714  LVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK 773

Query: 1023 TVHITTLITRNSIEEKILQLAKNKLALDTYI 1053
               I   I+  +IEEKI Q    K++L + +
Sbjct: 774  DCFIYRFISTGTIEEKIFQRQSMKMSLSSCV 804

>Kwal_27.10513
          Length = 900

 Score =  113 bits (283), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 61/149 (40%), Positives = 96/149 (64%), Gaps = 3/149 (2%)

Query: 903  NSGKITALRKILENIIE-HKKEKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDR 961
            +SGK+  L  +L+N+ +   +EKV++ S +TQ LDI++  + + +++F RLDGST   DR
Sbjct: 612  DSGKLRVLMALLDNLRKLSPQEKVVIVSNYTQTLDIIQNMICSNSLSFTRLDGSTANKDR 671

Query: 962  QALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQT 1021
              +++ F+   +I  F+LS K+GG G+NL+ A+ +I+FD  +NP  D QA  R HR GQ 
Sbjct: 672  DKIVNSFNTVPSIFAFLLSAKSGGMGLNLIGASRLILFDNDWNPAIDLQAMSRIHRDGQK 731

Query: 1022 KTVHITTLITRNSIEEKIL--QLAKNKLA 1048
            +  +I  L+T   I+EKI   QLAK  L+
Sbjct: 732  RECYIYRLLTTGCIDEKIFQRQLAKTSLS 760

 Score = 96.3 bits (238), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 75/281 (26%), Positives = 135/281 (48%), Gaps = 36/281 (12%)

Query: 545 CILADEMGLGKTCQVIAFL-SYLKQNNEPGPH----------------LVVVPSSTLENW 587
           C+LADEMGLGKT   I  + + LKQ   P                   LVV P + + NW
Sbjct: 294 CLLADEMGLGKTLMTITLVWTLLKQTPIPSKANSSQNGISLQGLCNKILVVCPVTLIGNW 353

Query: 588 LREFNKF-----CPDLKIEPYYGSQQERAELRDILEDNDGQYDVIVTTYNLASGNKYDVS 642
            REF+K+        L +     +++++  +R+ L      Y V+V  Y        ++ 
Sbjct: 354 KREFSKWLNVNRIGILTLSSKSNAEKDKLTVRNFLRVQR-TYQVLVIGYEKLLSVTEELL 412

Query: 643 FLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEFIM 702
             K++  ++V+ DEGH LKN  S+    +  +E   +++LTGTP+QN+L E  ++ +F+ 
Sbjct: 413 EAKSK-IDLVICDEGHRLKNGQSKTLKAISSLEVPRKIMLTGTPIQNDLAEFFTIADFLN 471

Query: 703 PNLFIS----KKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMM---KPFILRRRK 755
             +  +    K++ ++ + R R    D N  +N L+ ++   + + ++   K F LRR  
Sbjct: 472 DGILGTFSKFKRDFINPITRAR----DLNNKHNNLIQEKGRDKTQELIEITKNFTLRRTA 527

Query: 756 DQVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQV-LDHKRM 795
           + + K LP K   + +C+ +  Q   + + +    LD  R+
Sbjct: 528 ETISKFLPSKTDVVLFCKPTSGQLDAFRKTLSAAQLDFSRL 568

>KLLA0F11814g complement(1089699..1092494) similar to sp|P38086
            Saccharomyces cerevisiae YBR073w RDH54 required for
            mitotic diploid-specific recombination and repair and
            meiosis, start by similarity
          Length = 931

 Score =  113 bits (282), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 87/148 (58%)

Query: 902  MNSGKITALRKILENIIEHKKEKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDR 961
              SGK+  L  +L  +     EKV+V S +TQ LDI+E   ++      RLDGST    R
Sbjct: 632  FTSGKLRILLSLLHELKTKTDEKVVVISNYTQTLDIIEGHCSSEGYTSARLDGSTATKTR 691

Query: 962  QALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQT 1021
              ++  F++D +I VF+LS K+GG G+NL+ A+ +++FD  +NP  D QA  R HR GQ 
Sbjct: 692  DQIVTSFNNDPSIFVFLLSAKSGGVGLNLIGASRLVLFDNDWNPSIDLQAMSRIHRDGQR 751

Query: 1022 KTVHITTLITRNSIEEKILQLAKNKLAL 1049
            +   I  L+T   I+EKILQ    K+AL
Sbjct: 752  RPCFIYRLVTTGCIDEKILQRQLMKIAL 779

 Score =  105 bits (261), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 75/264 (28%), Positives = 130/264 (49%), Gaps = 25/264 (9%)

Query: 544 SCILADEMGLGKTCQVIAFL-SYLKQNNEP--------------GPHLVVVPSSTLENWL 588
            C+LADEMGLGKT   I  + + LKQ   P                 L+V P + + NW 
Sbjct: 315 GCLLADEMGLGKTLMTITLIWTLLKQTPYPTIINQRGVTLAGEISKVLIVCPVTLIGNWK 374

Query: 589 REFNKFCP-----DLKIEPYYGSQQERAELRDILEDNDGQYDVIVTTYNLASGNKYDVSF 643
           +EF K+ P      L +       +++A++R  L+     Y V++  Y      K ++  
Sbjct: 375 KEFKKWLPMNRIGVLTLHSRNSPTEDKAQVRSFLK-VPRTYQVLIVGYEKLLSIKDELQN 433

Query: 644 LKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEFIMP 703
            K R  ++V+ DEGH LKN  S+    L  ++   +++L+GTP+QN+L+E  ++++FI P
Sbjct: 434 EK-RNLDLVICDEGHRLKNKDSKILKVLQSLDIEKKIVLSGTPIQNDLEEFYTIIDFINP 492

Query: 704 NLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMM---KPFILRRRKDQVLK 760
            +  S            AR+ D N   N  L ++ + R+  ++   K FILRR  + + +
Sbjct: 493 GILGSFGRFKREYILPIARSRDVNAKQNQTLVEQGLLRSDQLIEITKRFILRRTNEILQQ 552

Query: 761 HLPHKHSKIEYCEMSDVQRTIYNR 784
           +LP +   I +C+ +  Q   +++
Sbjct: 553 YLPPRTDLIIFCKPTAEQVEAFHK 576

>AAR147W [335] [Homologous to ScYOR191W (RIS1) - SH]
            complement(608865..613607) [4743 bp, 1580 aa]
          Length = 1580

 Score =  110 bits (274), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 55/158 (34%), Positives = 99/158 (62%), Gaps = 2/158 (1%)

Query: 894  FQLKNDEWMNSGKITALRKILENIIEHKK-EKVLVFSLFTQMLDILEMALT-TLNINFLR 951
            +QL  +    S K+     I++ ++++   EK++VFS FT   DIL+  +   LN+++LR
Sbjct: 1389 YQLNFENLHQSKKVQQCLGIIKTVLDNSTDEKLIVFSQFTTFFDILQFFIKKVLNVSYLR 1448

Query: 952  LDGSTQVNDRQALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQA 1011
             DG+   N R ++I++F+ +    + ++S KAG  G+ L CAN+VI+ D  +NP+ ++QA
Sbjct: 1449 YDGTMNGNVRASVIERFYREKNERLLLISMKAGNSGLTLTCANHVILVDPFWNPYVEEQA 1508

Query: 1012 ADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLAL 1049
             DR +R+ Q + V+I  L+ +N+IE++I++L   K  L
Sbjct: 1509 MDRCYRISQQREVYIHRLLLKNTIEDRIVELQNRKRTL 1546

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 77/302 (25%), Positives = 125/302 (41%), Gaps = 61/302 (20%)

Query: 516  KLLSPDVT--LKDYQQTGINWLNLLYRNNL-SCILADEMGLGKTCQVIAF-LSYLKQNNE 571
            +L  PD+T  L  +Q+ G+ WL     +     +LAD+MGLGKT Q IA  L+    ++ 
Sbjct: 886  ELTPPDMTVNLLKHQRQGLYWLLKTESSKFKGGLLADDMGLGKTVQAIALMLANRSADST 945

Query: 572  PGPHLVVVPSSTLENWLREFN---KFCPDLKIEPYYGSQQERAELRDILEDNDGQYDVIV 628
               +LVV P + L  W  E N   K      +  Y G   ++ E    + +    YDV++
Sbjct: 946  CKTNLVVGPVAVLRVWHDEINTKVKKQAQFSVMIYGGFGGKKVENFKAMHN----YDVVL 1001

Query: 629  TTY-----------------------------------NLASGNKYDVSFLKN-RGFNVV 652
             +Y                                   ++   N+Y   F  +   F  +
Sbjct: 1002 VSYQTLAVEFKKHWPARLQGTSENGGQLPEVASIKAMNSMKLRNEYWSPFFSDDSNFYRI 1061

Query: 653  VYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEF--IMP-NLFISK 709
            + DE   +KN  ++       +   +R  L+GTP+QNN+ EL SLL F  I P N     
Sbjct: 1062 ILDEAQNIKNKQTQAAKACCTLNGTYRWALSGTPIQNNILELYSLLRFLRIAPYNREQKF 1121

Query: 710  KNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMMKPFILRRRK-----DQVLKHLPH 764
            K D+      R        D++ +  + A+ + + +++  +LRR K      Q +  LP 
Sbjct: 1122 KEDIGNALLSRG------GDFDSMDTKRALKKVRVLLRAIMLRRAKTSQINGQPILELPA 1175

Query: 765  KH 766
            KH
Sbjct: 1176 KH 1177

>Kwal_14.1868
          Length = 1357

 Score =  107 bits (267), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 100/172 (58%), Gaps = 3/172 (1%)

Query: 894  FQLKNDEWMNSGKITALRKILENI-IEHKKEKVLVFSLFTQMLDILEMALTT-LNINFLR 951
            +++  D+   S K+     I+ ++ ++ K EK++VFS FT   D+L+  +   L   +LR
Sbjct: 1165 YKVDFDKLEPSQKVKQCLDIIRDVFLKSKTEKIIVFSQFTTFFDLLQHFIRKDLGAQYLR 1224

Query: 952  LDGSTQVNDRQALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQA 1011
             DGS     R A I++F+      + ++S KAG  G+ L CAN+VI+ D  +NP  ++QA
Sbjct: 1225 YDGSMDSQSRAATIEEFYRSLERRILLISMKAGNAGLTLTCANHVILIDPFWNPFVEEQA 1284

Query: 1012 ADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLALDTYISEDDSKAAEA 1063
             DR +R+ QT+ V +  L+ +NS+E++IL+L K K  L   I+ D SK  E 
Sbjct: 1285 MDRCYRISQTRDVQVHRLLVKNSVEDRILELQKKKREL-VEIAMDPSKIREV 1335

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 74/291 (25%), Positives = 130/291 (44%), Gaps = 51/291 (17%)

Query: 516 KLLSPDVT--LKDYQQTGINWLNLLYRNNL-SCILADEMGLGKTCQVIAFLSYLKQNNE- 571
           +L  P++T  L  +Q+ G++WL  + ++N    +LAD+MGLGKT Q IA +   K   E 
Sbjct: 665 ELTPPEMTINLMKHQRQGLHWLLTVEKSNRKGGLLADDMGLGKTVQAIALMLANKSGVEN 724

Query: 572 PGPHLVVVPSSTLENWLREFN---KFCPDLKIEPYYGSQQERAE-LRDILEDNDGQYDVI 627
              +L+V P + L  W  E     K    LK+  Y G    + E  R +L     ++DV+
Sbjct: 725 CKTNLIVAPVAVLRVWQAEVKTKVKKTSGLKVLIYGGGNGAKVENYRSLL-----RHDVV 779

Query: 628 VTTY----------------------------------NLASGNKYDVSFLKNRG-FNVV 652
           + +Y                                  +L    +Y   F  N   F  +
Sbjct: 780 LVSYQTLASELKKHWPARLSEDSEEAKITDIPDLKALNSLKERKEYWSPFYCNESKFYRI 839

Query: 653 VYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEFIMPNLFISKKND 712
           + DE   +KN  ++       ++A +R  L+GTP+QNN+ EL SL+ F+  + +  ++  
Sbjct: 840 ILDEAQNIKNKKTQSAKACCTLDATYRWALSGTPMQNNIMELYSLIRFLKISPYKREQKF 899

Query: 713 LSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMMKPFILRRRKDQVLKHLP 763
              +     + ++   DY+    Q+AI + + +++  +LRR KD  +   P
Sbjct: 900 KLDIGNPLGKATN---DYDSHDRQQAIKKVQVLLRAIMLRRTKDSKIDGKP 947

>KLLA0F17479g complement(1601287..1604631) similar to sp|P32849
            Saccharomyces cerevisiae YLR032w RAD5 DNA helicase, start
            by similarity
          Length = 1114

 Score =  106 bits (264), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 59/165 (35%), Positives = 95/165 (57%), Gaps = 7/165 (4%)

Query: 902  MNSGKITALRKILENIIE-HKKEKVLVFSLFTQMLDILEMALTTL----NINFLRLDGST 956
              S KI AL + L+ I E    E+++VFS F+  LDILE+ L +      +   + DG  
Sbjct: 936  FQSTKIKALLRHLKQIQETSPGEQIIVFSQFSSFLDILEIELRSHLPRDQVIIYKFDGRL 995

Query: 957  QVNDRQALIDKFHDDD--TIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADR 1014
             + +R  ++++FHD D   I + +LS K GG G+NL CA+   + D  ++P  + QA DR
Sbjct: 996  DMKERTRILEQFHDKDLSCIKLLLLSLKTGGVGLNLTCASRAFMMDPWWSPGMEDQAIDR 1055

Query: 1015 SHRVGQTKTVHITTLITRNSIEEKILQLAKNKLALDTYISEDDSK 1059
             HR+GQ +TV +   I  NS+EEK+L++ + K  L   +  D+++
Sbjct: 1056 IHRIGQQQTVKVVRFIIDNSVEEKMLRIQERKRMLGDIVEGDEAE 1100

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 77/285 (27%), Positives = 127/285 (44%), Gaps = 63/285 (22%)

Query: 546 ILADEMGLGKTCQVIAFL---SY---------------LKQ-----NNEPGPH------- 575
           ILADEMGLGKT   +A +   SY               +K+     ++ P  H       
Sbjct: 481 ILADEMGLGKTISALALICTASYDEAHEKKIESTKKPSMKEMSSQVDSSPLRHSQHKHDT 540

Query: 576 ------LVVVPSSTLENWLREFNKFCPDLK--IEPYYGSQQERAELRDILEDNDGQYDVI 627
                 L+VVP S L  W  EF K   DLK   E YYG+  +  +LR  +   +    VI
Sbjct: 541 YAYRTTLIVVPMSLLNQWQSEFEKANKDLKKRCEIYYGNNIK--DLRAYVLGPNAP-SVI 597

Query: 628 VTTYNLASG--NKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGT 685
           +TTY +      +   S L N  F  ++ DEGH ++N  +     ++ + ++ + +LTGT
Sbjct: 598 ITTYGIIQSEYGRTSTSGLFNVVFFRIILDEGHTIRNRSTRTSKAVIALRSSRKWILTGT 657

Query: 686 PLQNNLKELMSLLEF--IMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAK 743
           P+ N L +L SL++F  + P   I+      +V  ++   +            +A     
Sbjct: 658 PIINRLDDLFSLVQFLNLEPWSHINYWKRYVSVPFEKGNYA------------QAFDVIN 705

Query: 744 TMMKPFILRRRKD------QVLKHLPHKHSKIEYCEMSDVQRTIY 782
            +++P +LRR K+      + L  LP K   +E  ++S  ++ +Y
Sbjct: 706 AVLEPVLLRRTKNMKDVDGKPLVSLPPKEVIVEKLQLSSSEKRVY 750

>KLLA0C05368g 481598..486415 some similarities with sgd|S0005717
            Saccharomyces cerevisiae YOR191w RIS1, hypothetical start
          Length = 1605

 Score =  104 bits (260), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 51/128 (39%), Positives = 80/128 (62%), Gaps = 1/128 (0%)

Query: 923  EKVLVFSLFTQMLDILEMALT-TLNINFLRLDGSTQVNDRQALIDKFHDDDTIPVFILST 981
            EK+++FS FT   +IL   +   L +NFLR DGS   + R A I+ F+ D+   V ++S 
Sbjct: 1447 EKLVIFSQFTMFFEILGHFIKKNLGLNFLRYDGSMSSSQRSACIESFYQDNNYRVMLISM 1506

Query: 982  KAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQ 1041
            KAG  G+ L CAN+VI+ D  +NP  ++QA DR HR+ Q + V++  L+ + S+E++I++
Sbjct: 1507 KAGNSGLTLTCANHVILADPFWNPFVEEQAMDRCHRISQEREVYVHRLLIKMSVEDRIVE 1566

Query: 1042 LAKNKLAL 1049
            L   K  L
Sbjct: 1567 LQNKKKTL 1574

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 96/377 (25%), Positives = 160/377 (42%), Gaps = 79/377 (20%)

Query: 518  LSPD---VTLKDYQQTGINWLNLLYRNN-LSCILADEMGLGKTCQVIAFLSYLKQNNEPG 573
            L+P+   V L  +Q+ G+ WL  + +++    +LAD+MGLGKT Q +A L      N+P 
Sbjct: 910  LTPNELTVNLLKHQRQGLRWLVSMEKSSKRGGLLADDMGLGKTVQSLALL----MANKPE 965

Query: 574  PH------LVVVPSSTLENWLREFN---KFCPDLKIEPYYGSQQERAELRDILEDNDGQY 624
            P       LVV P + L  W  E     K   ++K+  + G +   ++ R     +  +Y
Sbjct: 966  PKSAIKTTLVVAPVAVLRVWKDEVAVKIKKDVNVKVVIFGGGENNSSKFRSW--KDLAEY 1023

Query: 625  DVIVTTYN---------------------------------LASGNKYDVSFLKNRG-FN 650
            D+++ +Y                                  + S ++Y   F +N   F 
Sbjct: 1024 DIVLVSYQTLASEFKKHWPLSWKNGEHQPDVHAVDLKLMNQVKSSDEYFSPFYRNDSEFY 1083

Query: 651  VVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEFI-MP--NLFI 707
             V+ DE   +KN  ++       I + FR  L+GTP+QNN+ EL SL+ F+ +P  N   
Sbjct: 1084 RVILDEAQNIKNKKTQAAKACCTISSTFRWALSGTPIQNNIGELYSLIRFLRIPPYNKEA 1143

Query: 708  SKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMMKPFILRRRK-DQV----LKHL 762
               +D+ AV   +        DYN    Q A+ + + +++  +LRR K  Q+    +  L
Sbjct: 1144 KFHSDIGAVLNTKKPY-----DYNDSERQRAMKKVQVLLRAIMLRRTKTSQIDGKPILQL 1198

Query: 763  PHKHSKIEYCEMSDVQRTIYNREIQQVLDH-KRMLXXXXXXXXXXXXXPTKKNGGAQISK 821
            P KH K    ++   +   Y     +  D  K+ML               +K G      
Sbjct: 1199 PEKHLKESANKLEGDELEFYQALESKSRDKAKKMLESK------------QKQGAYSSIL 1246

Query: 822  NLIMSLRKAALHPLLFR 838
             L++ LR+A LH  L +
Sbjct: 1247 TLLLRLRQACLHSELVK 1263

>CAGL0G09493g complement(902228..906454) similar to tr|Q08562
            Saccharomyces cerevisiae YOR191w RIS1, hypothetical start
          Length = 1408

 Score =  104 bits (259), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 86/143 (60%), Gaps = 2/143 (1%)

Query: 904  SGKITALRKILENIIEHK-KEKVLVFSLFTQMLDILEMALTT-LNINFLRLDGSTQVNDR 961
            S K+     ++  + E    EK+++FS FT  LD+LE  L T L I+ L+  G      R
Sbjct: 1231 STKMNQCMDVINKVFEKSDSEKIIIFSQFTTFLDLLEHILATRLKISCLKYTGDMNAKVR 1290

Query: 962  QALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQT 1021
              +I +F+ ++   V ++S KAG  G+ L CAN+V+I D  +NP+ ++QA DR +R+ QT
Sbjct: 1291 SEIISRFYSEEDKRVLLISMKAGNSGLTLTCANHVVIVDPFWNPYVEEQAQDRCYRISQT 1350

Query: 1022 KTVHITTLITRNSIEEKILQLAK 1044
            + V +  L  +NS+E++IL+L K
Sbjct: 1351 REVTVHRLFIKNSVEDRILELQK 1373

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 93/368 (25%), Positives = 156/368 (42%), Gaps = 71/368 (19%)

Query: 518  LSPD---VTLKDYQQTGINWL-NLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQNNEPG 573
            L+P+   V L  +Q+ G+ WL N         +LAD+MGLGKT Q IA +   + +NE  
Sbjct: 724  LTPEGMTVNLLRHQRLGLQWLLNAETSKRKGGLLADDMGLGKTVQAIALMLANRSSNESK 783

Query: 574  -PHLVVVPSSTLENWLREFN---KFCPDLKIEPYYGSQQERAELRDILEDNDGQYDVIVT 629
              +L+V P S L  W  E     K   D     Y G    +    D L +    +DVI+ 
Sbjct: 784  KTNLIVAPVSVLRVWKGEIETKIKESSDFNSAIYGGVNGIKFRSWDKLSN----FDVILV 839

Query: 630  TY--------------------------------NLASGNKYDVSFLKNRG-FNVVVYDE 656
            +Y                                +L + N+Y   F  +   F  ++ DE
Sbjct: 840  SYQTLANELKKHWPERLKTDSKQLPPVPDIKAMNSLKTKNEYWSPFYSDDSTFYRIILDE 899

Query: 657  GHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEFI-MP--NLFISKKNDL 713
            G  +KN  ++       + + +R +L+GTP+QNN++EL SL+ F+ +P  N     + D+
Sbjct: 900  GQNIKNMKTQAAKACCTVNSVYRWILSGTPIQNNMEELYSLIRFLRIPPYNRHERFQQDI 959

Query: 714  SAVFRQRARTSDSNKDYNPLLAQEAIARAKTMMKPFILRRRK-DQV----LKHLPHKHSK 768
               F      S+  ++Y+    ++AI + + +++  +LRR K D++    +  LP K+  
Sbjct: 960  GRPF------SNLKQNYDSESRKQAIKKVRVLLRAIMLRRSKTDKIDGVPILELPPKNVN 1013

Query: 769  IEYCEMSDVQRTIYNREIQQVLDHKRMLXXXXXXXXXXXXXPTKKNGGAQISKNLIMSLR 828
             +     D +   Y     + L+HK                 +K  G       L++ LR
Sbjct: 1014 AQETTFKDDELEFY-----KALEHKN-------KQLAKKLLESKVQGNYSSVLTLLLRLR 1061

Query: 829  KAALHPLL 836
            +A  HP L
Sbjct: 1062 QACCHPEL 1069

>Kwal_23.3660
          Length = 768

 Score =  102 bits (255), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 89/160 (55%), Gaps = 2/160 (1%)

Query: 901  WMNSGKITALRKILENIIEHKKE-KVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVN 959
            W +S KI AL + L N+   ++  K +VFS FT MLD++E  L       ++L GS    
Sbjct: 593  WRSSTKIEALVEELYNLRSDRRTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMTPT 652

Query: 960  DRQALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVG 1019
             R   I  F D+    VF++S KAGG  +NL  A+ V I D  +NP  + Q+ DR HR+G
Sbjct: 653  QRDQTIKYFMDNTHCEVFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIG 712

Query: 1020 QTKTVHITTLITRNSIEEKILQLAKNKL-ALDTYISEDDS 1058
            Q + V IT     +SIE +I++L + K   +   I++DD+
Sbjct: 713  QYRPVKITRFCIEDSIESRIIELQEKKANMIHATINQDDA 752

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 92/201 (45%), Gaps = 35/201 (17%)

Query: 522 VTLKDYQQTGINWL----NLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQNNEPGPHLV 577
           + L  +Q  G++WL    + +Y      +LADEMG+GKT Q IA L     +    P LV
Sbjct: 160 IKLLPFQLEGLHWLISQEHSVYNGG---VLADEMGMGKTIQTIALL---MNDVTKKPSLV 213

Query: 578 VVPSSTLENWLREFNKFCPD-LKIEPYYGSQQER--AELRDILEDNDGQYDVIVTTYNL- 633
           V P+  L  W  E  +     LK   ++G+ +     E +D+        DV++TTY + 
Sbjct: 214 VAPTVALMQWKNEIEQHTGGKLKTHIFHGANRTSNVGEFKDV--------DVLLTTYAVL 265

Query: 634 -------------ASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRL 680
                         SG   + S L N  F  V+ DE H +K+  S     +  +    + 
Sbjct: 266 ESVFRKQNYGFKRKSGVYKEPSVLHNMNFYRVILDEAHNIKDRQSNTAKAVNSLLTEKKW 325

Query: 681 LLTGTPLQNNLKELMSLLEFI 701
            LTGTPLQN + E+ SL+ F+
Sbjct: 326 CLTGTPLQNRIGEMYSLIRFL 346

>CAGL0M01958g complement(238113..240875) similar to sp|P38086
            Saccharomyces cerevisiae YBR073w RDH54, hypothetical
            start
          Length = 920

 Score =  102 bits (255), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 98/164 (59%), Gaps = 4/164 (2%)

Query: 903  NSGKITALRKILENI-IEHKKEKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDR 961
            +SGK+T L ++L  I      EKV++ S +TQ LDI++  + +  ++  RLDG+T    R
Sbjct: 629  SSGKLTVLLELLLEIKATSPMEKVVIVSNYTQSLDIIQGLMNSNQLSNCRLDGATPAKQR 688

Query: 962  QALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQT 1021
              L++ F+++  I  F+LS KAGG G+NL+ A+ +++FD  +NP  D QA  R HR GQ 
Sbjct: 689  DMLVNTFNNNPNIFGFLLSAKAGGVGLNLIGASRLVLFDNDWNPAVDLQAMSRIHREGQK 748

Query: 1022 KTVHITTLITRNSIEEKIL--QLAKNKLALDTYISEDDSKAAEA 1063
            +  +I  LIT   I+EKIL  QL K+ L    ++S + S    A
Sbjct: 749  RPCYIYRLITTGCIDEKILQRQLMKHNLT-RKFLSSNTSDTGSA 791

 Score = 94.4 bits (233), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 125/254 (49%), Gaps = 27/254 (10%)

Query: 544 SCILADEMGLGKTCQVIAFL-SYLKQN--------NEPGPHL--------VVVPSSTLEN 586
            CILAD+MGLGKT   I  + + LKQ         ++ G  L        +V P + + N
Sbjct: 309 GCILADDMGLGKTLMTITLIWTLLKQTPFASKVQCSQLGVPLSGMISKVVIVCPVTLIGN 368

Query: 587 WLREFNKF-----CPDLKIEPYYGSQQERAELRDILEDNDGQYDVIVTTYNLASGNKYDV 641
           W REF K+        L + P      ++  +R+ ++ N   Y V++  Y      + ++
Sbjct: 369 WKREFKKWLGLNRIGILTLNPKNNVDMDKISVRNFIKVNR-TYQVLILGYEKVLTVQEEL 427

Query: 642 SFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEFI 701
              K++  ++++ DEGH LKN  S+    L  ++ + +++LTGTP+QN+L E  ++++F+
Sbjct: 428 LKQKDK-LDLLICDEGHRLKNGASKILKVLKSLDIDKKVILTGTPIQNDLNEFFTIIDFV 486

Query: 702 MPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMM---KPFILRRRKDQV 758
            P +  +  +         +R  D N  +N  + ++   ++  ++   K FILRR  + +
Sbjct: 487 NPGVLGTYASFKKLYINPISRARDINNKFNTKVIEQGEEKSNQLIEFTKRFILRRSNNIL 546

Query: 759 LKHLPHKHSKIEYC 772
            K LP K   I +C
Sbjct: 547 SKFLPPKTDIILFC 560

>AFR220W [3412] [Homologous to ScYLR032W (RAD5) - SH]
            complement(830240..833497) [3258 bp, 1085 aa]
          Length = 1085

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 59/160 (36%), Positives = 92/160 (57%), Gaps = 7/160 (4%)

Query: 904  SGKITALRKILENIIE-HKKEKVLVFSLFTQMLDILE----MALTTLNINFLRLDGSTQV 958
            S KI AL + L+++ +    E+V+VFS F+  LDILE     +  +      + DG   +
Sbjct: 909  SSKIVALIRHLKHLQDTSANEQVVVFSQFSSYLDILENELRQSFASDICEIYKFDGRLDL 968

Query: 959  NDRQALIDKFHDDDTIP--VFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSH 1016
             +R  ++ KF +   +   V +LS KAGG G+NL CA++  I D  ++P  + QA DR H
Sbjct: 969  KERSNVLAKFTEKSLVKMKVLLLSLKAGGVGLNLTCASHAFIMDPWWSPGMEDQAMDRIH 1028

Query: 1017 RVGQTKTVHITTLITRNSIEEKILQLAKNKLALDTYISED 1056
            R+GQ+ TV I   I  NSIEEK+L++ + K +L  ++  D
Sbjct: 1029 RIGQSNTVKIYRFIVENSIEEKMLRIQEKKRSLGEFVDAD 1068

 Score = 83.2 bits (204), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 79/282 (28%), Positives = 119/282 (42%), Gaps = 57/282 (20%)

Query: 546 ILADEMGLGKTCQVIAFLSYL----------KQNNEPGPHL------------------V 577
           ILADEMGLGKT  ++A ++ +           Q   P  HL                  +
Sbjct: 457 ILADEMGLGKTISILALITMVPSDTKHLLTTAQEKPPVGHLSLELGISTVKPYTASTTLI 516

Query: 578 VVPSSTLENWLREFNKF--CPDLKIEPYYGSQQERAELRDILEDNDGQYDVIVTTYNLAS 635
           VVP S L  W  EF +      L  E YY      + LR +L        V++TTY +  
Sbjct: 517 VVPMSLLPQWRNEFVRVNDGNGLYCEVYYAGNV--SNLRTLLVKQKSPPSVVLTTYGVVQ 574

Query: 636 G-----NKYDVSFLKNRGFNV----VVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTP 686
                  ++D        F+V    ++ DEGH ++N  ++    +M + +  + +LTGTP
Sbjct: 575 TEWSKLQQFDYEASNEGLFSVEFFRIILDEGHNIRNRTTKTSKAVMALTSRRKWVLTGTP 634

Query: 687 LQNNLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMM 746
           + N L +L SL++F+  N     K D    +RQ        KDY+      A+   + +M
Sbjct: 635 IMNRLDDLFSLIKFM--NFEPWCKID---YWRQFVSDPFEKKDYS-----SALEVIQAVM 684

Query: 747 KPFILRRRKD------QVLKHLPHKHSKIEYCEMSDVQRTIY 782
            P +LRR K+        L  LP K   IE    SD +  +Y
Sbjct: 685 GPILLRRTKNMKDEDGNPLVQLPPKEVVIEMIRFSDTEAGLY 726

>YOR191W (RIS1) [4987] chr15 (692475..697334) Protein involved in
            silencing, member of Snf2p DNA-dependent ATPase family
            [4860 bp, 1619 aa]
          Length = 1619

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 87/145 (60%), Gaps = 2/145 (1%)

Query: 904  SGKITALRKILENII-EHKKEKVLVFSLFTQMLDILEMALTT-LNINFLRLDGSTQVNDR 961
            S KI    ++++ +  E   EK+++FS FT   +ILE  L   LN  +L+  GS     R
Sbjct: 1442 STKIEQCIQVIQRVFDESATEKIIIFSQFTTFFEILEHFLKNKLNFPYLKYIGSMNAQRR 1501

Query: 962  QALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQT 1021
              +I++F+ D    + ++S KAG  G+ L CAN+V+I D  +NP+ ++QA DR +R+ QT
Sbjct: 1502 SDVINEFYRDPEKRILLISMKAGNSGLTLTCANHVVIVDPFWNPYVEEQAQDRCYRISQT 1561

Query: 1022 KTVHITTLITRNSIEEKILQLAKNK 1046
            K V +  L  ++S+E++I +L K K
Sbjct: 1562 KKVQVHKLFIKDSVEDRISELQKRK 1586

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 74/288 (25%), Positives = 126/288 (43%), Gaps = 65/288 (22%)

Query: 518  LSPD---VTLKDYQQTGINWLNLLYRNNL--SCILADEMGLGKTCQVIAF-LSYLKQNNE 571
            L+P+   V L  +Q+ G++WL L   N+     +LAD+MGLGKT Q IA  L+   + ++
Sbjct: 934  LTPEDMTVNLLKHQRLGLHWL-LQVENSAKKGGLLADDMGLGKTIQAIALMLANRSEESK 992

Query: 572  PGPHLVVVPSSTLENWLREFN-------KFCPDLKIEPYYGSQQERAE-LRDILEDNDGQ 623
               +L+V P S L  W  E         KF   +    + GS   + +  RD+      +
Sbjct: 993  CKTNLIVAPVSVLRVWKGELETKVKKRAKFTTFI----FGGSGNGKVKHWRDL-----AR 1043

Query: 624  YDVIVTTYN--------------------------------LASGNKYDVSFLKNRG-FN 650
            YD ++ +Y                                 L + N+Y   F  N   F 
Sbjct: 1044 YDAVLVSYQTLANEFKKHWPKKLDGEQNQLPAVPHIQALNRLKTSNEYYSPFFCNDSTFY 1103

Query: 651  VVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEFI-MPNLFISK 709
             ++ DEG  +KN  +        I   +R +L+GTP+QN++ EL SL+ F+ +P     +
Sbjct: 1104 RILLDEGQNIKNKNTRASKACCTINGMYRWVLSGTPIQNSMDELYSLIRFLRIPPYHKEQ 1163

Query: 710  --KNDLSAVFRQRARTSDSNKDYNPLLAQEAIARAKTMMKPFILRRRK 755
              K D+   F++  +    N+D      + A+ + + ++   +LRR K
Sbjct: 1164 RFKLDIGRFFQRNKQYQYDNED-----RKNALRKVRVLLNAIMLRRSK 1206

>KLLA0B09240g complement(810178..812580) similar to sp|P31244
            Saccharomyces cerevisiae YBR114w RAD16 nucleotide
            excision repair protein, start by similarity
          Length = 800

 Score =  100 bits (250), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 59/161 (36%), Positives = 91/161 (56%), Gaps = 2/161 (1%)

Query: 900  EWMNSGKITALRKILENIIEHKKE-KVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQV 958
            +W +S KI AL + L N+   K+  K +VFS FT MLD++E  L       ++L GS   
Sbjct: 624  KWRSSTKIEALVEELYNLRSDKRTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMTP 683

Query: 959  NDRQALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRV 1018
              R   I  F ++    VF++S KAGG  +NL  A+ V I D  +NP  + Q+ DR HR+
Sbjct: 684  TQRDQTIKYFMENIHCEVFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRI 743

Query: 1019 GQTKTVHITTLITRNSIEEKILQLAKNKLAL-DTYISEDDS 1058
            GQ + V IT     +SIE +I++L + K ++    I++D++
Sbjct: 744  GQFRPVKITRFCIEDSIESRIIELQEKKASMIHATINQDEA 784

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/212 (28%), Positives = 97/212 (45%), Gaps = 32/212 (15%)

Query: 511 FKQKPKLLSPD---VTLKDYQQTGINWLNLLYRNNL-SCILADEMGLGKTCQVIAFLSYL 566
            +Q  +   PD   + L  +Q  G++WL     ++    +LADEMG+GKT Q IA L   
Sbjct: 178 IRQVERAPQPDGMAIRLLPFQLEGLHWLQQQEESDYNGGVLADEMGMGKTIQTIALLM-- 235

Query: 567 KQNNEPGPHLVVVPSSTLENWLREFNKFC-PDLKIEPYYGSQQER--AELRDILEDNDGQ 623
             +    P LVV P+  L  W  E  +     L +  Y+G+ +     + +D+       
Sbjct: 236 -SDITRKPSLVVAPTVALMQWKNEIEQHTNKKLSVYMYHGANRTNNLGDFKDV------- 287

Query: 624 YDVIVTTYNL--------------ASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFT 669
            DVI+TTY +               +G   + S L +  F  V+ DE H +K+  S    
Sbjct: 288 -DVILTTYAVLESVYRKQVYGFKRKAGTVKEKSLLHSINFYRVILDEAHNIKDRTSNTAK 346

Query: 670 KLMKIEANFRLLLTGTPLQNNLKELMSLLEFI 701
            +  ++   R  L+GTPLQN + E+ SL+ F+
Sbjct: 347 AVNSLQTKKRWCLSGTPLQNRIGEMYSLIRFL 378

>ADL345C [1395] [Homologous to ScYBR114W (RAD16) - SH]
            (100332..102572) [2241 bp, 746 aa]
          Length = 746

 Score =  100 bits (250), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 57/147 (38%), Positives = 81/147 (55%), Gaps = 1/147 (0%)

Query: 901  WMNSGKITALRKILENIIEHKKE-KVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVN 959
            W +S KI AL + L N+    +  K +VFS FT MLD++E  L        +L GS    
Sbjct: 571  WRSSTKIEALLEELYNLRSSTRTIKSIVFSQFTSMLDLVEWRLKRAGFQTAKLQGSMTPT 630

Query: 960  DRQALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVG 1019
             R   I+ F D+    VF++S KAGG  +NL  A+ V I D  +NP  + Q+ DR HR+G
Sbjct: 631  QRAETINYFMDNVHCEVFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIG 690

Query: 1020 QTKTVHITTLITRNSIEEKILQLAKNK 1046
            Q + V IT     +SIE +I++L + K
Sbjct: 691  QHRPVKITRFCIEDSIESRIIELQEKK 717

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/216 (30%), Positives = 102/216 (47%), Gaps = 31/216 (14%)

Query: 503 PKHKNVKFFKQKPKLLSPDVTLKDYQQTGINWLNLLYRNNL--SCILADEMGLGKTCQVI 560
           P +K ++    +P  L+  V L  +Q  G++W+ L   N      +LADEMG+GKT Q+I
Sbjct: 125 PAYKPIR--AAQPAGLT--VPLLPFQLEGLHWMALQENNERYRGGVLADEMGMGKTVQMI 180

Query: 561 AFLSYLKQNNEPGPHLVVVPSSTLENWLREFNKFCPD-LKIEPYYGSQQERAELRDILED 619
           + L +  +    GP LVV P+  L  W  E +K+    L+   ++G        R  + +
Sbjct: 181 SLLLHANK----GPTLVVAPTVALIQWKNEIDKYTGGALRSLVFHGPG------RSAVSE 230

Query: 620 NDGQYDVIVTTYNL--------------ASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMS 665
                DV++TTY +               +G   + S L    F  VV DE H +K+  S
Sbjct: 231 ELAAADVVLTTYAVLESVYRKQTQGFRRKAGVVREQSPLHAVDFYRVVLDEAHNIKDRSS 290

Query: 666 ERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEFI 701
                +  + A  R  LTGTPLQN + E+ SL+ F+
Sbjct: 291 GTARSVNALRAVRRWCLTGTPLQNRIGEMYSLIRFL 326

>Scas_674.12d
          Length = 1323

 Score = 99.0 bits (245), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 82/139 (58%), Gaps = 4/139 (2%)

Query: 909  ALRKILENIIEHKKEKVLVFSLFTQMLDILEMALTTL-NINFLRLDGSTQVNDRQALIDK 967
             ++K+ EN      EK+++FS FT   DI +  L  L  + +L+  G+     R  +I K
Sbjct: 1155 VIKKVFEN---SDTEKIIIFSQFTSFFDIFQHFLEKLLKVPYLKYTGAMTAQQRADVITK 1211

Query: 968  FHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHIT 1027
            F+      + ++S KAG  G+ L CAN+VII D  +NP+ ++QA DR +R+ QT+ VH+ 
Sbjct: 1212 FYRQANERILLISMKAGNSGLTLTCANHVIIVDPFWNPYVEEQAQDRCYRISQTREVHVH 1271

Query: 1028 TLITRNSIEEKILQLAKNK 1046
             L  ++S+E++I +L + K
Sbjct: 1272 RLFIKDSVEDRIAELQEKK 1290

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/310 (24%), Positives = 135/310 (43%), Gaps = 53/310 (17%)

Query: 518 LSPD---VTLKDYQQTGINWL-NLLYRNNLSCILADEMGLGKTCQVIAF-LSYLKQNNEP 572
           L+P+   V L  +Q+ G++WL N+        +LAD+MGLGKT Q IA  L+   ++   
Sbjct: 641 LTPEDMTVNLLKHQKIGLHWLLNVEASKKKGGLLADDMGLGKTVQGIALMLANRSKDQAC 700

Query: 573 GPHLVVVPSSTLENWLREF-NKFCPDLKIEPY-YGSQQERAELRDILEDNDGQYDVIVTT 630
             +L+V P + L  W  E   K   +     + YG   + A  +++ E     YD I+ +
Sbjct: 701 KTNLIVAPVAVLRVWGGELETKIKKEANFSAFIYGGGDKLATWKELSE-----YDAIMVS 755

Query: 631 Y--------------------------------NLASGNKYDVSFLKNRG-FNVVVYDEG 657
           Y                                +L   ++Y   F  N   F  ++ DEG
Sbjct: 756 YPTLAIEFKKHWPASLGKDQKQLPAIPQLAAMNSLKKKDEYFSPFFCNESTFYRIILDEG 815

Query: 658 HMLKNSMSERFTKLMKIEANFRLLLTGTPLQNNLKELMSLLEFIMPNLFISKKNDLSAVF 717
             +KN  +        ++A +R + +GTP+QN++ EL SL+ F+    +  ++  ++ + 
Sbjct: 816 QNIKNKKTRAAKACCSLDATYRWVFSGTPIQNSMDELYSLIRFLRIPPYHREERFMADIG 875

Query: 718 RQRARTSDSNKDYNPLLAQEAIARAKTMMKPFILRRRKDQV-----LKHLPHKHSKIEYC 772
           R   R    N +Y+    ++AI + + ++   +LRR K  +     L  LP K  +I+  
Sbjct: 876 RPFLR---KNGNYDDFDRKQAIKKVQVLLSAIMLRRSKSDMIDGKPLLELPPKQIEIDSA 932

Query: 773 EMSDVQRTIY 782
            +   +   Y
Sbjct: 933 ALEGDELEFY 942

>CAGL0K07766g 770935..773427 highly similar to sp|P31244 Saccharomyces
            cerevisiae YBR114w RAD16 DNA repair protein, start by
            similarity
          Length = 830

 Score = 98.2 bits (243), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 57/147 (38%), Positives = 80/147 (54%), Gaps = 1/147 (0%)

Query: 901  WMNSGKITALRKILENIIEHKKE-KVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVN 959
            W +S KI AL + L  +    K  K +VFS FT MLD++E  L       ++L GS    
Sbjct: 655  WRSSTKIEALVEELYKLRSPVKTVKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSPT 714

Query: 960  DRQALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVG 1019
             R   I  F D+    VF++S KAGG  +NL  A+ V I D  +NP  + Q+ DR HR+G
Sbjct: 715  QRDQTIKYFMDNIECEVFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRIG 774

Query: 1020 QTKTVHITTLITRNSIEEKILQLAKNK 1046
            Q + V IT     +SIE +I++L + K
Sbjct: 775  QYRPVKITRFCIEDSIEARIIELQEKK 801

 Score = 77.0 bits (188), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 63/206 (30%), Positives = 95/206 (46%), Gaps = 35/206 (16%)

Query: 522 VTLKDYQQTGINWL----NLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQNNEPGPHLV 577
           V L  +Q  G++W+    + +Y      +LADEMG+GKT Q IA L     +    P LV
Sbjct: 223 VKLLPFQLEGLHWMLSQEDSIYNGG---VLADEMGMGKTIQTIALL---MNDRSKKPSLV 276

Query: 578 VVPSSTLENWLREFNKFCPD-LKIEPYYGSQQ--ERAELRDILEDNDGQYDVIVTTYNL- 633
           V P+  L  W  E  +     L    Y+G+ +     +L+DI        DVI+TTY++ 
Sbjct: 277 VAPTVALMQWKNEIEQHTNGALSTYIYHGASRTINIHDLKDI--------DVILTTYSVL 328

Query: 634 -------------ASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRL 680
                         +G   + S L N  F   + DE H +K+  S     +  ++   R 
Sbjct: 329 ESVFRKQNYGFRRKNGLVKEKSLLHNIDFYRAILDEAHNIKDRTSNTSRAVNALKTQKRW 388

Query: 681 LLTGTPLQNNLKELMSLLEFIMPNLF 706
            L+GTPLQN + E+ SL+ F+  N F
Sbjct: 389 CLSGTPLQNRIGEMYSLIRFLDINPF 414

>YBR114W (RAD16) [303] chr2 (467204..469576) Nucleotide excision
            repair protein involved in G2 repair of inactive genes,
            component of the nucleotide excision repair factor four
            (NEF4, Rad7p-Rad16p) ATP-dependent damage recognition
            complex, has DNA helicase domain of Snf2p family [2373
            bp, 790 aa]
          Length = 790

 Score = 98.2 bits (243), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 83/148 (56%), Gaps = 1/148 (0%)

Query: 900  EWMNSGKITALRKILENIIEHKKE-KVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQV 958
            +W +S KI AL + L  +  +K+  K +VFS FT MLD++E  L       ++L GS   
Sbjct: 614  KWQSSTKIEALVEELYKLRSNKRTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMSP 673

Query: 959  NDRQALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRV 1018
              R   I  F ++    VF++S KAGG  +NL  A+ V I D  +NP  + Q+ DR HR+
Sbjct: 674  TQRDETIKYFMNNIQCEVFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRVHRI 733

Query: 1019 GQTKTVHITTLITRNSIEEKILQLAKNK 1046
            GQ + V IT     +SIE +I++L + K
Sbjct: 734  GQYRPVKITRFCIEDSIEARIIELQEKK 761

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 96/204 (47%), Gaps = 31/204 (15%)

Query: 522 VTLKDYQQTGINWL----NLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQNNEPGPHLV 577
           + L  +Q  G++WL      +Y      +LADEMG+GKT Q IA L     +    P LV
Sbjct: 182 IKLLPFQLEGLHWLISQEESIYAGG---VLADEMGMGKTIQTIALL---MNDLTKSPSLV 235

Query: 578 VVPSSTLENWLREFNKFCP-DLKIEPYYGSQQERAELRDILEDNDGQYDVIVTTYNL--- 633
           V P+  L  W  E  +     LKI  Y+G+ +   +++D+       YDV++TTY +   
Sbjct: 236 VAPTVALMQWKNEIEQHTKGQLKIYIYHGASRT-TDIKDL-----QGYDVVLTTYAVLES 289

Query: 634 -----------ASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLL 682
                       +G     S L N  F  V+ DE H +K+  S     +  ++   R  L
Sbjct: 290 VFRKQNYGFRRKNGLFKQPSVLHNIDFYRVILDEAHNIKDRQSNTARAVNNLKTQKRWCL 349

Query: 683 TGTPLQNNLKELMSLLEFIMPNLF 706
           +GTPLQN + E+ SL+ F+  N F
Sbjct: 350 SGTPLQNRIGEMYSLIRFLNINPF 373

>YLR032W (RAD5) [3450] chr12 (204992..208501) Single-stranded
            DNA-dependent ATPase of the Snf2p family of DNA
            helicases, member of the RAD6 epistasis group, involved
            in error-free DNA repair [3510 bp, 1169 aa]
          Length = 1169

 Score = 94.7 bits (234), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 93/161 (57%), Gaps = 7/161 (4%)

Query: 904  SGKITALRKILENIIEHKK-EKVLVFSLFTQMLDILEMALT-TLN---INFLRLDGSTQV 958
            S KITAL K L+ + +    E+V++FS F+  LDILE  LT T +       + DG   +
Sbjct: 993  SSKITALLKELQLLQDSSAGEQVVIFSQFSTYLDILEKELTHTFSKDVAKIYKFDGRLSL 1052

Query: 959  NDRQALIDKF--HDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSH 1016
             +R +++  F   D     + +LS KAGG G+NL CA++  + D  ++P  + QA DR H
Sbjct: 1053 KERTSVLADFAVKDYSRQKILLLSLKAGGVGLNLTCASHAYMMDPWWSPSMEDQAIDRLH 1112

Query: 1017 RVGQTKTVHITTLITRNSIEEKILQLAKNKLALDTYISEDD 1057
            R+GQT +V +   I ++SIEEK+L++ + K  +   +  D+
Sbjct: 1113 RIGQTNSVKVMRFIIQDSIEEKMLRIQEKKRTIGEAMDTDE 1153

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 121/288 (42%), Gaps = 63/288 (21%)

Query: 546 ILADEMGLGKTCQVIAFL---------------------------SYLKQNNEPGPH--- 575
           IL+DEMGLGKT    + +                           S  + N +P      
Sbjct: 529 ILSDEMGLGKTVAAYSLVLSCPHDSDVVDKKLFDIENTAVSDNLPSTWQDNKKPYASKTT 588

Query: 576 LVVVPSSTLENWLREFNKF--CPDLKIEPYYGSQQERAELRDILEDNDGQYDVIVTTYNL 633
           L+VVP S L  W  EF K    PD+  E YYG     + L+ +L        V++TTY +
Sbjct: 589 LIVVPMSLLTQWSNEFTKANNSPDMYHEVYYGGNV--SSLKTLLTKTKTPPTVVLTTYGI 646

Query: 634 --------ASGNKYD-----VSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRL 680
                   + G   D      S L +  F  ++ DEGH ++N  +     +M ++   + 
Sbjct: 647 VQNEWTKHSKGRMTDEDVNISSGLFSVNFYRIIIDEGHNIRNRTTVTSKAVMALQGKCKW 706

Query: 681 LLTGTPLQNNLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIA 740
           +LTGTP+ N L +L SL++F+  + +  ++ +    F     T   +K+Y     ++A  
Sbjct: 707 VLTGTPIINRLDDLYSLVKFLELDPW--RQINYWKTF---VSTPFESKNY-----KQAFD 756

Query: 741 RAKTMMKPFILRRRKD------QVLKHLPHKHSKIEYCEMSDVQRTIY 782
               +++P +LRR K       + L  LP K   I+    S  Q  +Y
Sbjct: 757 VVNAILEPVLLRRTKQMKDKDGKPLVELPPKEVVIKRLPFSKSQDLLY 804

>Scas_721.100
          Length = 1137

 Score = 93.2 bits (230), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 94/172 (54%), Gaps = 8/172 (4%)

Query: 894  FQLKNDEW-MNSGKITALRKILENIIEHKK-EKVLVFSLFTQMLDILE----MALTTLNI 947
            F+LK+ E  +   K++AL K L+ + +    E+V++FS F+  LDILE     A  T   
Sbjct: 950  FKLKHYENNLKPAKLSALLKHLQLLQDSSAGEQVVIFSQFSSYLDILEDELKEAFPTDVA 1009

Query: 948  NFLRLDGSTQVNDRQALIDKFHDDDTI--PVFILSTKAGGFGINLVCANNVIIFDQSFNP 1005
               + DG   + +R  ++  F   D     + +LS KAGG G+NL CA++  + D  ++P
Sbjct: 1010 KIYKFDGRLSLKERSTVLQDFQIKDLSRQKILLLSLKAGGVGLNLTCASHAYMMDPWWSP 1069

Query: 1006 HDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQLAKNKLALDTYISEDD 1057
              + QA DR HR+GQT  V +   I  NSIEEK+L++ + K  +   +  D+
Sbjct: 1070 SMEDQAIDRIHRIGQTNNVKVVRFIIENSIEEKMLRIQERKRTIGEAMDADE 1121

 Score = 83.6 bits (205), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 76/285 (26%), Positives = 121/285 (42%), Gaps = 62/285 (21%)

Query: 546 ILADEMGLGKTCQVIAFLSYLKQNNE----------------PGPHL---------VVVP 580
           IL+DEMGLGKT   +A +     ++E                  PHL         +VVP
Sbjct: 503 ILSDEMGLGKTISTLALILSCPYDSEVVDKKLFKGEEDDIRETQPHLKPYASKTTLIVVP 562

Query: 581 SSTLENWLREFNKF--CPDLKIEPYYGSQQERAELRDILEDNDGQYDVIVTTYNLASGNK 638
            S L  W  EFNK     D++ E YYG     + L+ +L        V++TTY +     
Sbjct: 563 MSLLNQWNTEFNKANNSSDMRSEIYYGGNV--SSLKKLLTKTHNPPTVVITTYGIVQSEW 620

Query: 639 YDVSFLKNRG-------------FNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGT 685
             +   +N G             F  +V DEGH ++N  +     +M + +  + +LTGT
Sbjct: 621 SKIFKKQNIGAEIQSSSGLFSVDFYRIVIDEGHTIRNRTTLTSKAIMDLTSKCKWVLTGT 680

Query: 686 PLQNNLKELMSLLEFIMPNLFISKKNDLSAV--FRQRARTSDSNKDYNPLLAQEAIARAK 743
           P+ N L +L SL+ F+       K    S +  ++    T   NK++     ++A     
Sbjct: 681 PIINRLDDLYSLVRFL-------KLEPWSQIGYWKMFVSTPFENKNF-----KQAFDVVN 728

Query: 744 TMMKPFILRRRKD------QVLKHLPHKHSKIEYCEMSDVQRTIY 782
            +++P +LRR K       + L  LP K   +E  ++S  Q  +Y
Sbjct: 729 AILEPVLLRRTKQMKDIDGKPLVELPPKEVIVERLKLSKAQNAVY 773

>CAGL0A03432g 345192..348647 similar to sp|P32849 Saccharomyces
            cerevisiae YLR032w RAD5, hypothetical start
          Length = 1151

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 87/160 (54%), Gaps = 7/160 (4%)

Query: 905  GKITALRKILENIIEHKK-EKVLVFSLFTQMLDILEMALTTL----NINFLRLDGSTQVN 959
             K+ AL + L+ + +    E+V+VFS F+  LDILE  L  +     +   + DG   + 
Sbjct: 975  AKLNALIRHLQQLQDSSAGEQVVVFSQFSSYLDILESQLNEVYSSNKLKVYKFDGRLSLK 1034

Query: 960  DRQALIDKFHDDDTI--PVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHR 1017
            +R A+++ F   D     V +LS KAGG G+NL CA+   + D  ++P  + QA DR HR
Sbjct: 1035 ERTAVLEDFKVKDYAVQKVLLLSLKAGGVGLNLTCASYAFMMDPWWSPSMEDQAIDRIHR 1094

Query: 1018 VGQTKTVHITTLITRNSIEEKILQLAKNKLALDTYISEDD 1057
            +GQT +V +   +   SIEEK+L++   K  L   +  D+
Sbjct: 1095 IGQTNSVKVIRFVIDGSIEEKMLRIQDRKRTLGEAMDTDE 1134

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 76/296 (25%), Positives = 130/296 (43%), Gaps = 65/296 (21%)

Query: 546 ILADEMGLGKTCQVIAFL------------SYLKQNN------------EP------GPH 575
           IL+DEMGLGKT   ++ +            S   Q +            EP         
Sbjct: 510 ILSDEMGLGKTISALSLVLMRPKDEHTTSQSLFHQESSNLSSDDVIEIKEPERSYAYKTT 569

Query: 576 LVVVPSSTLENWLREFNKFCPD--LKIEPYYGSQQERAELRDILEDNDGQYDVIVTTYNL 633
           L++VP S L  W  EF+K   +  L  E YYG     + L+ +L        V++TTY +
Sbjct: 570 LIIVPMSLLTQWRDEFDKVNNNAGLTCELYYGGN--VSSLKSLLIKRKNPPTVVLTTYGI 627

Query: 634 ASGNKY-----DVSFLKNRG---------FNVVVYDEGHMLKNSMSERFTKLMKIEANFR 679
              N++     D + +++ G         F  ++ DEGH ++N  +     ++++ + +R
Sbjct: 628 VQ-NEWTKLSKDGTNIRSLGRTSGIFSIEFFRIILDEGHTIRNKSTITSKAVLELSSKYR 686

Query: 680 LLLTGTPLQNNLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAI 739
            +LTGTP+ N L +L SL++F+       K    S +   +   ++  ++ N    ++A 
Sbjct: 687 WILTGTPIINRLDDLYSLVKFL-------KLEPWSQIGYWKQFITNPFEERN---FKQAF 736

Query: 740 ARAKTMMKPFILRRRKD------QVLKHLPHKHSKIEYCEMSDVQRTIYNREIQQV 789
                +M+P +LRR K         L  LP K   IE  ++S  Q+ IY   +Q+ 
Sbjct: 737 DVVNAIMEPVLLRRTKQMKDTDGNPLVQLPPKEIVIEKLQLSKKQKLIYEEFLQRA 792

>Kwal_47.17771
          Length = 972

 Score = 90.5 bits (223), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 85/157 (54%), Gaps = 9/157 (5%)

Query: 907  ITALRKILENIIEHKKEKVLVFSLFTQMLDILEMALTTL----NINFLRLDGSTQVNDRQ 962
            IT+L+++ +       E+++VFS F+  LDI+E  +++          + DG   + +R 
Sbjct: 803  ITSLKRLQDAC---PGEQIVVFSQFSSFLDIIETEISSCFSKSTTKVYKFDGRLSMKERS 859

Query: 963  ALIDKFHDDDT--IPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQ 1020
             ++  F   D   + + +LS KAGG G+NL CA+   + D  ++P  + QA DR HR+GQ
Sbjct: 860  KVLQDFAVKDMTRLKILLLSLKAGGVGLNLTCASRAYMMDPWWSPSLEDQAIDRIHRIGQ 919

Query: 1021 TKTVHITTLITRNSIEEKILQLAKNKLALDTYISEDD 1057
               V +   I  +SIEEK+L++ + K  L   +  D+
Sbjct: 920  VNNVKVVRFIIEHSIEEKMLRIQERKRTLGEAVDADE 956

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 81/276 (29%), Positives = 119/276 (43%), Gaps = 63/276 (22%)

Query: 546 ILADEMGLGKTCQVIAFL-------SYLKQ-----NNEPGPH------------------ 575
           ILADEMGLGKT  ++A +       SY K+     +  P P                   
Sbjct: 337 ILADEMGLGKTISILAMILTVPSDSSYGKEKLREASESPDPEISVLGSQWSGGSKPYASG 396

Query: 576 --LVVVPSSTLENWLREFNKFCP--DLKIEPYYGSQQERAELRDILEDNDGQYDVIVTTY 631
             LVVVP S L  W +EF K     +   E YYG     + L+ +L        V++TTY
Sbjct: 397 TTLVVVPMSLLSQWQQEFEKASSSKEATCEIYYGGNT--SSLKSLLTKTKSPPTVLITTY 454

Query: 632 NLASG------NK-----YDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRL 680
                      NK      DVS L +  F  +V DEGH ++N  +     LM +++    
Sbjct: 455 GTVQHEWSRLLNKNGQMDTDVSGLFSVEFFRIVIDEGHTIRNRNTRTSRSLMDLKSTRSW 514

Query: 681 LLTGTPLQNNLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAIA 740
           +LTGTP+ N L +L SL++F+       +    S +   +   SD  +  N   A + ++
Sbjct: 515 ILTGTPIINRLDDLYSLVKFM-------RLEPWSQIGYWKTFVSDPFEKKNYKAAFDIVS 567

Query: 741 RAKTMMKPFILRRRK------DQVLKHLPHKHSKIE 770
              ++++P ILRR K       + L  LP K   IE
Sbjct: 568 ---SILEPVILRRTKGMRDVDGKRLVELPPKEVIIE 600

>Sklu_2412.7 YLR032W, Contig c2412 15481-18864
          Length = 1127

 Score = 87.8 bits (216), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 86/160 (53%), Gaps = 7/160 (4%)

Query: 904  SGKITALRKILENIIEH-KKEKVLVFSLFTQMLDILEMALTT----LNINFLRLDGSTQV 958
            S KI +L K L+ + E    E+V+VFS F+  LDILE  LT+     +    + DG   +
Sbjct: 951  SSKICSLLKHLKQLQETCPGEQVVVFSQFSSYLDILENELTSSFSKADAKIYKFDGRLNL 1010

Query: 959  NDRQALIDKF--HDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSH 1016
             DR  ++D F   D   + + +LS KAGG G+NL CA+   + D  ++P  + QA DR H
Sbjct: 1011 KDRSRVLDTFATKDLSKLKILLLSLKAGGVGLNLTCASRAYMMDPWWSPSLEDQAIDRVH 1070

Query: 1017 RVGQTKTVHITTLITRNSIEEKILQLAKNKLALDTYISED 1056
            R+GQ   V I   I  NSIEEK+L +   K  L   +  D
Sbjct: 1071 RIGQESNVKIIRFIMENSIEEKMLSIQDRKRTLGEAVDAD 1110

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 75/290 (25%), Positives = 124/290 (42%), Gaps = 71/290 (24%)

Query: 546 ILADEMGLGKTCQVIAFLSYL-----------KQNNEPG----------PH-----LVVV 579
           +LADEMGLGKT   +A +S +           K+ NE G          P+     L+VV
Sbjct: 497 LLADEMGLGKTISTLAMISMVPCDTDPVEEKNKRENEIGMNDYGYKSDKPYASKTTLIVV 556

Query: 580 PSSTLENWLREFNKFC--PDLKIEPYYGSQQERAELRDILEDNDGQYDVIVTTYNL---- 633
           P S L  W +EF K    P+   E YYG +     L  +L        +I+T+Y +    
Sbjct: 557 PMSLLFQWQKEFEKANNNPNAHCEIYYGGRA--GNLITLLTKTKNPPTIILTSYGVIQSE 614

Query: 634 ---------------ASGNKYDVSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANF 678
                          A+   + V F +      +V DEGH ++N  +     +M + ++ 
Sbjct: 615 WSKLPRCNNNRIEQGAAIGLFSVEFFR------IVIDEGHSIRNRTTRTSKAVMDLSSSR 668

Query: 679 RLLLTGTPLQNNLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEA 738
           + +LTGTP+ N L +L SL++F+       K    S +   ++  S   +  N    ++A
Sbjct: 669 KWVLTGTPIINRLDDLFSLVKFM-------KLEPWSQIGYWKSFVSGPFEKKN---YKQA 718

Query: 739 IARAKTMMKPFILRRRKD------QVLKHLPHKHSKIEYCEMSDVQRTIY 782
                ++++P +LRR K       + L  LP K   IE  + +  +  +Y
Sbjct: 719 FDVVSSVLEPVLLRRTKQMKDINGKPLVTLPLKEIVIEKVKFNTSEDILY 768

>Kwal_14.1287
          Length = 1518

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 83/168 (49%), Gaps = 13/168 (7%)

Query: 885  TRFPDSLAKFQLKNDEWMNSGKITALRKILENIIEHK----------KEKVLVFSLFTQM 934
            +R+PD     QL   E   S    A++ IL  +  H+            +++++S +++ 
Sbjct: 1283 SRYPDLDKIHQLTLKESYGSKIDFAVKLILYLLYRHRDGQDGANVERAPQIIIYSQYSEF 1342

Query: 935  LDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIPVFILSTKAGGFGINLVCAN 994
            L +L   L   +I      GS + +    +++KF  +  +   +L+      G+ LV A 
Sbjct: 1343 LGLLSKVLKQHSIQHCNTAGSGKFS---KIVEKFKKNPEVTCLLLNVTRQATGLTLVNAT 1399

Query: 995  NVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQL 1042
            +V I D   N  D+ QA +R+HR+GQT+  ++   + RN++E+ I++L
Sbjct: 1400 HVFIMDPIMNTSDELQAINRTHRIGQTRETYVWNFVVRNTVEQNIVRL 1447

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 46/203 (22%), Positives = 87/203 (42%), Gaps = 50/203 (24%)

Query: 546 ILADEMGLGKTCQVIAFLSYLKQNNEPGP---------------HLVVVPSSTLENWLRE 590
           +L++EMGLGKT +++A +   K+     P               +L+V P S L+ W+ E
Sbjct: 356 VLSEEMGLGKTLEILALMLVHKRTINGAPTFLSDSKKTILKTATNLIVCPDSILQQWIDE 415

Query: 591 FNKFCP------DLKIEPYYGSQQERAEL--RDI--LEDNDGQYDVIVTTYNLASGN--- 637
                        + I  Y G Q+ +      DI  +  +   YD+I+ +Y   S     
Sbjct: 416 VEAHVVSEASHRSMNIFHYRGYQEVKKHFDTEDIAAIVSHLSTYDIILCSYATVSSEVHY 475

Query: 638 -KYDVSFLKNRG---------------FNVVVYDEGHML--KNSMSERFTKLMKIEANFR 679
            +++ S  + RG               F  ++ DE  ML  +++ + R T L+     + 
Sbjct: 476 AEFNSSARQRRGTAPKYDYTSPLSLLEFFRIILDEVQMLGSESTNAARCTGLLHRVHTWG 535

Query: 680 LLLTGTPLQN--NLKELMSLLEF 700
             ++GTP+ +  + + ++S L+F
Sbjct: 536 --VSGTPIYDIHHFQTVLSYLQF 556

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 66/127 (51%), Gaps = 6/127 (4%)

Query: 924  KVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIPVFILSTKA 983
            +++++S + ++L+I+   L   +I FL    +  V +   +++ F  D  I   +L TK 
Sbjct: 1359 QIVIYSQYAELLEIVAHVLKQNSIKFL--TTTKNVRNFAKVVETFKADPEITCLLLDTKR 1416

Query: 984  GGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQ-- 1041
               G+ L+ A +V + +   N   + QA +R HR+GQT   ++   +  N++E  IL+  
Sbjct: 1417 QASGLTLINATHVFLLEPIVNNSTEFQAINRIHRIGQTSETYVWHFMLLNTVEHSILRYK 1476

Query: 1042 --LAKNK 1046
              L KNK
Sbjct: 1477 SILEKNK 1483

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 80/201 (39%), Gaps = 48/201 (23%)

Query: 546 ILADEMGLGKTC------------------QVIAFLSYLKQNNEPGPHLVVVPSSTLENW 587
           +L++EMGLGKT                   QV   +S  K+      +L+V P   ++ W
Sbjct: 381 MLSEEMGLGKTVEVLALLLLRPRAMDPVEEQVYEVVSTGKRMRRVKTNLIVCPQVIVQQW 440

Query: 588 LREFNKFC-PDLKIEPYYGSQQERAELR----DILEDNDGQYDVIVTTYNLASGN----- 637
           L E  K     LK   Y G    + E        L     +YDVI+T+Y   S       
Sbjct: 441 LDEIAKHVDGSLKAYHYRGFANIKEEFNTENISELVATLSEYDVIITSYATVSAEVHYAE 500

Query: 638 -------------KYDVSF-LKNRGFNVVVYDEGHML--KNSMSERFTKLMKIEANFRLL 681
                        KYD S  L    F  ++ DE  ML  +++ + R T L++    +   
Sbjct: 501 YSTTMRSRRHKSPKYDYSSPLSLMQFFRIILDEVQMLGSESTNAARCTNLLQRIHTWG-- 558

Query: 682 LTGTPLQN--NLKELMSLLEF 700
           ++GTP+ +  + K + S L+ 
Sbjct: 559 VSGTPIHSLADFKVVFSYLQL 579

>Scas_573.9
          Length = 1502

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 73/289 (25%), Positives = 132/289 (45%), Gaps = 67/289 (23%)

Query: 546 ILADEMGLGKTCQVIAFL-----------SYLKQNNEP----GPHLVVVPSSTLENWLRE 590
           +L++EMGLGKT +V+A +           S++   N+        L+V P++ L  W+ E
Sbjct: 372 LLSEEMGLGKTIEVLALIMLNKRDVIKEDSFIDDQNKTIRRTNLTLIVCPNAILTQWINE 431

Query: 591 FNKFCPDLKIEPYYGSQQERAE-----LRDILEDNDGQYDVIVTTYNLASGN-------- 637
            N    +LKI  Y GS   R +     +++IL D   +YD+I+T+Y++ S          
Sbjct: 432 TNAHTENLKIFHYMGSLATRIQFDTDNIQEIL-DRLSEYDIIITSYDIVSAEIHYAEYNA 490

Query: 638 ----------KYDVSF-LKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGTP 686
                     KYD S  L    F  ++ DE  ML+++ +        +       ++GTP
Sbjct: 491 NIRSRRQKSPKYDYSSPLSLLEFFRIILDEVQMLRSNSTNAAKCTSLLHRIHTWGVSGTP 550

Query: 687 LQN--NLKELMSLLEFI----MPNLFISKKNDLSAVFRQRARTSDSNKDYNPLLAQEAI- 739
           +Q   + + ++S L+F     +P+  I KK  ++  F++R + S      N L+ +E   
Sbjct: 551 IQTIYDFETVLSYLKFHPFCELPD--IIKK--ITINFKRREKIS------NGLVVRELFN 600

Query: 740 ---ARAKTMMKPFI-----LRRRKDQVLK--HLPHKHSKIEYCEMSDVQ 778
              +    ++  FI     +R  K +V+   H+P +H+ I   E + V+
Sbjct: 601 GIDSSVHDLLNLFIKFDICIRHTKMEVISQIHIPKQHNLIVPLEFTPVE 649

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 68/140 (48%), Gaps = 14/140 (10%)

Query: 924  KVLVFSLFTQMLDILEMALTTLNINFLR-LDGSTQVNDRQALIDKFHDDDTIPVFILSTK 982
            ++L++S     L +L   LT  +I  L  L  S+ +  +   I +F     I   +L+ K
Sbjct: 1333 QILLYSQSANFLKVLGKILTKNDIEHLTCLSNSSTIGKK---IARFKSQSNITCLLLNVK 1389

Query: 983  AGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQL 1042
              G G+NL+ A ++ + D   N  D+ QA +R++R+GQ    ++  LI  NS+EE I + 
Sbjct: 1390 TLGAGLNLLNARHIFLLDPIINHSDELQAMNRNNRIGQKYETYVWNLIINNSVEENIFKY 1449

Query: 1043 A----------KNKLALDTY 1052
                       K +L LD Y
Sbjct: 1450 KCKLESERKEHKTELNLDNY 1469

>KLLA0F12166g complement(1116715..1121301) weakly similar to
            sgd|S0004237 Saccharomyces cerevisiae YLR247c,
            hypothetical start
          Length = 1528

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 61/123 (49%), Gaps = 4/123 (3%)

Query: 920  HKKE-KVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIPVFI 978
            HKK  ++++FS  +  L IL   LT  N+   R   +T+       +D F  D      +
Sbjct: 1348 HKKNPQIVIFSSHSAFLSILSTLLTAHNVTHARPLRNTKF---AKAVDTFRKDPNCTCLL 1404

Query: 979  LSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEK 1038
            L+  +   G+ LV A ++I+ +   +   + QA  R HR+GQ    ++   + RN++EE 
Sbjct: 1405 LNVHSQSTGLTLVNARHLILLEPIMDSSTEAQAISRIHRIGQKDVTYVWNFMVRNTVEES 1464

Query: 1039 ILQ 1041
            I++
Sbjct: 1465 IMK 1467

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 82/193 (42%), Gaps = 56/193 (29%)

Query: 546 ILADEMGLGKTCQVIAFLSYLKQN--NEPGP---------------HLVVVPSSTLENWL 588
           +LADEMGLGKT +++  +S   +N  NE                  +L+V P S L+ W+
Sbjct: 354 VLADEMGLGKTIEILTLISTNVRNLSNESSSFVSPINEKEVRRVKTNLIVCPESILQQWI 413

Query: 589 RE----FNKFCPDLKIEPYYGSQQER--------AELRDILEDNDGQYDVIVTTYNLASG 636
            E     NK   D K+  Y G ++ R        AE+ +++     QYDV++ +Y   S 
Sbjct: 414 DEIDLHINKKVSDFKVFHYEGFEKTRNKFNTDSPAEIVELM----SQYDVVICSYYTMSA 469

Query: 637 N------------------KYD-VSFLKNRGFNVVVYDEGHMLKNSMS--ERFTKLMKIE 675
                              +YD  S L    F+ V+ DE  +L   M+   R T L  I 
Sbjct: 470 EVHYAEFSKIQRPSRDSTRRYDYTSPLSIMEFHRVILDEAQLLGGGMTNASRCTSL--IH 527

Query: 676 ANFRLLLTGTPLQ 688
                 ++GTP++
Sbjct: 528 RVHTWGVSGTPVE 540

>YLR247C (YLR247C) [3643] chr12 complement(628686..633356) Protein
            containing an SNF2 related N-terminal domain, a C3HC4
            type (RING) zinc finger, and a helicase conserved
            C-terminal domain, has a region of low similarity to a
            region of transcription termination factor RNA polymerase
            II (human TTF2) [4671 bp, 1556 aa]
          Length = 1556

 Score = 57.0 bits (136), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 63/119 (52%), Gaps = 4/119 (3%)

Query: 924  KVLVFSLFTQMLDILEMALTTLNINFLR-LDGSTQVNDRQALIDKFHDDDTIPVFILSTK 982
            +V+++S  T+ L ++   L   +I  L  L  +  V +    I+ F    ++   +L+ K
Sbjct: 1381 QVILYSQKTEYLKVIGKVLKLYHIEHLACLSNTANVGET---INNFKRQPSVTCLLLNVK 1437

Query: 983  AGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQ 1041
              G G+NL+ A ++ + D   N  D+ QA  R++R+GQ +   +   + RN++EE IL+
Sbjct: 1438 TLGAGLNLINAKHIFLLDPILNNSDELQAMGRNNRIGQDEETFVWNFMIRNTVEENILR 1496

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 71/285 (24%), Positives = 121/285 (42%), Gaps = 58/285 (20%)

Query: 546 ILADEMGLGKTCQVIAFL------------SYLKQNNE----PGPHLVVVPSSTLENWLR 589
           +LA+EMGLGKT ++++ +            +++   N         L++ P++ L+ WL 
Sbjct: 388 VLAEEMGLGKTIEILSLILLNRRKLKDSEATFIDDENRTITKTKTTLIICPNAILKQWLE 447

Query: 590 EFNKFCPDLKIEPYYGSQQERAELRDILE--DNDGQYDVIVTTYNLASGN---------- 637
           E       LK   Y G  +   + + + E      QYD+IVT+YN+ +            
Sbjct: 448 EIELHANSLKWYTYRGYNEIMKDCKTVDEAVQQLCQYDIIVTSYNIIATEVHHAEFNRSI 507

Query: 638 --------KYDVSF-LKNRGFNVVVYDEGHMLKNS--MSERFTKLMKIEANFRLLLTGTP 686
                   KYD S  L    F  ++ DE  ML++S   S + T L+     +   ++GTP
Sbjct: 508 RSRRLKSPKYDYSSPLALMQFYRIILDEVQMLRSSSTYSAKCTSLLHRIHTWG--VSGTP 565

Query: 687 LQN--NLKELMSLLEFIMPNLFISKKNDLSAVFRQRARTSDSNKDY--NPLLAQEAIAR- 741
           +QN  N + +MS L+ + P      + D     ++  +  +  KDY  N  + Q    R 
Sbjct: 566 IQNIYNFRMIMSYLK-LHP---FCDEVDFIRTLQEEIKLRNEAKDYTSNDFVCQLKGVRF 621

Query: 742 -AKTMMKPF-----ILRRRKDQVLK--HLPHKHSKIEYCEMSDVQ 778
             K  M  F      +R  K  V    H+P +H+ I   E + ++
Sbjct: 622 SIKDCMNIFYRYDLCIRHSKANVASQIHIPRQHNFIIPLEFAPIE 666

>CAGL0B05049g 487186..491598 some similarities with tr|Q06554
           Saccharomyces cerevisiae YLR247c, hypothetical start
          Length = 1470

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 87/196 (44%), Gaps = 41/196 (20%)

Query: 546 ILADEMGLGKTCQVIAFLSYLKQN---NEP--------------GPHLVVVPSSTLENWL 588
           +LA+EMGLGKT +++A +   K+    +EP                 L+V P S L+ W+
Sbjct: 353 VLAEEMGLGKTLEILALICINKRKYKADEPLDFVSESGKVISKCSTTLIVCPGSILKQWI 412

Query: 589 REFNKFCPDLKIEPYYGSQQERAELR----DILEDNDGQYDVIVTTYNLASGN----KYD 640
            E     P +KI  Y G    + E      + +     QYD+++T+YN+ S      +++
Sbjct: 413 DEMQSTHPAIKIYHYGGFIAVKKEFACDNINTIVQKLSQYDIVITSYNVVSNEVHYAQFN 472

Query: 641 VSFLKNR---------------GFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLLLTGT 685
            +F +NR                F  ++ DE  ML +  ++       +       ++GT
Sbjct: 473 NAFRQNRRRHVQYDYSSPLSLMQFYRIILDELQMLHSGSTKAAICTSLLHRVHTWGVSGT 532

Query: 686 PLQNNLKELMSLLEFI 701
           P+Q  +++  ++L ++
Sbjct: 533 PIQ-KVRDFQTILSYL 547

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 64/119 (53%), Gaps = 4/119 (3%)

Query: 924  KVLVFSLFTQMLDILEMALTTLNIN-FLRLDGSTQVNDRQALIDKFHDDDTIPVFILSTK 982
            ++L++S     + ++   L+  NIN    L  +  V D   +I +F     I   +L+ +
Sbjct: 1299 QILMYSQSFDFMKVVSQVLSLHNINNICCLQNNRNVGD---MIARFKKTSDITCLLLNIR 1355

Query: 983  AGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLITRNSIEEKILQ 1041
            + G G+NL+ A ++ + D   N +++ QA  R++R+GQ +  ++   +  N++EE I++
Sbjct: 1356 SLGAGLNLLNARHIFLLDPILNVNEEIQAMSRNNRIGQRQETYVWNFMLENTVEESIMR 1414

>Sklu_2234.2 YOR191W, Contig c2234 6350-9366 reverse complement
          Length = 1006

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 65/135 (48%), Gaps = 20/135 (14%)

Query: 518  LSPD---VTLKDYQQTGINWL-NLLYRNNLSCILADEMGLGKTCQVIAFLSYLKQNNEP- 572
            L+P+   V L  +Q+ G++WL N+   N    +LAD+MGLGKT Q IA +   +   E  
Sbjct: 876  LTPEELTVNLLKHQRRGLHWLLNVEKSNKRGGLLADDMGLGKTVQAIALMIANRSELESC 935

Query: 573  GPHLVVVPSSTLENWLREF-NKFCPDLKIEPY-YGSQQERAELRDILEDNDGQYDVIVTT 630
              +L+V P + L  W  E   K   +   + + YG   +    +D+L     +YD ++ +
Sbjct: 936  KTNLIVAPVAVLRVWQAEIQTKIKKNATFKAFIYGGNNKVVSYKDLL-----RYDAVLVS 990

Query: 631  Y--------NLASGN 637
            Y        N+  GN
Sbjct: 991  YQTLASELKNIGRGN 1005

>Sklu_2432.9 , Contig c2432 20306-24733 reverse complement
          Length = 1475

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 39/74 (52%)

Query: 968  FHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHIT 1027
            F  D +I   +++ K    G+ L  A +VI+ +        +QA +R HR+GQ K   + 
Sbjct: 1343 FKRDSSITCLLMNPKWCSRGLKLTNATHVILMEPMSEGRIQEQAVERIHRIGQGKDTFVW 1402

Query: 1028 TLITRNSIEEKILQ 1041
             L+TRN+ EE  L+
Sbjct: 1403 HLMTRNTAEESTLK 1416

 Score = 33.9 bits (76), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 84/212 (39%), Gaps = 54/212 (25%)

Query: 546 ILADEMGLGKTCQVIAFLSYLKQN---NEPGPH--------------LVVVPSSTLENWL 588
           IL+D+ GLGKT + +A +   ++    +EP  +              L+  P   L+ WL
Sbjct: 353 ILSDDTGLGKTVETLALVCLHRRKFRPDEPRSYTLPEGREILKAKTTLICCPGPILQQWL 412

Query: 589 REFNKFCPDLKIEPYYGSQQERAELRDILE-DNDG-------QYDVIVTTYNLAS----- 635
            E +       +  +Y    +  E++  LE +N G       +YDVIV  Y   S     
Sbjct: 413 DEAHIHTKGSALSVFYYCGYD--EVKKQLETENIGEISRKLAEYDVIVADYGTISFELTN 470

Query: 636 -------------GNKYD-VSFLKNRGFNVVVYDEGHMLKNSMSERFTKLMKIEANFRLL 681
                          KYD  S L    F  + YDE  +L    S   +K  ++ A     
Sbjct: 471 VGYSTVARSRRSGSPKYDYTSPLSLLEFYRIAYDEVELLYGD-SSPVSKCTRLLARVHTW 529

Query: 682 -LTGTPLQN--NLKELMSLLEF----IMPNLF 706
            ++ TP+ +  N + ++S L+F      PN+ 
Sbjct: 530 GVSSTPIGDTTNFQMVLSFLKFHPFEAFPNII 561

>ADR260C [2001] [Homologous to ScYDL084W (SUB2) - SH]
           (1152259..1153575) [1317 bp, 438 aa]
          Length = 438

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 54/107 (50%), Gaps = 16/107 (14%)

Query: 552 GLGKTCQVIAFLSYLKQ-NNEPGPHLVVVPSSTLE-------NWLREFNKFCPDLKIEPY 603
           GLGKT   +  LS L+Q +  PG   VVV  +  E        +LR F+K+ PD+K   +
Sbjct: 101 GLGKTA--VFVLSTLQQLDPVPGEVSVVVLCNARELAYQIRNEYLR-FSKYMPDVKTAVF 157

Query: 604 YGSQQERAELRDILEDNDGQYDVIVTTYN----LASGNKYDVSFLKN 646
           YG    R ++ ++L++ D    ++V T      L   N  D+S +KN
Sbjct: 158 YGGTDTRKDI-ELLKNKDTAPHIVVATPGRLKALVRDNNIDLSHVKN 203

>Scas_720.17
          Length = 519

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 69/166 (41%), Gaps = 17/166 (10%)

Query: 879  ELHRLCTRFPDSLAKFQLKN-DEWMNSGKITAL----------RKILENIIEH--KKEKV 925
            E+  L + F +   K  + N DE   + +IT +          RK+LE + ++  KKEKV
Sbjct: 299  EVRELASSFMNKPVKVSIGNRDELSANKRITQIVEVIEPQRKDRKLLELLKKYHSKKEKV 358

Query: 926  LVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIPVFILSTKAGG 985
            L+F+L+ +    +E  L     +   + G      R   + +F    +    +L+T    
Sbjct: 359  LIFALYKKEAARVERTLRYNGYDVAAIHGDLSQEQRTKALGEFKSGKS--NLLLATDVAA 416

Query: 986  FGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLIT 1031
             G+++     VI         D      R+ R GQT T H  TL T
Sbjct: 417  RGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAH--TLFT 460

>KLLA0F23716g join(complement(2216857..2218129), some similarities
            with ca|CA1415|CaDBP2.exon2 Candida albicans
            ATP-dependent RNA helicase of DEAD box family, exon 2 (by
            homology), hypothetical start
          Length = 554

 Score = 37.0 bits (84), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 50/115 (43%), Gaps = 2/115 (1%)

Query: 910  LRKILENIIEHKKEKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFH 969
            L K LE   + +  K+++F+   +  D +   L T     L + G    N+R  ++ +F 
Sbjct: 348  LAKHLETASQDQDSKIIIFASTKRTCDEITSYLRTEGWPALAIHGDKAQNERDWVLAEFR 407

Query: 970  DDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTV 1024
               + P+ + +T     GI++   N VI +D   N  D      R+ R G T T 
Sbjct: 408  SGRS-PIMV-ATDVAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGSTGTA 460

>YGL078C (DBP3) [1904] chr7 complement(360289..361860) ATP-dependent
            RNA helicase CA3, member of the DEAD-box family of RNA
            helicases [1572 bp, 523 aa]
          Length = 523

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 70/169 (41%), Gaps = 20/169 (11%)

Query: 879  ELHRLCTRFPDSLAKFQLKNDEWMNSGK-ITAL----------RKILENIIEH-----KK 922
            E+  L + F ++  K  + N + + + K IT +          RK+LE + ++     K 
Sbjct: 300  EVRELASTFMNNPIKVSIGNTDQLTANKRITQIVEVVDPRGKERKLLELLKKYHSGPKKN 359

Query: 923  EKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIPVFILSTK 982
            EKVL+F+L+ +    +E  L     N   + G      R   +++F    +    +L+T 
Sbjct: 360  EKVLIFALYKKEAARVERNLKYNGYNVAAIHGDLSQQQRTQALNEFKSGKS--NLLLATD 417

Query: 983  AGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLIT 1031
                G+++     VI         D      R+ R GQT T H  TL T
Sbjct: 418  VAARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAH--TLFT 464

>YNL112W (DBP2) [4481] chr14 (413639..414911,415914..416281)
            ATP-dependent RNA helicase of the DEAD-box family [1641
            bp, 546 aa]
          Length = 546

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 49/115 (42%), Gaps = 2/115 (1%)

Query: 910  LRKILENIIEHKKEKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFH 969
            L K LE   +  + K L+F+   +M D +   L       L + G     +R  ++ +F 
Sbjct: 348  LNKYLETASQDNEYKTLIFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFR 407

Query: 970  DDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTV 1024
            +  + P+ + +T     GI++   N VI +D   N  D      R+ R G T T 
Sbjct: 408  NGRS-PIMV-ATDVAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTA 460

>CAGL0L03846g join(complement(443151..444414),
            complement(441680..442050)) highly similar to sp|P24783
            Saccharomyces cerevisiae YNL112w DBP2 ATP-dependent RNA
            helicase of DEAD box family
          Length = 544

 Score = 33.9 bits (76), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 51/115 (44%), Gaps = 2/115 (1%)

Query: 910  LRKILENIIEHKKEKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFH 969
            L K L+   + K+ K+L+F+   +  D +   L       L + G     +R  ++++F 
Sbjct: 345  LVKHLDTASQDKESKILIFASTKRTCDEITSYLRQDGWPALAIHGDKDQRERDWVLNEFR 404

Query: 970  DDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTV 1024
              ++ P+ + +T     GI++   N V+ +D   N  D      R+ R G T T 
Sbjct: 405  TGNS-PIMV-ATDVAARGIDVKGINFVVNYDMPGNIEDYVHRIGRTGRAGATGTA 457

>Scas_623.5
          Length = 446

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 45/87 (51%), Gaps = 12/87 (13%)

Query: 552 GLGKTCQVIAFLSYLKQNNE-PGPHLVVVPSSTLE-------NWLREFNKFCPDLKIEPY 603
           GLGKT   +  LS L+Q +  PG   VVV  +  E        +LR F+K+ PD+K   +
Sbjct: 109 GLGKTA--VFVLSTLQQMDPVPGEVSVVVICNARELAYQIRNEYLR-FSKYMPDVKTAVF 165

Query: 604 YGSQQERAELRDILEDNDGQYDVIVTT 630
           YG     A+  ++L++ D    ++V T
Sbjct: 166 YGGTP-IAKDAELLKNKDTAPHIVVAT 191

>CAGL0H03377g complement(313755..315377) highly similar to sp|P20447
            Saccharomyces cerevisiae YGL078c DBP3, hypothetical start
          Length = 540

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 67/169 (39%), Gaps = 20/169 (11%)

Query: 879  ELHRLCTRFPDSLAKFQLKN-DEWMNSGKITAL----------RKILENIIEH-----KK 922
            E+  L + F     K  + N DE   + +IT +          RK+L+ + ++     K 
Sbjct: 317  EVRELASTFMKEPVKVSIGNRDELSANKRITQIVEVVDPRSKERKLLDLLKKYQSGPKKN 376

Query: 923  EKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQALIDKFHDDDTIPVFILSTK 982
            +KVL+F+L+ +    +E  L         + G      R   +++F    +    +L+T 
Sbjct: 377  DKVLIFALYKKEASRVERNLNYNGYKVAAIHGDLSQQQRTQALNEFKSGKS--NLLLATD 434

Query: 983  AGGFGINLVCANNVIIFDQSFNPHDDKQAADRSHRVGQTKTVHITTLIT 1031
                G+++     VI         D      R+ R GQT T H  TL T
Sbjct: 435  VAARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAH--TLFT 481

>YDL084W (SUB2) [784] chr4 (305237..306577) Essential pre-mRNA
           splicing factor, required for nuclear export of mRNA and
           for expression of lacZ fusions in yeast, involved in
           silencing at telomeres and ribosomal DNA, member of the
           DexD/H box family of RNA-dependent ATPases [1341 bp, 446
           aa]
          Length = 446

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 45/89 (50%), Gaps = 16/89 (17%)

Query: 552 GLGKTCQVIAFLSYLKQ-NNEPGPHLVVVPSSTLE-------NWLREFNKFCPDLKIEPY 603
           GLGKT   +  LS L+Q +  PG   VVV  +  E        +LR F+K+ PD+K   +
Sbjct: 109 GLGKTA--VFVLSTLQQLDPVPGEVAVVVICNARELAYQIRNEYLR-FSKYMPDVKTAVF 165

Query: 604 YGSQ--QERAELRDILEDNDGQYDVIVTT 630
           YG     + AEL   L++ D    ++V T
Sbjct: 166 YGGTPISKDAEL---LKNKDTAPHIVVAT 191

>CAGL0K07029g complement(689672..692122) similar to sp|P21372
            Saccharomyces cerevisiae YBR237w Pre-mRNA processing RNA
            helicase PRP5, hypothetical start
          Length = 816

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 58/129 (44%), Gaps = 10/129 (7%)

Query: 893  KFQLKNDEWMNSGKITALRKILENIIEHKKEKVLVFSLFTQMLDILEMALTTLNINFLRL 952
            KF + +DE     ++ +L K+  +  E   EK ++F    Q+ DI+E  LT  +     +
Sbjct: 477  KFTICSDESDKFKELLSLLKVFNS--ETVDEKTIIFVSSQQICDIIEKRLTDYSEKLYSI 534

Query: 953  DGSTQVNDRQALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQAA 1012
                  N+R+  ++ F    T    +L T+    G+N+   + VI+++ +      K  A
Sbjct: 535  HAGRPYNERRQNLELFK--KTSNSILLCTEVMSRGLNVPEVSRVILYNSA------KTFA 586

Query: 1013 DRSHRVGQT 1021
               H  G+T
Sbjct: 587  QYVHSTGRT 595

>CAGL0L06908g complement(777557..778876) highly similar to sp|Q07478
           Saccharomyces cerevisiae YDL084w SUB2, start by
           similarity
          Length = 439

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 52/107 (48%), Gaps = 16/107 (14%)

Query: 552 GLGKTCQVIAFLSYLKQ-NNEPGPHLVVVPSSTLE-------NWLREFNKFCPDLKIEPY 603
           GLGKT   +  LS L+Q +  PG   VVV  +  E        +LR F+K+ PD++   +
Sbjct: 102 GLGKTA--VFVLSTLQQLDPVPGEVSVVVICNARELAYQIRNEYLR-FSKYMPDVRTAVF 158

Query: 604 YGSQQERAELRDILEDNDGQYDVIVTTYN----LASGNKYDVSFLKN 646
           YG     A+  ++L++ D    ++V T      L      D+S +KN
Sbjct: 159 YGGTP-IAKDAELLKNKDTAPHIVVATPGRLKALVRDKMIDLSHVKN 204

>KLLA0E22033g 1959770..1961083 highly similar to sp|Q07478
           Saccharomyces cerevisiae YDL084w SUB2 probably involved
           in pre-mRNA splicing, start by similarity
          Length = 437

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 51/107 (47%), Gaps = 16/107 (14%)

Query: 552 GLGKTCQVIAFLSYLKQ-NNEPGPHLVVVPSSTLE-------NWLREFNKFCPDLKIEPY 603
           GLGKT   +  LS L+Q +   G   VVV  +  E        +LR F+K+ PD+K   +
Sbjct: 100 GLGKTA--VFVLSTLQQLDPVQGEVSVVVLCNARELAYQIRNEYLR-FSKYMPDVKTAVF 156

Query: 604 YGSQQERAELRDILEDNDGQYDVIVTTYN----LASGNKYDVSFLKN 646
           YG  + + ++ D+L   +    +IV T      L      D+S +KN
Sbjct: 157 YGGTEYKNDI-DLLSKKETVPHIIVATPGRLKALVRDKHIDLSHVKN 202

>KLLA0F15950g 1477113..1478522 similar to sp|P20449 Saccharomyces
            cerevisiae YOR046c DBP5 RNA helicase, start by similarity
          Length = 469

 Score = 30.4 bits (67), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 33/70 (47%), Gaps = 2/70 (2%)

Query: 952  LDGSTQVNDRQALIDKFHDDDTIPVFILSTKAGGFGINLVCANNVIIFDQSFNPHDDKQA 1011
            L G  Q  DR  LID F +  +    +++T     GI++   + V+ +D    P+     
Sbjct: 347  LHGDLQSQDRDRLIDDFREGRS--KVLITTNVLARGIDIPSVSMVVNYDLPTLPNGQADP 404

Query: 1012 ADRSHRVGQT 1021
            +   HR+G+T
Sbjct: 405  STYVHRIGRT 414

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 31,731,849
Number of extensions: 1322015
Number of successful extensions: 4940
Number of sequences better than 10.0: 131
Number of HSP's gapped: 4681
Number of HSP's successfully gapped: 253
Length of query: 1066
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 954
Effective length of database: 12,718,893
Effective search space: 12133823922
Effective search space used: 12133823922
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)