Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.711274273137720.0
ACR288W73674425620.0
KLLA0F15884g79078724670.0
YAL021C (CCR4)83769123950.0
CAGL0H06149g87368523240.0
Scas_548.285572722350.0
CAGL0F01001g3593563374e-34
Kwal_26.71703723663145e-31
KLLA0F07733g3713543092e-30
Scas_643.173893483093e-30
YOL042W (NGL1)3633662977e-29
ACR277C3783562722e-25
Scas_692.124762482183e-18
ABL118W5042351882e-14
CAGL0I02684g4932261853e-14
Scas_497.35562341774e-13
Kwal_27.102044942371756e-13
Sklu_2335.34312261712e-12
YMR285C (NGL2)5152271676e-12
KLLA0C06248g5162621587e-11
CAGL0B02387g4712371391e-08
YML118W (NGL3)5052721337e-08
CAGL0D02288g868591293e-07
KLLA0C13145g792831194e-06
ADR381C719591161e-05
KLLA0F15708g19001031161e-05
Kwal_26.6909708921151e-05
AAL162C1874911161e-05
YOR353C (SOG2)791591052e-04
YJL005W (CYR1)20261031043e-04
Kwal_33.151531861951017e-04
CAGL0D03168g208293990.001
Scas_619.889459980.001
Sklu_2261.292473950.003
Scas_669.13194879880.021
KLLA0D02816g362107780.28
AER010C76446780.30
AFR110C843187740.87
AAR141W30342711.5
Scas_700.5450102702.8
Sklu_2339.435376684.4
Kwal_47.167091688121685.2
CAGL0J06534g167042676.9
Kwal_56.23844149448676.9
AER104W34976667.3
CAGL0E01595g468119667.6
YOR373W (NUD1)85160669.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.7112
         (731 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.7112                                                         1457   0.0  
ACR288W [1335] [Homologous to ScYAL021C (CCR4) - SH] complement(...   991   0.0  
KLLA0F15884g complement(1468612..1470984) similar to sp|P31384 S...   954   0.0  
YAL021C (CCR4) [47] chr1 complement(110849..113362) Component of...   927   0.0  
CAGL0H06149g complement(598643..601264) similar to sp|P31384 Sac...   899   0.0  
Scas_548.2                                                            865   0.0  
CAGL0F01001g 106796..107875 highly similar to tr|Q08213 Saccharo...   134   4e-34
Kwal_26.7170                                                          125   5e-31
KLLA0F07733g 731317..732432 similar to sgd|S0005402 Saccharomyce...   123   2e-30
Scas_643.17                                                           123   3e-30
YOL042W (NGL1) [4776] chr15 (249823..250914) Mitochondrial membe...   119   7e-29
ACR277C [1324] [Homologous to ScYOL042W (NGL1) - SH] (857936..85...   109   2e-25
Scas_692.12                                                            89   3e-18
ABL118W [474] [Homologous to ScYMR285C (NGL2) - SH; ScYML118W (N...    77   2e-14
CAGL0I02684g complement(239316..240797) similar to sp|Q03264 Sac...    76   3e-14
Scas_497.3                                                             73   4e-13
Kwal_27.10204                                                          72   6e-13
Sklu_2335.3 YMR285C, Contig c2335 6512-7807 reverse complement         70   2e-12
YMR285C (NGL2) [4239] chr13 complement(840143..841690) Protein r...    69   6e-12
KLLA0C06248g complement(552493..554043) similar to sp|Q03264 Sac...    65   7e-11
CAGL0B02387g complement(228209..229624) weakly similar to sp|Q03...    58   1e-08
YML118W (NGL3) [3853] chr13 (32334..33851) Protein with possible...    56   7e-08
CAGL0D02288g complement(233487..236093) similar to tr|Q08817 Sac...    54   3e-07
KLLA0C13145g 1119411..1121789 weakly similar to sgd|S0005880 Sac...    50   4e-06
ADR381C [2122] [Homologous to ScYOR353C - SH] (1389632..1391791)...    49   1e-05
KLLA0F15708g 1447749..1453451 similar to sp|P08678 Saccharomyces...    49   1e-05
Kwal_26.6909                                                           49   1e-05
AAL162C [25] [Homologous to ScYJL005W (CYR1) - SH] (58565..64189...    49   1e-05
YOR353C (SOG2) [5130] chr15 complement(998448..1000823) Protein ...    45   2e-04
YJL005W (CYR1) [2897] chr10 (425072..431152) Adenylate cyclase, ...    45   3e-04
Kwal_33.15153                                                          44   7e-04
CAGL0D03168g complement(324192..330440) similar to sp|P08678 Sac...    43   0.001
Scas_619.8                                                             42   0.001
Sklu_2261.2 YOR353C, Contig c2261 1277-4051 reverse complement         41   0.003
Scas_669.13                                                            39   0.021
KLLA0D02816g complement(238050..239138) similar to sp|P36047 Sac...    35   0.28 
AER010C [2515] [Homologous to ScYBR007C - SH] (650061..652355) [...    35   0.30 
AFR110C [3302] [Homologous to ScYGR157W (CHO2) - SH] (633808..63...    33   0.87 
AAR141W [328] [Homologous to ScYKR071C (DRE2) - SH] complement(5...    32   1.5  
Scas_700.5                                                             32   2.8  
Sklu_2339.4 YKL193C, Contig c2339 10414-11475                          31   4.4  
Kwal_47.16709                                                          31   5.2  
CAGL0J06534g 623480..628492 similar to sp|P52593 Saccharomyces c...    30   6.9  
Kwal_56.23844                                                          30   6.9  
AER104W [2609] [Homologous to ScYKL193C (SDS22) - SH] complement...    30   7.3  
CAGL0E01595g 152176..153582 similar to sp|Q08271 Saccharomyces c...    30   7.6  
YOR373W (NUD1) [5148] chr15 (1036830..1039385) Spindle pole body...    30   9.2  

>Kwal_26.7112
          Length = 742

 Score = 1457 bits (3772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 700/731 (95%), Positives = 700/731 (95%)

Query: 1   MNNPAPMMGYSGMAGQQNVGQSAMPSVMGTPGTIPQQLHMQQAHTQNGQTXXXXXXXXXX 60
           MNNPAPMMGYSGMAGQQNVGQSAMPSVMGTPGTIPQQLHMQQAHTQNGQT          
Sbjct: 1   MNNPAPMMGYSGMAGQQNVGQSAMPSVMGTPGTIPQQLHMQQAHTQNGQTAAGQQVQQLP 60

Query: 61  XXXXXSSDQTLSGMVNGGNVGATLAASNAGNPLYHPHQGDPAMLNNPIWKLQLQLAAVSR 120
                SSDQTLSGMVNGGNVGATLAASNAGNPLYHPHQGDPAMLNNPIWKLQLQLAAVSR
Sbjct: 61  PPGLVSSDQTLSGMVNGGNVGATLAASNAGNPLYHPHQGDPAMLNNPIWKLQLQLAAVSR 120

Query: 121 QSLGRANVYARQSAMRKYLLNKTQGASSGGTLNEMSASLVDHTKQLLLDMAGESPLGNNN 180
           QSLGRANVYARQSAMRKYLLNKTQGASSGGTLNEMSASLVDHTKQLLLDMAGESPLGNNN
Sbjct: 121 QSLGRANVYARQSAMRKYLLNKTQGASSGGTLNEMSASLVDHTKQLLLDMAGESPLGNNN 180

Query: 181 ASSSAVSTPITPNAELSNGHPTTPSVLLQHKKLSQYNIDEDDEIEHRMVGPKDAKHDDQL 240
           ASSSAVSTPITPNAELSNGHPTTPSVLLQHKKLSQYNIDEDDEIEHRMVGPKDAKHDDQL
Sbjct: 181 ASSSAVSTPITPNAELSNGHPTTPSVLLQHKKLSQYNIDEDDEIEHRMVGPKDAKHDDQL 240

Query: 241 WHALDLSNLQVFNLTESLFRYEFLTRLYLNGNNLTVLPKAVKSLKNLRVLDLSHNRLTEL 300
           WHALDLSNLQVFNLTESLFRYEFLTRLYLNGNNLTVLPKAVKSLKNLRVLDLSHNRLTEL
Sbjct: 241 WHALDLSNLQVFNLTESLFRYEFLTRLYLNGNNLTVLPKAVKSLKNLRVLDLSHNRLTEL 300

Query: 301 PSELGLCHQLKYLYFFDNMVSTLPWXXXXXXXXXXXXXXXXPMDRQMIKIITEKSVTGLI 360
           PSELGLCHQLKYLYFFDNMVSTLPW                PMDRQMIKIITEKSVTGLI
Sbjct: 301 PSELGLCHQLKYLYFFDNMVSTLPWEFGNLFNLQFLGLEGNPMDRQMIKIITEKSVTGLI 360

Query: 361 FYLRDNAPEIPLPTERKFIDINVDGEVTQEYASLQESDSHLNRETAKKSFTLLSYNTLCQ 420
           FYLRDNAPEIPLPTERKFIDINVDGEVTQEYASLQESDSHLNRETAKKSFTLLSYNTLCQ
Sbjct: 361 FYLRDNAPEIPLPTERKFIDINVDGEVTQEYASLQESDSHLNRETAKKSFTLLSYNTLCQ 420

Query: 421 HYATPKMYRFTPSWALSWDYRREKLKEQILYYSTDIICLQEVECKTYEDFWAPLLREEGY 480
           HYATPKMYRFTPSWALSWDYRREKLKEQILYYSTDIICLQEVECKTYEDFWAPLLREEGY
Sbjct: 421 HYATPKMYRFTPSWALSWDYRREKLKEQILYYSTDIICLQEVECKTYEDFWAPLLREEGY 480

Query: 481 TGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSSVWMKHKKFQRTEDYL 540
           TGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSSVWMKHKKFQRTEDYL
Sbjct: 481 TGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSSVWMKHKKFQRTEDYL 540

Query: 541 NRAMNKDNVALLVKLQHLKSGEHVWAATTHLHWDPQFNDVKTFQVGVLLDHMEKVIKEHS 600
           NRAMNKDNVALLVKLQHLKSGEHVWAATTHLHWDPQFNDVKTFQVGVLLDHMEKVIKEHS
Sbjct: 541 NRAMNKDNVALLVKLQHLKSGEHVWAATTHLHWDPQFNDVKTFQVGVLLDHMEKVIKEHS 600

Query: 601 GYNNSQELKKVPVIICGDFNSQVDSAVYELLSTGSVRQHCDIEGRDFGFMSQKNYAHNLP 660
           GYNNSQELKKVPVIICGDFNSQVDSAVYELLSTGSVRQHCDIEGRDFGFMSQKNYAHNLP
Sbjct: 601 GYNNSQELKKVPVIICGDFNSQVDSAVYELLSTGSVRQHCDIEGRDFGFMSQKNYAHNLP 660

Query: 661 LKSSYECIGELPFTNLTPTYTDVIDYIWYSSQGLRVRGVLGQIDPDYASKFIGFPNDKFP 720
           LKSSYECIGELPFTNLTPTYTDVIDYIWYSSQGLRVRGVLGQIDPDYASKFIGFPNDKFP
Sbjct: 661 LKSSYECIGELPFTNLTPTYTDVIDYIWYSSQGLRVRGVLGQIDPDYASKFIGFPNDKFP 720

Query: 721 SDHIPLLTRFE 731
           SDHIPLLTRFE
Sbjct: 721 SDHIPLLTRFE 731

>ACR288W [1335] [Homologous to ScYAL021C (CCR4) - SH]
           complement(882345..884555) [2211 bp, 736 aa]
          Length = 736

 Score =  991 bits (2562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/744 (63%), Positives = 574/744 (77%), Gaps = 38/744 (5%)

Query: 1   MNNPAPMMGYSGMAGQQNVGQSAMPSVMGTPGTIPQQLHMQQAHTQNGQTXXXXXXXXXX 60
           MNNP PMMGY      Q  G  ++  ++GTP  + Q LH      Q G T          
Sbjct: 1   MNNPPPMMGY------QPSGGGSVTQMLGTPQPLAQPLH------QTGPTQQAQQMLQQP 48

Query: 61  XXXXXSSDQTLSGMVNGGNVGATLAASNAGNPLYHPHQGDPAMLNNPIWKLQLQLAAVSR 120
                S  + + G +  G VG+        NPL HPHQ DP ++NNPIWKLQLQLAA+SR
Sbjct: 49  PGLVSSGTRQMLGQI--GQVGS--------NPLCHPHQSDPTLVNNPIWKLQLQLAAISR 98

Query: 121 QSLGRANVYARQSAMRKYLLNKTQGASSGGTLNEMSASLVDHTKQLLLDMAGESPLGNNN 180
           QS+G+ANVYARQ+AM+KYL+ +T G+       +M+ SLVD TKQ LL+MA +  + NN 
Sbjct: 99  QSVGQANVYARQNAMKKYLMTQTNGSQQPA---DMAKSLVDFTKQYLLEMAADPAVPNNA 155

Query: 181 ASSSA-----------VSTPITPNAELSNGHPTTPSVLLQHKKLSQ--YNIDEDDEIEHR 227
           A +++           VSTP TP AEL+N   TTPS+LLQ ++     +NIDEDDE+EHR
Sbjct: 156 ALAASGQQIQRPHGTPVSTPSTPKAELANNAQTTPSILLQQQQKKLSQFNIDEDDEVEHR 215

Query: 228 MVGPKDAKHDDQLWHALDLSNLQVFNLTESLFRYEFLTRLYLNGNNLTVLPKAVKSLKNL 287
           M+ P + K+D+QLWH +DLSNL V+NL E+LF+Y+FLTRLYLNGNNLT LP ++K L+NL
Sbjct: 216 MMAPVNTKYDEQLWHTIDLSNLSVYNLNENLFKYDFLTRLYLNGNNLTHLPASIKQLQNL 275

Query: 288 RVLDLSHNRLTELPSELGLCHQLKYLYFFDNMVSTLPWXXXXXXXXXXXXXXXXPMDRQM 347
           RVLD+SHNRLTELP ELG+C+QLKYLYFFDNMVSTLPW                P+DRQ+
Sbjct: 276 RVLDVSHNRLTELPPELGMCYQLKYLYFFDNMVSTLPWEFGNLFNLQFLGCEGNPLDRQL 335

Query: 348 IKIITEKSVTGLIFYLRDNAPEIPLPTERKFIDINVDGEVTQEYASLQESDSHLNRETAK 407
           IKI+TEKSVTGLIFYLRDNAPEIPLP  R+FI++N DGE  + Y  ++ES +HLN E  K
Sbjct: 336 IKILTEKSVTGLIFYLRDNAPEIPLPEPRRFIEVNADGESVETYRCIEESTNHLNEELLK 395

Query: 408 KSFTLLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQILYYSTDIICLQEVECKTY 467
           KSFTLLSYNTLCQHYATPKMYRF PSWALSWDYRREKLK+++L Y TDIICLQEVE KTY
Sbjct: 396 KSFTLLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKDEVLAYQTDIICLQEVESKTY 455

Query: 468 EDFWAPLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSSVW 527
           E+FW P+L ++GY+GIFHAKTRARTMQ KD+KKVDGCC+FY++SEF  +FKD +DFSSVW
Sbjct: 456 EEFWLPILEKQGYSGIFHAKTRARTMQSKDAKKVDGCCIFYKNSEFTAVFKDAIDFSSVW 515

Query: 528 MKHKKFQRTEDYLNRAMNKDNVALLVKLQHLKSGEHVWAATTHLHWDPQFNDVKTFQVGV 587
           MKHKKFQRTEDYLNRAMNKDNVAL++KL+H ++GEHVW  TTHLHWDP FNDVKTFQV V
Sbjct: 516 MKHKKFQRTEDYLNRAMNKDNVALIIKLRHERTGEHVWVVTTHLHWDPHFNDVKTFQVAV 575

Query: 588 LLDHMEKVIKEHSGYNNSQELKKVPVIICGDFNSQVDSAVYELLSTGSVRQHCDIEGRDF 647
           +LD++EK++K+H G  + Q+ KK+P++ICGDFNSQ+DSAV EL +TGSVR H DIEGRDF
Sbjct: 576 MLDYIEKLLKQHGGVGSPQDKKKIPLVICGDFNSQLDSAVVELFNTGSVRSHKDIEGRDF 635

Query: 648 GFMSQKNYAHNLPLKSSYECIGELPFTNLTPTYTDVIDYIWYSSQGLRVRGVLGQIDPDY 707
           G+MSQKN+AH L LKSSY  IGELPFTNL+PT+TDVIDYIWYS+Q LRVRG+LG+IDP Y
Sbjct: 636 GYMSQKNFAHGLALKSSYGSIGELPFTNLSPTFTDVIDYIWYSTQALRVRGLLGEIDPAY 695

Query: 708 ASKFIGFPNDKFPSDHIPLLTRFE 731
           A+KFIG PNDK PSDHIPLL RFE
Sbjct: 696 AAKFIGLPNDKIPSDHIPLLARFE 719

>KLLA0F15884g complement(1468612..1470984) similar to sp|P31384
           Saccharomyces cerevisiae YAL021c CCR4 transcriptional
           regulator, hypothetical start
          Length = 790

 Score =  954 bits (2467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/787 (59%), Positives = 569/787 (72%), Gaps = 67/787 (8%)

Query: 1   MNNPAPMMGYSGMAGQQNVGQSAMPSVMGTPGTIPQQLHMQQAHTQNGQTXXXXXXXXXX 60
           MN P P+ G+   AGQ      A+P ++GTP  + QQLH         Q           
Sbjct: 1   MNYPPPLSGFQKPAGQ------AVPQMVGTPQAVTQQLHQHPPGLMGNQGNQHQPAQLNN 54

Query: 61  XXXXXSSDQTLSGMVNGG-----------NVGA---------TLAASNAGNPLYHPHQGD 100
                 +   +  ++ GG           NVG              SNA NPL HPH  D
Sbjct: 55  VLPMMMNQ--VQNVITGGAGGPQQAVGPPNVGTPNAAQAALVAQQLSNANNPLCHPHLAD 112

Query: 101 PAMLNNPIWKLQLQLAAVSRQSLGRANVYARQSAMRKYLLNKTQ-GASSGGT-------- 151
           P++LN+PIWKLQLQLAAVSRQSLG++NVYARQ+AM+K+L N+ Q G S+ G         
Sbjct: 113 PSLLNSPIWKLQLQLAAVSRQSLGQSNVYARQNAMKKFLNNQNQLGLSTNGQDGVQSQQQ 172

Query: 152 -------------------LNEMSASLVDHTKQLLLDMAGESPLG-------NNNASSSA 185
                               N+ S SLV+HTKQ L++MA             N++ +S+ 
Sbjct: 173 QGQQQQPSQSGQQQGQQPLGNDASMSLVEHTKQHLMEMASSGNEATASAVNVNSDLNSTG 232

Query: 186 VSTPITPNAELSNGHPTTPSVLLQHKKLSQYNIDEDDEIEHRMVGPKDAKHDDQLWHALD 245
            STP TP AEL   HP TPS+LLQHKKLSQYNIDEDDEIEHRMV P ++KHDDQLWHALD
Sbjct: 233 FSTPNTPKAEL---HPNTPSLLLQHKKLSQYNIDEDDEIEHRMVAPTNSKHDDQLWHALD 289

Query: 246 LSNLQVFNLTESLFRYEFLTRLYLNGNNLTVLPKAVKSLKNLRVLDLSHNRLTELPSELG 305
           LSNL +FNL E LF YEFLTRLYLNGN+LT LP ++K L+NLRVLDLSHNRLTELP ELG
Sbjct: 290 LSNLALFNLNEKLFHYEFLTRLYLNGNSLTSLPSSIKKLRNLRVLDLSHNRLTELPKELG 349

Query: 306 LCHQLKYLYFFDNMVSTLPWXXXXXXXXXXXXXXXXPMDRQMIKIITEKSVTGLIFYLRD 365
           +C+QLKYLYFFDNM++T+PW                P+D+Q++KII EKSVTGLIFYLRD
Sbjct: 350 MCYQLKYLYFFDNMITTIPWEFGNLFNLQFLGLEGNPLDKQLVKIIAEKSVTGLIFYLRD 409

Query: 366 NAPEIPLPTERKFIDINVDGEVTQEYASLQESDSHLNRETAKKSFTLLSYNTLCQHYATP 425
           NAPEIP   +RKFI+I+ DGE T EY SLQE+ +H+N    K SFTLLSYNTLC HYATP
Sbjct: 410 NAPEIPYAKDRKFIEISADGEPTNEYESLQENTNHMNNTLLKNSFTLLSYNTLCHHYATP 469

Query: 426 KMYRFTPSWALSWDYRREKLKEQILYYSTDIICLQEVECKTYEDFWAPLLREEGYTGIFH 485
           KMYRFTPSWALSWDYRREKLKEQ+L + TD+ICLQEVE  TYE++W PL+ +  Y+ +FH
Sbjct: 470 KMYRFTPSWALSWDYRREKLKEQLLDFDTDVICLQEVETLTYEEYWVPLMEKYNYSCLFH 529

Query: 486 AKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSSVWMKHKKFQRTEDYLNRAMN 545
           AKTRA+TM  KDSKKVDGC +FY+  +F+L+F+D++DFSS W  HKKF RTEDYLNRAMN
Sbjct: 530 AKTRAKTMHAKDSKKVDGCAIFYKKDQFQLVFQDSIDFSSAWRSHKKFHRTEDYLNRAMN 589

Query: 546 KDNVALLVKLQHLKSGEHVWAATTHLHWDPQFNDVKTFQVGVLLDHMEKVIKEHSGYNNS 605
           KDNVAL+ +L+HL + E+VW  TTHLHWDPQFNDVKTFQVGV+LD++E +IK+H   NN+
Sbjct: 590 KDNVALIAELKHLNTNENVWVVTTHLHWDPQFNDVKTFQVGVMLDYLETLIKQHHHVNNN 649

Query: 606 QELKKVPVIICGDFNSQVDSAVYELLSTGSVR-QHCDIEGRDFGFMSQKNYAHNLPLKSS 664
            ++KK+P++ICGDFNSQ+DSAV EL ++G V   H DI+ RDFG+MSQKN++HNL L+SS
Sbjct: 650 NDIKKIPMVICGDFNSQLDSAVVELFNSGHVTANHKDIDQRDFGYMSQKNFSHNLSLRSS 709

Query: 665 YECIGELPFTNLTPTYTDVIDYIWYSSQGLRVRGVLGQIDPDYASKFIGFPNDKFPSDHI 724
           Y  IGELPFTN+TP++TDVIDYIWYSSQ LRVRG+LG+ID +YASKFIGFPNDKFPSDHI
Sbjct: 710 YGAIGELPFTNMTPSFTDVIDYIWYSSQSLRVRGLLGKIDEEYASKFIGFPNDKFPSDHI 769

Query: 725 PLLTRFE 731
           PL+TRFE
Sbjct: 770 PLVTRFE 776

>YAL021C (CCR4) [47] chr1 complement(110849..113362) Component of
           the CCR4 transcriptional complex and catalytic component
           of the major cytoplasmic mRNA deadenylase with 3' to 5'
           exonuclease activity, member of magnesium-dependent
           ExoIII-APE nuclease family [2514 bp, 837 aa]
          Length = 837

 Score =  927 bits (2395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/691 (63%), Positives = 533/691 (77%), Gaps = 47/691 (6%)

Query: 88  NAGNPLYHPHQGDPAMLNNPIWKLQLQLAAVSRQSLGRANVYARQSAMRKYLLNKT---- 143
           NA NPL HPH  DP++LNNPIWKLQL LAAVS QSLG+ N+YARQ+AM+KYL  +     
Sbjct: 136 NASNPLLHPHLDDPSLLNNPIWKLQLHLAAVSAQSLGQPNIYARQNAMKKYLATQQAQQA 195

Query: 144 --------------------QGASSG--------GTLNEMSASLVDHTKQLLLDMAG--- 172
                               Q A             + E S SLVD TKQ L++MA    
Sbjct: 196 QQQAQQQAQQQVPGPFGPGPQAAPPALQPTDFQQSHIAEASKSLVDCTKQALMEMADTLT 255

Query: 173 -------ESPLGNNN----ASSSAVSTPITPNAEL-SNGHPTTPSVLLQHKKLSQYNIDE 220
                  + P G++     A++SAVSTP+TP  EL +NG       LLQHKKLSQY+IDE
Sbjct: 256 DSKTAKKQQPTGDSTPSGTATNSAVSTPLTPKIELFANGKDEANQALLQHKKLSQYSIDE 315

Query: 221 DDEIEHRMVGPKDAKHDDQLWHALDLSNLQVFNLTESLFRYEFLTRLYLNGNNLTVLPKA 280
           DD+IE+RMV PKD+K+DDQLWHALDLSNLQ+FN++ ++F+Y+FLTRLYLNGN+LT LP  
Sbjct: 316 DDDIENRMVMPKDSKYDDQLWHALDLSNLQIFNISANIFKYDFLTRLYLNGNSLTELPAE 375

Query: 281 VKSLKNLRVLDLSHNRLTELPSELGLCHQLKYLYFFDNMVSTLPWXXXXXXXXXXXXXXX 340
           +K+L NLRVLDLSHNRLT LP+ELG C QLKY YFFDNMV+TLPW               
Sbjct: 376 IKNLSNLRVLDLSHNRLTSLPAELGSCFQLKYFYFFDNMVTTLPWEFGNLCNLQFLGVEG 435

Query: 341 XPMDRQMIKIITEKSVTGLIFYLRDNAPEIPLPTERKFIDINVDGEVTQEYASLQESDSH 400
            P+++Q +KI+TEKSVTGLIFYLRDN PEIPLP ER+FI+IN DGE  +EY SLQ+S  H
Sbjct: 436 NPLEKQFLKILTEKSVTGLIFYLRDNRPEIPLPHERRFIEINTDGEPQREYDSLQQSTEH 495

Query: 401 LNRETAKKSFTLLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQILYYSTDIICLQ 460
           L  + AK++FT+LSYNTLCQHYATPKMYR+TPSWALSWDYRR KLKEQIL Y +D++CLQ
Sbjct: 496 LATDLAKRTFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQ 555

Query: 461 EVECKTYEDFWAPLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDT 520
           EVE KT+E++W PLL + GYTGIFHAK RA+TM  KDSKKVDGCC+F++  +FKLI KD 
Sbjct: 556 EVESKTFEEYWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKLITKDA 615

Query: 521 VDFSSVWMKHKKFQRTEDYLNRAMNKDNVALLVKLQHLKSGEHVWAATTHLHWDPQFNDV 580
           +DFS  WMKHKKFQRTEDYLNRAMNKDNVAL +KLQH+ SG+ +WA TTHLHWDP+FNDV
Sbjct: 616 MDFSGAWMKHKKFQRTEDYLNRAMNKDNVALFLKLQHIPSGDTIWAVTTHLHWDPKFNDV 675

Query: 581 KTFQVGVLLDHMEKVIKEHSGYNNSQELKKVPVIICGDFNSQVDSAVYELLSTGSVRQHC 640
           KTFQVGVLLDH+E ++KE + +N  Q++KK PV+ICGDFNS ++SAVYEL++TG V+ H 
Sbjct: 676 KTFQVGVLLDHLETLLKEETSHNFRQDIKKFPVLICGDFNSYINSAVYELINTGRVQIHQ 735

Query: 641 DIEGRDFGFMSQKNYAHNLPLKSSYECIGELPFTNLTPTYTDVIDYIWYSSQGLRVRGVL 700
           +  GRDFG+MS+KN++HNL LKSSY CIGELPFTN TP++TDVIDYIW+S+  LRVRG+L
Sbjct: 736 EGNGRDFGYMSEKNFSHNLALKSSYNCIGELPFTNFTPSFTDVIDYIWFSTHALRVRGLL 795

Query: 701 GQIDPDYASKFIGFPNDKFPSDHIPLLTRFE 731
           G++DP+Y SKFIGFPNDKFPSDHIPLL RFE
Sbjct: 796 GEVDPEYVSKFIGFPNDKFPSDHIPLLARFE 826

>CAGL0H06149g complement(598643..601264) similar to sp|P31384
           Saccharomyces cerevisiae YAL021c CCR4, start by
           similarity
          Length = 873

 Score =  899 bits (2324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/685 (62%), Positives = 536/685 (78%), Gaps = 27/685 (3%)

Query: 71  LSGMVNGGNVGATLAA------SNAGNPLYHPHQGDPAMLNNPIWKLQLQLAAVSRQSLG 124
           + G+   GN    LAA      +NA NP+YHPH  DP+++NNPIWKLQLQLA VS QS+G
Sbjct: 175 MPGISTFGNTPGQLAAPPIQPNANANNPMYHPHLEDPSLMNNPIWKLQLQLATVSAQSVG 234

Query: 125 RANVYARQSAMRKYLLNKTQGASSGGT-------LNEMSASLVDHTKQLLLDMAG----- 172
           + N+YARQ+AM+KYL  +    +           + E S SLVD TKQ L+D+       
Sbjct: 235 QPNIYARQNAMKKYLATQVPPQNQTQQQAQAQSQIAETSKSLVDCTKQALMDIMAPDDSK 294

Query: 173 ----ESPLGNNNASSSAVSTPITPNAELSNG--HPTTPSVLLQHKKLSQYNIDEDDEIEH 226
                +P   +  ++S +STP T   +++N    P+TPS+LLQHKKLSQY+IDEDDE+E+
Sbjct: 295 LKGMSAPNTASTTTNSTISTPTTSKIDMNNSREQPSTPSLLLQHKKLSQYSIDEDDEVEN 354

Query: 227 RMVGPKDAKHDDQLWHALDLSNLQVFNLTESLFRYEFLTRLYLNGNNLTVLPKAVKSLKN 286
           RMV PKD K++DQ+WHA+DLSNLQ+FN++ +L +Y+FLTRLYLNGN L  +P ++++LKN
Sbjct: 355 RMVAPKDTKYNDQIWHAIDLSNLQIFNISPNLMKYDFLTRLYLNGNGLESIPSSIRNLKN 414

Query: 287 LRVLDLSHNRLTELPSELGLCHQLKYLYFFDNMVSTLPWXXXXXXXXXXXXXXXXPMDRQ 346
           LRVLDLSHN+L ELP E+G C+QLKYLYFFDN ++TLPW                P+D++
Sbjct: 415 LRVLDLSHNKLKELPKEIGNCYQLKYLYFFDNQITTLPWELGNLCNIQFLGCEGNPLDKE 474

Query: 347 MIKIITEKSVTGLIFYLRDNAPEIPLPTERKFIDINVDGEVTQEYASLQESDSHLNRETA 406
           ++KI+TEKS TGLIFYLRDN PE+P P +RKFI+IN DGE  +EY ++QE++ +L+ +  
Sbjct: 475 LLKILTEKSFTGLIFYLRDNRPEVPYPHDRKFIEINADGEPEKEYDTVQEAERNLSSDMQ 534

Query: 407 KKSFTLLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQILYYSTDIICLQEVECKT 466
           KKSFT+LSYNTLCQHYATPKMYR+TPSWALSWDYRREKLKEQIL ++TDIICLQEVE KT
Sbjct: 535 KKSFTMLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILNFNTDIICLQEVEAKT 594

Query: 467 YEDFWAPLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSSV 526
           +EDFW PLL + GYTG+FHAKTRA+TMQ KDSKKVDGCC FY+ S+FK++FK+ VDFS +
Sbjct: 595 FEDFWQPLLEKHGYTGLFHAKTRAKTMQSKDSKKVDGCCAFYKTSKFKMLFKECVDFSGL 654

Query: 527 WMKHKKFQRTEDYLNRAMNKDNVALLVKLQHLKSGEHVWAATTHLHWDPQFNDVKTFQVG 586
           WMKHKKFQRTEDYLNRAMNKDNVA+++KLQH++SGE +W  TTHLHWDP+FNDVKTFQVG
Sbjct: 655 WMKHKKFQRTEDYLNRAMNKDNVAIVMKLQHIQSGEIMWLVTTHLHWDPKFNDVKTFQVG 714

Query: 587 VLLDHMEKVIKEHSGYNNSQELKKVPVIICGDFNSQVDSAVYELLSTGSVRQHCDIEGRD 646
           VLLDHME ++KE    N  Q++KK P++ICGD NS + S+VYEL STG V+ H D + RD
Sbjct: 715 VLLDHMETLLKEQ---NPKQDVKKYPLVICGDLNSYLSSSVYELFSTGRVQHHHDGKDRD 771

Query: 647 FGFMSQKNYAHNLPLKSSYECIGELPFTNLTPTYTDVIDYIWYSSQGLRVRGVLGQIDPD 706
           FG+ S+ N++HNL LKSSY CIGEL FTN TP++TDVIDYIW+SSQ LRVRG+LG++D +
Sbjct: 772 FGYFSEDNFSHNLALKSSYNCIGELAFTNFTPSFTDVIDYIWFSSQALRVRGLLGEVDSE 831

Query: 707 YASKFIGFPNDKFPSDHIPLLTRFE 731
           Y S FIGFPNDKFPSDHIPLL R+E
Sbjct: 832 YVSNFIGFPNDKFPSDHIPLLGRYE 856

>Scas_548.2
          Length = 855

 Score =  865 bits (2235), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/727 (60%), Positives = 532/727 (73%), Gaps = 85/727 (11%)

Query: 87  SNAGNPLYHPHQGDPAMLNNPIWKLQLQLAAVSRQSLGRANVYARQSAMRKYLLNKTQGA 146
           +NA NPL+HPH  DP +L+NPIWKLQLQLA VS QSLG+ NVYARQ+AM+KYL ++ Q  
Sbjct: 121 ANANNPLFHPHLEDPTLLSNPIWKLQLQLANVSLQSLGQPNVYARQNAMKKYLASQNQSQ 180

Query: 147 -SSGGTL------------------------------------------NEMSASLVDHT 163
            +S  TL                                          +EMS SLVD T
Sbjct: 181 NTSNNTLTAPVVPNNTNNPTIQPQSQTTTGAPTTNENINQSQQQQQTQPSEMSMSLVDRT 240

Query: 164 KQLLLDMAGES----------------------PLGNNNA-------------SSSAVST 188
           K+LL++MA E+                      P   N A             ++S + T
Sbjct: 241 KKLLMEMATETSKEKGKTSKPSTANSANNGNSMPNNTNEAMTPSSANTPLATTNNSRMGT 300

Query: 189 PITPNAELSNG---HPTTPSVLLQHKKLSQ-YNIDEDDEIEHRMVGPKDAKHDDQLWHAL 244
           P TP+ EL N    + TTPSVLLQHKKLSQ YNIDEDDEIE+RMV PKD K++DQLWHA+
Sbjct: 301 PTTPHTELLNTRDQNSTTPSVLLQHKKLSQQYNIDEDDEIENRMVAPKDTKYNDQLWHAI 360

Query: 245 DLSNLQVFNLTESLFRYEFLTRLYLNGNNLTVLPKAVKSLKNLRVLDLSHNRLTELPSEL 304
           D SNLQ+F++ ++LF+Y FLTRLYLNGN LT +PK +K+L NL VLDLS+N+L+ELPSE+
Sbjct: 361 DFSNLQIFHINDNLFKYTFLTRLYLNGNGLTHIPKEIKNLNNLCVLDLSNNKLSELPSEI 420

Query: 305 GLCHQLKYLYFFDNMVSTLPWXXXXXXXXXXXXXXXXPMDRQMIKIITEKSVTGLIFYLR 364
           G C +LKYLYFF+N++S LPW                P+D++++KI+TEKSVTGLIFYLR
Sbjct: 421 GSCFRLKYLYFFNNLISDLPWEFGNLYNLQFLGCEGNPLDKKLLKILTEKSVTGLIFYLR 480

Query: 365 DNAPEIPLPTERKFIDINVDGEVTQEYASLQESDSHLNRETAKKSFTLLSYNTLCQHYAT 424
           DN PEIPL  +RKFI+I+ +GE  +EY SL+ +D++ N +  KKSFTLLSYNTLCQHYAT
Sbjct: 481 DNRPEIPLIKDRKFIEIDTEGEPVREYDSLKLADANGNPDLEKKSFTLLSYNTLCQHYAT 540

Query: 425 PKMYRFTPSWALSWDYRREKLKEQILYYSTDIICLQEVECKTYEDFWAPLLREEGYTGIF 484
           PKMYR+TPSWALSWDYRREKLK+QIL Y +DI+CLQEVE KT+E+FW+PLL +  Y GIF
Sbjct: 541 PKMYRYTPSWALSWDYRREKLKDQILSYQSDILCLQEVESKTFEEFWSPLLEKYDYQGIF 600

Query: 485 HAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSSVWMKHKKFQRTEDYLNRAM 544
           H KTRA+TMQ KDSKKVDGCC+F++ S+FKL+FK+ +DFS  WMKHKKFQRTEDYLNRAM
Sbjct: 601 HIKTRAKTMQSKDSKKVDGCCIFFKKSKFKLLFKEAMDFSGTWMKHKKFQRTEDYLNRAM 660

Query: 545 NKDNVALLVKLQHLKSGEHVWAATTHLHWDPQFNDVKTFQVGVLLDHMEKVIKEHSGYNN 604
           NKDNVAL +KLQ L SGE VW  TTHLHWDP+FNDVKTFQVG+LLDHME ++KE    N 
Sbjct: 661 NKDNVALYLKLQSLTSGESVWVVTTHLHWDPKFNDVKTFQVGILLDHMEALLKEE---NP 717

Query: 605 SQELKKVPVIICGDFNSQVDSAVYELLSTGSVRQHCDIEGRDFGFMSQKNYAHNLPLKSS 664
            Q++KK  V+ICGD NS  DSAVYELLSTG V  H D +GRDFG+MSQKN+AHNL L+SS
Sbjct: 718 KQDVKKANVVICGDLNSYFDSAVYELLSTGRVVNHQDNKGRDFGYMSQKNFAHNLSLRSS 777

Query: 665 YECIGELPFTNLTPTYTDVIDYIWYSSQGLRVRGVLGQIDPDYASKFIGFPNDKFPSDHI 724
           Y+ IGELPFTN TP++TDVIDYIW+S+Q +RVRG+LG +D DY S FIGFPNDKFPSDHI
Sbjct: 778 YDYIGELPFTNFTPSFTDVIDYIWFSTQSMRVRGLLGGVDQDYVSNFIGFPNDKFPSDHI 837

Query: 725 PLLTRFE 731
           PLL RFE
Sbjct: 838 PLLARFE 844

>CAGL0F01001g 106796..107875 highly similar to tr|Q08213
           Saccharomyces cerevisiae YOL042w, start by similarity
          Length = 359

 Score =  134 bits (337), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 101/356 (28%), Positives = 173/356 (48%), Gaps = 40/356 (11%)

Query: 403 RETAKKSFTLLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQIL-YYSTDIICLQE 461
           + +AK  FTLLSYN L   Y  P++Y + P     W+YR + L++++L  Y  DI+CLQE
Sbjct: 15  KNSAKPLFTLLSYNLLSPSYMWPQVYTYVPEKYKDWNYRHKLLEQELLDKYRADIMCLQE 74

Query: 462 VECKTYEDFWAPLLREE-GYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDT 520
           +  + Y +FW   L+    Y   + AKT  +  + +  +++DG  +FY   +F+ I +  
Sbjct: 75  LTSEDYSNFWKKALQTNMNYGSNYIAKTPPQYWK-RPVEQMDGVGIFYNLDKFEFISRSG 133

Query: 521 VDFSSV----------WMKHKKFQRTEDYLNRA---------MNKDNVALLVKLQHLKSG 561
           +  + +          +++ K    T+   N+           +K+ VAL V L+H ++G
Sbjct: 134 IYLNQLLGVFSNNELEYLEKKPVTLTDGAGNQVGEQSLLQILKSKNQVALFVSLKHKETG 193

Query: 562 EHVWAATTHLHWDPQFNDVKTFQVGVLLDHMEKVIKEH-SGYNNSQELKKVPVIICGDFN 620
                  THL+W  +++DVK  Q  +++  + ++I++H  G  N  +  K+ ++  GD N
Sbjct: 194 NVFVVINTHLYW--KYDDVKLTQCMIIMRELARIIEKHLVGLENVTD-DKIKILFTGDLN 250

Query: 621 SQVDSAVYELLSTGSVRQHCDIEGRDFGFMSQKNYAHNLPLKSSYECIGELPFTN--LTP 678
           S  DS V   L  G +  H ++   +      K Y  +      Y+ + E  FT+   + 
Sbjct: 251 STSDSLVINFLK-GQIVSHDNLNVIN----PMKPYLEH----CVYDDVPEELFTHTCYSG 301

Query: 679 TYTDVIDYIWYSSQGLRVRGVLGQIDPDY---ASKFIGFPNDKFPSDHIPLLTRFE 731
               + DYIWY     ++R +L   +  +   A    G PN+  PSDHIPL T FE
Sbjct: 302 KLKGIFDYIWYHDTDFKLRRILSGREVSHELAALNQFGLPNENHPSDHIPLFTEFE 357

>Kwal_26.7170
          Length = 372

 Score =  125 bits (314), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 100/366 (27%), Positives = 164/366 (44%), Gaps = 38/366 (10%)

Query: 392 ASLQESDSHLNRETAKKSFTLLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQIL- 450
           A+L+ S   +   T++ +FT ++YN L  +Y  P++Y + P     W YR   L+ +IL 
Sbjct: 16  AALKASLPEIKNGTSRSTFTFMTYNMLSPYYMWPQVYTYVPEKYKEWSYRHRLLEREILN 75

Query: 451 YYSTDIICLQEVECKTYEDFWAPLLREE-GYTGIFHAKTRARTMQGKDSKKVDGCCLFYR 509
            Y  DI+C+QE+ CK Y+ FW    + +  Y   F +KT  +  Q +   ++DG  +FY 
Sbjct: 76  LYRADIMCVQELTCKDYDGFWKGHFKSKMNYGSSFISKTPPKYWQ-RPPDEMDGVGIFYN 134

Query: 510 DSEFKLI------FKDTVDFSSV----WMKHKKFQRT---------EDYLNRAMNKDNVA 550
             +F+ I        D +   ++    ++K      T         +  LN    ++ V+
Sbjct: 135 LDKFEHISTTSIYLNDLIGLFNISELNYLKSTIITLTNGAGEPVDKDSLLNVLHGRNQVS 194

Query: 551 LLVKLQHLKSGEHVWAATTHLHWDPQFNDVKTFQVGVLLDHMEKVIKEHSGYNNSQELKK 610
           L V L H ++        THL+W  ++++VK  Q   ++  + +VIK            K
Sbjct: 195 LFVSLMHKETRTLFVVINTHLYW--KYDEVKLCQCLTIMRKLHRVIKSLLMGREGVTYSK 252

Query: 611 VPVIICGDFNSQVDSAVYELLSTGSV-RQHCDIEGRDFGFMSQKNYAHNLPLKSSYECI- 668
           V ++  GD NS  DS V + L   SV R    +      +++   Y    P    + C  
Sbjct: 253 VKILFAGDLNSAPDSPVVKFLKGESVHRADLSLINPLRPYLNHYIYQDVEPELFEHTCYS 312

Query: 669 GELPFTNLTPTYTDVIDYIWYSSQGLRVRGVL-GQIDPDYASKF--IGFPNDKFPSDHIP 725
           G+L           + DYIWY  +  R++ +L G        +F   G PN   PSDHIP
Sbjct: 313 GKL---------KGIFDYIWYHDKDFRLKRILSGAEVSQELREFQEFGLPNKNHPSDHIP 363

Query: 726 LLTRFE 731
           +LT  E
Sbjct: 364 VLTELE 369

>KLLA0F07733g 731317..732432 similar to sgd|S0005402 Saccharomyces
           cerevisiae YOL042w, start by similarity
          Length = 371

 Score =  123 bits (309), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 103/354 (29%), Positives = 165/354 (46%), Gaps = 50/354 (14%)

Query: 410 FTLLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQILY-YSTDIICLQEVECKTYE 468
           FT+L+YN L  +Y  P++Y +       WDYR   L+ ++ Y Y +DIICLQE+    Y 
Sbjct: 34  FTMLTYNMLSPYYMWPQVYTYVKDEYKDWDYRHRLLEHELFYKYKSDIICLQELTTNDYN 93

Query: 469 DFWAP-LLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSSV- 526
           +FW   ++    Y   F AKT  +    K  + +DG  +FY   +F+ +F  ++  + + 
Sbjct: 94  EFWKKQMMNRMNYGSNFTAKTPPKYWT-KPLECMDGVGIFYNLDKFEYLFSSSLYLNDLV 152

Query: 527 ---------WMKHKKFQRT--------EDYL-NRAMNKDNVALLVKLQHLKSGEHVWAAT 568
                    ++ H     T        ED L N A  ++ V L V L+H +S   +    
Sbjct: 153 GTFDQQELHYLTHHNITLTNGAGDVIGEDSLYNVAKARNQVCLFVMLRHRESKSIIVVIN 212

Query: 569 THLHWDPQFNDVKTFQVGVLLDHMEKVIK------EHSGYNNSQELKKVPVIICGDFNSQ 622
           THL+W  ++++VK  Q  +++  ++++IK      E   Y+N      V ++  GDFNS 
Sbjct: 213 THLYW--KYDEVKLVQCLIIMRKLQRIIKGLLMGIEGVTYSN------VKILFSGDFNSS 264

Query: 623 VDSAVYELLSTGSVRQHCDIEGRDFGFMSQKNYAHNLPLKSSYECIGELPF--TNLTPTY 680
            DS V + L+ G + +H DI  ++      + Y  +    S Y+ I E  +  T  +   
Sbjct: 265 RDSLVIKFLN-GKIIKHGDINLQN----PMRAYLSH----SIYDDIPEDAYVHTCYSGKL 315

Query: 681 TDVIDYIWYSSQGLRVRGVL-GQIDPDYASKF--IGFPNDKFPSDHIPLLTRFE 731
             + DYIW+      V  VL GQ      +     G PN   PSDHIP+LT   
Sbjct: 316 KGIFDYIWFHPGDFEVEKVLSGQEVSKELTHLNDFGLPNKYHPSDHIPVLTELR 369

>Scas_643.17
          Length = 389

 Score =  123 bits (309), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 101/348 (29%), Positives = 161/348 (46%), Gaps = 40/348 (11%)

Query: 410 FTLLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQIL-YYSTDIICLQEVECKTYE 468
           FTLL+YN L   Y  P++Y + P     W YR + L+ ++L  Y  DI+CLQE+  + Y 
Sbjct: 30  FTLLTYNMLSPSYMWPQVYTYVPDPYKDWQYRHKLLESELLGSYKADIMCLQEMTSRDYN 89

Query: 469 DFWAPLLREE-GYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTV------ 521
           + W  LL    GY   F AK+     + ++  ++DG  +FY   +F  I    +      
Sbjct: 90  ENWKRLLGSGIGYGSKFIAKSPPLYWE-REVDEIDGVGIFYNLKKFDFISSSGIYLNQFL 148

Query: 522 -DFSSVWMKHKKFQR------------TEDYLNRAMNKDNVALLVKLQHLKSGEHVWAAT 568
             FSS  +++   +R             ++ L+    K+ V L V L+H ++GE      
Sbjct: 149 NVFSSTELEYLHSKRLVLTDGAGVPIGEKNLLDVISGKNQVCLFVSLKHKETGEMFVVIN 208

Query: 569 THLHWDPQFNDVKTFQVGVLLDHMEKVIKEHSGYNNSQELKKVPVIICGDFNSQVDSAVY 628
           THL+W  ++++VK  Q  +++  + K+I E        +  KV ++  GD NS   S V 
Sbjct: 209 THLYW--KYDEVKLTQCMIIMRELSKIIDEL--VKGVDDPGKVKILFTGDLNSTKKSLVI 264

Query: 629 ELLSTGSVRQHCDIEGRDFGFMSQKNYAHNLPLKSSYECIGELPF--TNLTPTYTDVIDY 686
             L  G +  H        G ++  N        S YE + E  F  T  +     + DY
Sbjct: 265 NFLK-GQILSH--------GPLNMLNPMRPFINSSIYEEVPENFFVHTCYSGKLKGIFDY 315

Query: 687 IWYSSQGLRVRGVL-GQIDPDYASKF--IGFPNDKFPSDHIPLLTRFE 731
           IWY ++ L++  +L G+   D  +     G PN   PSDHIP+LT F+
Sbjct: 316 IWYDAKELQLTKILTGKEVSDELTDLEQFGLPNKDHPSDHIPVLTEFQ 363

>YOL042W (NGL1) [4776] chr15 (249823..250914) Mitochondrial member
           of the ExoIII-APE nuclease family [1092 bp, 363 aa]
          Length = 363

 Score =  119 bits (297), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 101/366 (27%), Positives = 170/366 (46%), Gaps = 42/366 (11%)

Query: 394 LQESDSHLNRETAKKS-FTLLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQIL-Y 451
           +Q +  ++ +   K + FTLL+YN L   Y  P++Y +      +W YR   L++++L  
Sbjct: 10  VQSTKQNIGKYVRKDARFTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHRLLEKELLNT 69

Query: 452 YSTDIICLQEVECKTYEDFWAPLL-REEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRD 510
           +  DI+CLQE+  + YED+W   +  +  Y   F +KT  +  + K  K +DG  +FY  
Sbjct: 70  FKADIMCLQEMTARDYEDYWHDSIGVDVNYGSKFISKTPPKYWK-KPVKDMDGVSIFYNL 128

Query: 511 SEFKLIFKDTVDFSSV----------WMKHKKFQRTE---------DYLNRAMNKDNVAL 551
           ++F  I    +  + +          ++ +KK   T+           L+    K+ V L
Sbjct: 129 AKFDFISSSGIYLNQLLNVFNQRELKYLYNKKVTLTDGASNVIGEDSLLDVLKGKNQVCL 188

Query: 552 LVKLQHLKSGEHVWAATTHLHWDPQFNDVKTFQVGVLLDHMEKVIKEH-SGYNNSQELKK 610
            V L+H ++G       THL+W  ++++VK  Q  +++  + K+IK+   G    QE  +
Sbjct: 189 FVSLRHKETGTIFVVLNTHLYW--KYDEVKLTQCMIIMRELSKIIKQLLPGDVKGQE--R 244

Query: 611 VPVIICGDFNSQVDSAVYELLSTGSVRQHCDIEGRDFGFMSQKNYAHNLPLKSSYECIGE 670
           V ++  GD NS  DS V   L  G +  H D        ++  N       +  Y+ I +
Sbjct: 245 VKILFTGDLNSTRDSLVVNFLQ-GQIVSHGD--------LNLINPMRPYLDRCVYDDIPK 295

Query: 671 LPF--TNLTPTYTDVIDYIWYSSQGLRVRGVLG---QIDPDYASKFIGFPNDKFPSDHIP 725
             F  T  +     + DY+WY      +  +L      D   AS  +G PN+  PSDHIP
Sbjct: 296 DYFVHTCYSGKLKGIFDYVWYHDSDFLLTKILTGNEVSDELLASNQLGLPNENHPSDHIP 355

Query: 726 LLTRFE 731
           LLT F+
Sbjct: 356 LLTEFK 361

>ACR277C [1324] [Homologous to ScYOL042W (NGL1) - SH]
           (857936..859072) [1137 bp, 378 aa]
          Length = 378

 Score =  109 bits (272), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 88/356 (24%), Positives = 159/356 (44%), Gaps = 47/356 (13%)

Query: 406 AKKSFTLLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQILY-YSTDIICLQEVEC 464
           +++ F LL+YN L  +Y  P++Y + P     W+YR + L+ ++ + Y  DI+CLQE+  
Sbjct: 38  SERRFNLLTYNMLSPYYMWPQVYTYVPEPFKKWEYRHKLLEYELFHKYHADILCLQELTG 97

Query: 465 KTYEDFWAPLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFS 524
           K YE FW   ++        +A+        +  +++DG   FY   +F+ +  D    S
Sbjct: 98  KDYEKFWRKQMKRRMNFESQYAQKPPPAYWKRSQEEMDGVGTFYNADKFEHVATDLEYLS 157

Query: 525 SV----------WMKHKKFQRTE--------DYLNRAMNKDN-VALLVKLQHLKSGEHVW 565
                       WM   + + T+          L   + + N V L V L H  +G    
Sbjct: 158 DTLGVLTPTEKEWMAQTQVEVTDATGHVVEKQSLKTVLTQRNQVCLFVTLLHKPTGSLFV 217

Query: 566 AATTHLHWDPQFNDVKTFQVGVLLDHMEKVIK-----EHSGYNNSQELKKVPVIICGDFN 620
              T L+W  ++++VK  Q  +++  ++ ++K     + + Y+N      + V++ GD N
Sbjct: 218 VVNTQLYW--KYDEVKLAQCFIIMRRLKAIVKRLLTRKDTSYSN------IKVLLSGDLN 269

Query: 621 SQVDSAVYELLSTGSVRQHCDIEGRDFGFMSQKNYAHNLPLKSSYECIGELPFTN--LTP 678
           S  D+     L    V+    + G +F     +N   +    S Y+ I +  F N   + 
Sbjct: 270 SSQDALSVRFLRGQVVK----VAGLEF-----QNPMRSFLNGSLYDYIPKDSFDNTCYSG 320

Query: 679 TYTDVIDYIWYSSQGLRVRGVLG--QIDPDYASKF-IGFPNDKFPSDHIPLLTRFE 731
               + DY+W+  +  R+  VL   ++  + +S    G PN+  PSDHIP+   FE
Sbjct: 321 KIKGIFDYVWFHGRDFRLLQVLSGKEVSEELSSTAQTGLPNELHPSDHIPIYAEFE 376

>Scas_692.12
          Length = 476

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 72/248 (29%), Positives = 113/248 (45%), Gaps = 37/248 (14%)

Query: 406 AKKSFTLLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQILYYSTDIICLQEVECK 465
           +K  F++L+YN L Q      M+  + + AL W  R + +  ++ YY+ DI+CLQE++ K
Sbjct: 74  SKHEFSILTYNCLAQGLIMRDMFPESGN-ALKWTRRSKTMINELKYYNPDIMCLQEIDFK 132

Query: 466 TYEDFWAPLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSS 525
             ++FW+   +  GY+              K  KK+ G  + +RDS FK   +  VDF  
Sbjct: 133 YVKEFWSVQFKSLGYS----------FKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDE 182

Query: 526 VWMKHKKFQRTEDYLNRAMNKDNVALLVKLQHL--------KSGEHVWAATTHLHWDPQF 577
           +           D   R   + N+ L+V LQ L        +    +  ATTHL W P  
Sbjct: 183 LL--------AGDIPPRTKTR-NIGLIVALQFLDNNNNNPSRESHGIVVATTHLFWHPFG 233

Query: 578 NDVKTFQVGVLLDHMEK---VIKEHSGYNNSQELKKVPVIICGDFNSQVDSAVYELLSTG 634
              +T Q  ++L  M K    + EHSG  N          + GDFNSQ   A Y  ++T 
Sbjct: 234 TFERTRQCYLMLSEMNKFLSFLNEHSGITNWYPF------LTGDFNSQPKDAPYMSMTTK 287

Query: 635 SVRQHCDI 642
            ++ H ++
Sbjct: 288 PIQYHDEM 295

>ABL118W [474] [Homologous to ScYMR285C (NGL2) - SH; ScYML118W
           (NGL3) - SH] complement(177533..179047) [1515 bp, 504
           aa]
          Length = 504

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 97/235 (41%), Gaps = 41/235 (17%)

Query: 410 FTLLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQILYYSTDIICLQEVECKTYED 469
           F +++YN L Q     K++  T   AL W  R + L  ++ YY+ D+ICLQE++   Y+ 
Sbjct: 105 FRMMTYNCLAQALIRRKLFP-TSGNALKWFKRSKVLLSELQYYNPDVICLQEIDHTQYKS 163

Query: 470 FWAPLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSSVWMK 529
           FW   L+  GY   FH          +   K  G  + +R S F  + +  +DF      
Sbjct: 164 FWMDALQHAGYCSKFH----------RSFGKNHGIAIVWRRSLFNKVDETLIDFD----- 208

Query: 530 HKKFQRTEDYLNRAMNKDNVALLVKLQH-----------LKSGEHVWAATTHLHWDPQFN 578
               +     + R     NV L+V L++            +SG  +   T+HL W P   
Sbjct: 209 ----EEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSG--IVVGTSHLFWHPFGT 262

Query: 579 DVKTFQVGVLLDHMEKVIK-----EHSGYNNSQELKKVPVIICGDFNSQVDSAVY 628
             +  Q  ++L  M+  +K     E      + +        CGDFNSQ   A Y
Sbjct: 263 YERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHP---FFCGDFNSQPFDAPY 314

>CAGL0I02684g complement(239316..240797) similar to sp|Q03264
           Saccharomyces cerevisiae YMR285c, hypothetical start
          Length = 493

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/226 (26%), Positives = 101/226 (44%), Gaps = 37/226 (16%)

Query: 412 LLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQILYYSTDIICLQEVECKTYEDFW 471
           ++SYN L Q     K++  +   AL W  R   L  +  +Y  D++CLQE++   Y+ FW
Sbjct: 94  IMSYNCLAQALIRRKLFPDSGE-ALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFW 152

Query: 472 APLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSSVWMKHK 531
               ++ GY+  FH K            K  G C+ ++  +F++  +  +DF S      
Sbjct: 153 KEEFQKLGYSSQFHRK----------PSKNHGVCIIWKHEKFEMSDRMLIDFDS------ 196

Query: 532 KFQRTEDYLNRAMNKDNVALLVKLQHL-------------KSGEHVWAATTHLHWDPQFN 578
             +++ D   R    +N AL++ L+               KSG  +   TTHL W P   
Sbjct: 197 --EKSGDIEPRTTT-NNAALILALKFTQKVKMMGKKLLDDKSG--ILVGTTHLFWHPFGT 251

Query: 579 DVKTFQVGVLLDHMEKVIKEHSGY--NNSQELKKVPVIICGDFNSQ 622
             +T Q  V+L+ M++ +   +    NN  ++       CGDFNSQ
Sbjct: 252 YERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNSQ 297

>Scas_497.3
          Length = 556

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 99/234 (42%), Gaps = 16/234 (6%)

Query: 394 LQESDSHLNRETAKKSF--TLLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQILY 451
           +Q    HL+ E     F  ++++YN L Q     K++  +   AL W  R + L  +  +
Sbjct: 136 IQRPILHLHEEEPVTGFKISIMTYNCLAQALIRRKLFPDSGD-ALKWFKRSKVLSNEFKH 194

Query: 452 YSTDIICLQEVECKTYEDFWAPLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDS 511
           Y+ D+ICLQE++   Y+ FW     + GY   FH K            K  G  + +R  
Sbjct: 195 YNPDVICLQEIDHLQYQSFWKAEFEKVGYESQFHRK----------QSKNHGVAIIWRKE 244

Query: 512 EFKLIFKDTVDFSSVWMKHKKFQRTEDYLNRAMN-KDNVALLVKLQHLKSGEHVWAATTH 570
            F L  K  +DF          + T +    A++ K     L K  +  S   +   TTH
Sbjct: 245 LFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVGTTH 304

Query: 571 LHWDPQFNDVKTFQVGVLLDHMEKVIKEHSGY--NNSQELKKVPVIICGDFNSQ 622
           L W P     +T Q  V+L+ M++ +   +    NN  +        CGDFNSQ
Sbjct: 305 LFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQ 358

>Kwal_27.10204
          Length = 494

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 96/237 (40%), Gaps = 30/237 (12%)

Query: 410 FTLLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQILYYSTDIICLQEVECKTYED 469
           F +++YN L Q     K++  T   AL W  R   L  + ++Y  D+ CLQE++   Y+ 
Sbjct: 96  FKIMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQS 154

Query: 470 FWAPLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSSVWMK 529
           FW     + GY   FH          +   K  G  + ++   F ++ K  VD+      
Sbjct: 155 FWKEEFGKLGYDSQFH----------RHGTKNHGIAIVWKRDLFTMVDKMLVDYD----- 199

Query: 530 HKKFQRTEDYLNRAMNKDNVALLVKLQHLK---------SGEHVWAATTHLHWDPQFNDV 580
               +     L       NV L++ L   K         S   +   TTHL W P     
Sbjct: 200 ----KEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGILVGTTHLFWHPFGTFE 255

Query: 581 KTFQVGVLLDHMEKVI-KEHSGYNNSQELKKVPVIICGDFNSQVDSAVYELLSTGSV 636
           +T Q  VLL+ M+  I + +   + S   KK     CGDFN+Q     Y  +S+  V
Sbjct: 256 RTRQCYVLLNKMKDFIHRVNVLQDGSSPEKKWYPFFCGDFNAQPFDTPYLSMSSKPV 312

>Sklu_2335.3 YMR285C, Contig c2335 6512-7807 reverse complement
          Length = 431

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/226 (26%), Positives = 100/226 (44%), Gaps = 35/226 (15%)

Query: 410 FTLLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQILYYSTDIICLQEVECKTYED 469
           F +++YN L Q     K++ ++ + A+ W  R + L  +  +Y  D+ CLQE++   Y+ 
Sbjct: 32  FKIMTYNALAQALIRRKLFPWSGN-AVKWFKRSKVLLNEFKHYDADVHCLQEIDHIQYQA 90

Query: 470 FWAPLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSSVWMK 529
           FW    ++ GY   FH          +   K  G  + +R S F ++    VD+      
Sbjct: 91  FWKEEFQKLGYASQFH----------RIGTKNHGVAIVWRCSLFTMVDTMLVDYDK---- 136

Query: 530 HKKFQRTEDYLNRAMNKDNVALLVKLQHL-----------KSGEHVWAATTHLHWDPQFN 578
               + + D   R   K N  L++ L+             KSG  +   TTHL W P   
Sbjct: 137 ----EPSGDIPPRTTTK-NAGLILALKFTDKVLNQFPGTKKSG--ILIGTTHLFWHPFGT 189

Query: 579 DVKTFQVGVLLDHMEKVIKEHSGYNNSQ--ELKKVPVIICGDFNSQ 622
             +T Q  V+L+ M+++I   +   N+Q  +       ICGDFNSQ
Sbjct: 190 FERTRQCYVVLNKMKELIHRVNVLQNNQDRDYSHWYPFICGDFNSQ 235

>YMR285C (NGL2) [4239] chr13 complement(840143..841690) Protein
           required for 5.8 S rRNA processing, has possible
           DNAse/RNAse function, member of the magnesium-dependent
           ExoIII-APE nuclease family [1548 bp, 515 aa]
          Length = 515

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 59/227 (25%), Positives = 102/227 (44%), Gaps = 35/227 (15%)

Query: 410 FTLLSYNTLCQHYATPKMYRFTPSWALSWDYRREK-LKEQILYYSTDIICLQEVECKTYE 468
           F L++YN L Q     K++  +   AL W YRR K L  +  YY++D+ICLQE++   ++
Sbjct: 112 FKLMTYNCLAQALIRRKLFPDSGD-ALKW-YRRSKVLLNEFKYYNSDVICLQEIDHIQFQ 169

Query: 469 DFWAPLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSSVWM 528
            FW     + GY G ++          +++ K  G  + +R   F  + K  +D+     
Sbjct: 170 SFWKDEFSKLGYDGQYY----------RNATKNHGVAIMWRRELFHQVDKMLIDYD---- 215

Query: 529 KHKKFQRTEDYLNRAMNKDNVALLVKLQH---------LKSGEH--VWAATTHLHWDPQF 577
                + + + ++     +NV L++ L+           KS +   +   TTHL W P  
Sbjct: 216 -----KESSESISTRTTTNNVGLVLALKFSEKVLSNLGKKSSKKCGILIGTTHLFWHPFG 270

Query: 578 NDVKTFQVGVLLDHMEKVIKEHSGYNNSQ--ELKKVPVIICGDFNSQ 622
              +T Q  ++L  M++ +   +   N    +L       CGDFNSQ
Sbjct: 271 TYERTRQCYIVLKKMKEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQ 317

>KLLA0C06248g complement(552493..554043) similar to sp|Q03264
           Saccharomyces cerevisiae YMR285c, start by similarity
          Length = 516

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 63/262 (24%), Positives = 107/262 (40%), Gaps = 45/262 (17%)

Query: 392 ASLQESDSHLNRETAKKSFTLLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQILY 451
           A  ++S     RE      ++++YN L Q      ++  T   A+ W  R + L  +  Y
Sbjct: 101 AVPRDSSGQSTREVC--PISIMTYNCLAQALIRRTLFP-TSGNAVKWFKRSQVLLNEFKY 157

Query: 452 YSTDIICLQEVECKTYEDFWAPLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDS 511
           Y+ D++CLQE++   Y+ FW     + GY   FH           +  K  G  + +++ 
Sbjct: 158 YNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHF----------NPTKNHGVLIAWKED 207

Query: 512 EFKLIFKDTVDFSSVWMKHKKFQRTEDYLNRAMNKDNVALLVKLQHLK-----------S 560
            F +  K  +D+          + T   +       NV +L+ L+  K           S
Sbjct: 208 LFDMTDKMLIDYD---------KETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVS 258

Query: 561 GEHVWAATTHLHWDPQFNDVKTFQVGVLLDHMEK------VIKEHSGYNNSQELKKVPVI 614
           G  +   TTHL W P     +T Q  ++L  +++      V++     +NS      P  
Sbjct: 259 G--IIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSH----WPAF 312

Query: 615 ICGDFNSQVDSAVYELLSTGSV 636
            CGDFNSQ   A Y  +++  V
Sbjct: 313 FCGDFNSQPFDAPYLSITSKPV 334

>CAGL0B02387g complement(228209..229624) weakly similar to sp|Q03264
           Saccharomyces cerevisiae YMR285c or sp|Q03210
           Saccharomyces cerevisiae YML118w, hypothetical start
          Length = 471

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 103/237 (43%), Gaps = 45/237 (18%)

Query: 410 FTLLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQILYYSTDIICLQEVECKTYED 469
            ++++YN L Q     +M+  +   AL W  R + L  +I +Y+ DI CLQE++   Y+ 
Sbjct: 80  LSIMTYNCLAQTLIRREMFPESGP-ALKWFVRSKVLLHEIKHYNADICCLQEIDDVQYDL 138

Query: 470 FWAPLLREEGYTGI-FHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSSVWM 528
           FW+  L + GY  I FH          +DSK   G  + +++  F+L     ++F     
Sbjct: 139 FWSEELPKFGYKTIYFH----------QDSKS-HGVMIAWKEELFQLESHMNIEFD---- 183

Query: 529 KHKKFQRTEDYLNRAMNKDNVALLV-------------KLQHLKSGEHVWAATTHLHWDP 575
                +     +      +NV LLV             +++  +SG  V   T HL W P
Sbjct: 184 -----KEAPAGIQPRTRTNNVGLLVALAFTDAFRARNNRIRTSRSG--VIIGTFHLFWHP 236

Query: 576 QFNDVKTFQVGVLLDHMEKVIKEHSGYNNSQELKKVPVIICGDFNSQVDSAVYELLS 632
                +T Q  V+    +K I E +G       K    +  GDFNSQ +S  Y +L+
Sbjct: 237 FGTYDRTRQCLVI----KKKILEFAGTVKGDYCK----MFTGDFNSQPNSVPYLVLT 285

>YML118W (NGL3) [3853] chr13 (32334..33851) Protein with possible
           DNAse/RNAse function, member of the magnesium-dependent
           ExoIII-APE nuclease family [1518 bp, 505 aa]
          Length = 505

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 68/272 (25%), Positives = 110/272 (40%), Gaps = 48/272 (17%)

Query: 368 PEIPLP----TERKFIDINVDGEVTQEYASLQESDSHLNRETAKKSFTLLSYNTLCQHYA 423
           P+ P P     ER F+ IN D       A++Q +   L+         +++YNTL Q   
Sbjct: 70  PDFPTPDLQFIERPFLPINHDNSKGLTPATIQVTQDSLD-------VKIMTYNTLAQ--- 119

Query: 424 TPKMYRFTPSW--ALSWDYRREKLKEQILYYSTDIICLQEVECKTYEDFWAPLLREEGYT 481
           T     F P    AL W  R + L  ++  Y  D++ LQEV+     +FW     + G+ 
Sbjct: 120 TLIRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFWQENFHKLGFD 178

Query: 482 GIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSSVWMKHKKFQRTEDYLN 541
            IF           +   K  G  + + + +F+L     +D+ ++   +    RT     
Sbjct: 179 VIFK----------RHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTR---- 224

Query: 542 RAMNKDNVALLVKLQHLK-----SGEHVWAATTHLHWDPQFNDVKTFQVGVLLDHMEKVI 596
                 N+AL++ L + K     S   +  A THL W P F   +  +   L+    + I
Sbjct: 225 ----TKNIALIISL-YFKGITDSSSRGIIVANTHLFWHP-FGVFERLRQSYLVLQKIQEI 278

Query: 597 KEHSGYNNSQELKKVPVIICGDFNSQVDSAVY 628
           K  S YN    L      + GDFN++ +   Y
Sbjct: 279 KACSKYNGWHSL------LMGDFNTEPEEPPY 304

>CAGL0D02288g complement(233487..236093) similar to tr|Q08817
           Saccharomyces cerevisiae YOR353c, start by similarity
          Length = 868

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 35/59 (59%)

Query: 266 RLYLNGNNLTVLPKAVKSLKNLRVLDLSHNRLTELPSELGLCHQLKYLYFFDNMVSTLP 324
           RL L  NN+T LP+    LKNLR LDL  N L E+P EL  C +L+ L    N +S LP
Sbjct: 69  RLSLRKNNITYLPENFSELKNLRYLDLHSNGLREIPVELLNCQKLEILDISSNKISQLP 127

 Score = 30.0 bits (66), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 1/59 (1%)

Query: 267 LYLNGNNL-TVLPKAVKSLKNLRVLDLSHNRLTELPSELGLCHQLKYLYFFDNMVSTLP 324
           + L G NL T+ P+ +K L N   L L  N +T LP        L+YL    N +  +P
Sbjct: 46  VKLIGLNLKTIPPEDIKLLANAERLSLRKNNITYLPENFSELKNLRYLDLHSNGLREIP 104

>KLLA0C13145g 1119411..1121789 weakly similar to sgd|S0005880
           Saccharomyces cerevisiae YOR353c, hypothetical start
          Length = 792

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 48/83 (57%), Gaps = 1/83 (1%)

Query: 243 ALDLSNLQVFNLTESLFRY-EFLTRLYLNGNNLTVLPKAVKSLKNLRVLDLSHNRLTELP 301
           A+ L++L + ++T+      + +  L L+ NNLT LP + K L NLR +DLS NR  ++P
Sbjct: 35  AVSLADLGLSSITDDAVELLQLVENLSLHQNNLTQLPGSFKKLTNLRTIDLSDNRFNDIP 94

Query: 302 SELGLCHQLKYLYFFDNMVSTLP 324
             L  C +L+ +   +N +  LP
Sbjct: 95  PSLMQCLRLEKINLSNNNIWQLP 117

>ADR381C [2122] [Homologous to ScYOR353C - SH] (1389632..1391791)
           [2160 bp, 719 aa]
          Length = 719

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 34/59 (57%)

Query: 266 RLYLNGNNLTVLPKAVKSLKNLRVLDLSHNRLTELPSELGLCHQLKYLYFFDNMVSTLP 324
           RL L  N LT LP + ++L  LR LDL  NRL E+P+ L  C  L+ +    N +S LP
Sbjct: 62  RLSLQRNQLTTLPTSFRNLTKLRYLDLHGNRLAEIPAILLQCPHLEIVDLSSNEISALP 120

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 5/90 (5%)

Query: 239 QLWHALDLSNLQVFNLTESLFRYEFLTRLY---LNGNNLTVLPKAVKSLKNLRVLDLSHN 295
           +L H ++  +LQ   LT     +  LT+L    L+GN L  +P  +    +L ++DLS N
Sbjct: 55  ELLHTVERLSLQRNQLTTLPTSFRNLTKLRYLDLHGNRLAEIPAILLQCPHLEIVDLSSN 114

Query: 296 RLTELPSELG--LCHQLKYLYFFDNMVSTL 323
            ++ LP E     C  +K L   +N V +L
Sbjct: 115 EISALPQEYSPLWCSNVKVLSLKNNRVRSL 144

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 273 NLTVLPK-AVKSLKNLRVLDLSHNRLTELPSELGLCHQLKYLYFFDNMVSTLP 324
           N++ LP+ AV+ L  +  L L  N+LT LP+      +L+YL    N ++ +P
Sbjct: 45  NISSLPEEAVELLHTVERLSLQRNQLTTLPTSFRNLTKLRYLDLHGNRLAEIP 97

>KLLA0F15708g 1447749..1453451 similar to sp|P08678 Saccharomyces
           cerevisiae YJL005w CYR1 adenylate cyclase, start by
           similarity
          Length = 1900

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 51/103 (49%), Gaps = 5/103 (4%)

Query: 227 RMVGPKDAKHDDQLWHALDLSNLQ-----VFNLTESLFRYEFLTRLYLNGNNLTVLPKAV 281
           RMV  + ++    +  A DL +L      +  + ES+ +   LT L L  N L  LP   
Sbjct: 710 RMVNVRASRFPANITQAYDLVSLDLERNFIKRVPESISKLSNLTILNLQCNQLDRLPSGF 769

Query: 282 KSLKNLRVLDLSHNRLTELPSELGLCHQLKYLYFFDNMVSTLP 324
           K+LKNL++LD+S N  T  P  +  C  L  +    N +++LP
Sbjct: 770 KNLKNLQLLDISSNAFTAYPEVINRCTNLLQVDLSYNKINSLP 812

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 8/70 (11%)

Query: 245  DLSNLQVFNLTESLFRYEFLTRLYLNGNNLTVLPKAV-KSLKNLRVLDLSHNRLTELPSE 303
            D+S++   NL         LT LYL+GN +T LP  V + +KNL+V+ L+ N+L  LPSE
Sbjct: 1059 DISDISALNLPS-------LTELYLSGNAITSLPGEVFQRMKNLKVIMLNGNKLMSLPSE 1111

Query: 304  LGLCHQLKYL 313
            L     L  L
Sbjct: 1112 LSQLSNLTVL 1121

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 42/88 (47%), Gaps = 9/88 (10%)

Query: 246 LSNLQVFNLTES---------LFRYEFLTRLYLNGNNLTVLPKAVKSLKNLRVLDLSHNR 296
           LSNL   +L ++         L   E L +L LN NNLT LP  +K  K L     ++N+
Sbjct: 903 LSNLTSLSLNKAKLSSLPIDFLKTLEKLEKLELNDNNLTSLPAEIKYSKKLIHFSAANNK 962

Query: 297 LTELPSELGLCHQLKYLYFFDNMVSTLP 324
           L  +P E+G    LK L    N +  LP
Sbjct: 963 LDSIPEEIGELSNLKSLDLHCNNIRELP 990

 Score = 37.0 bits (84), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 43/92 (46%), Gaps = 5/92 (5%)

Query: 238 DQLWHALDLSNLQVFNLTESLFRYEF-----LTRLYLNGNNLTVLPKAVKSLKNLRVLDL 292
           D +  A+ LS+L++ N+  S F         L  L L  N +  +P+++  L NL +L+L
Sbjct: 698 DFIESAVKLSSLRMVNVRASRFPANITQAYDLVSLDLERNFIKRVPESISKLSNLTILNL 757

Query: 293 SHNRLTELPSELGLCHQLKYLYFFDNMVSTLP 324
             N+L  LPS       L+ L    N  +  P
Sbjct: 758 QCNQLDRLPSGFKNLKNLQLLDISSNAFTAYP 789

 Score = 33.5 bits (75), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%)

Query: 256  ESLFRYEFLTRLYLNGNNLTVLPKAVKSLKNLRVLDLSHNRL 297
            E   R + L  + LNGN L  LP  +  L NL VLD+  N+L
Sbjct: 1087 EVFQRMKNLKVIMLNGNKLMSLPSELSQLSNLTVLDVGSNQL 1128

>Kwal_26.6909
          Length = 708

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 47/92 (51%), Gaps = 1/92 (1%)

Query: 234 AKHDDQLWHALDLSNLQVFNLTESLFRYEF-LTRLYLNGNNLTVLPKAVKSLKNLRVLDL 292
           +K   Q    + L +L + +LT+        + RL L  N L+ LP+  K+L  LR LDL
Sbjct: 26  SKQVSQQDPTIKLIDLGITSLTQETIELLLPVERLSLQKNQLSTLPEEFKTLSELRYLDL 85

Query: 293 SHNRLTELPSELGLCHQLKYLYFFDNMVSTLP 324
             N+L E+P  L  C +L+ L    N ++ LP
Sbjct: 86  HDNKLQEIPPILLQCQRLEILDLSSNFITHLP 117

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 2/82 (2%)

Query: 244 LDLSNLQVFNLTESLFRYEFLTRLYLNGNNLTVLPKAVKSLKNLRVLDLSHNRLTELPSE 303
           L L   Q+  L E       L  L L+ N L  +P  +   + L +LDLS N +T LP E
Sbjct: 60  LSLQKNQLSTLPEEFKTLSELRYLDLHDNKLQEIPPILLQCQRLEILDLSSNFITHLPHE 119

Query: 304 LGL--CHQLKYLYFFDNMVSTL 323
                C  +K L   +N V+++
Sbjct: 120 YPRVWCDNIKVLSLKNNKVASV 141

>AAL162C [25] [Homologous to ScYJL005W (CYR1) - SH] (58565..64189)
           [5625 bp, 1874 aa]
          Length = 1874

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 50/91 (54%), Gaps = 3/91 (3%)

Query: 237 DDQLWH--ALDLSNLQVFNLTESLFR-YEFLTRLYLNGNNLTVLPKAVKSLKNLRVLDLS 293
           +D L H  +L +S  ++  L ESL R    L +L L+ N+LTVLP  +K LK L  L ++
Sbjct: 857 NDYLEHLTSLSISKAKLAVLPESLLRRLPRLEKLELSENSLTVLPPDIKHLKKLVHLSVA 916

Query: 294 HNRLTELPSELGLCHQLKYLYFFDNMVSTLP 324
            N+L  LP E+     LK L    N + TLP
Sbjct: 917 KNKLESLPDEIASLKNLKMLDLHCNNLMTLP 947

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 48/89 (53%), Gaps = 8/89 (8%)

Query: 233  DAKHDDQLWHALD-LSNLQVFNLTESLF------RYEFLTRLYLNGNNLTVLP-KAVKSL 284
            D +  D+ W   +    L+V NL+ + F        E LT LYL+GN+LT L  +A   L
Sbjct: 992  DNQMGDKFWEIFNTFKTLKVLNLSYNNFMALPELEMENLTELYLSGNHLTTLSGEAFLKL 1051

Query: 285  KNLRVLDLSHNRLTELPSELGLCHQLKYL 313
            K+LRVL L+ N L  LP+E+    QL  +
Sbjct: 1052 KSLRVLMLNANNLQSLPAEISQLSQLSVI 1080

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 48/103 (46%), Gaps = 5/103 (4%)

Query: 227 RMVGPKDAKHDDQLWHA-----LDLSNLQVFNLTESLFRYEFLTRLYLNGNNLTVLPKAV 281
           RMV  + ++    +  A     LDL    +  + + + +   LT L L  N L  LP+  
Sbjct: 667 RMVNIRASRFPSNICEATKLITLDLERNFIKRVPDQMSKLTNLTILNLRCNELDRLPRGF 726

Query: 282 KSLKNLRVLDLSHNRLTELPSELGLCHQLKYLYFFDNMVSTLP 324
           K LK+L++LD+S N+    P  +  C  L  L    N + +LP
Sbjct: 727 KDLKSLQLLDISSNKFNIYPEVINSCTNLLQLDLSYNKIRSLP 769

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 41/84 (48%), Gaps = 8/84 (9%)

Query: 246 LSNLQVFNLT----ESLFR----YEFLTRLYLNGNNLTVLPKAVKSLKNLRVLDLSHNRL 297
           L+NL + NL     + L R     + L  L ++ N   + P+ + S  NL  LDLS+N++
Sbjct: 706 LTNLTILNLRCNELDRLPRGFKDLKSLQLLDISSNKFNIYPEVINSCTNLLQLDLSYNKI 765

Query: 298 TELPSELGLCHQLKYLYFFDNMVS 321
             LP  +    +L  +   +N ++
Sbjct: 766 RSLPDSMNQLQKLAKINLSNNRIT 789

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 23/42 (54%)

Query: 256  ESLFRYEFLTRLYLNGNNLTVLPKAVKSLKNLRVLDLSHNRL 297
            E+  + + L  L LN NNL  LP  +  L  L V+D+  N+L
Sbjct: 1046 EAFLKLKSLRVLMLNANNLQSLPAEISQLSQLSVIDVGSNQL 1087

>YOR353C (SOG2) [5130] chr15 complement(998448..1000823) Protein
           containing four leucine rich repeats, which mediate
           protein-protein interactions, has a region of low
           similarity to a region of adenylyl cyclase (ATP
           pyrophosphate lyase, C. albicans Cyr1p), which generates
           cAMP in response to activation [2376 bp, 791 aa]
          Length = 791

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 32/59 (54%)

Query: 266 RLYLNGNNLTVLPKAVKSLKNLRVLDLSHNRLTELPSELGLCHQLKYLYFFDNMVSTLP 324
           RL L  N+LT LP + K L  L+ LDL +N   E+P  L  C QL+ L    N +  LP
Sbjct: 70  RLSLRKNHLTSLPASFKRLSRLQYLDLHNNNFKEIPYILTQCPQLEILDLSSNEIEALP 128

 Score = 33.5 bits (75), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 38/82 (46%), Gaps = 2/82 (2%)

Query: 244 LDLSNLQVFNLTESLFRYEFLTRLYLNGNNLTVLPKAVKSLKNLRVLDLSHNRLTELPSE 303
           L L    + +L  S  R   L  L L+ NN   +P  +     L +LDLS N +  LP E
Sbjct: 71  LSLRKNHLTSLPASFKRLSRLQYLDLHNNNFKEIPYILTQCPQLEILDLSSNEIEALPDE 130

Query: 304 LGLCHQ--LKYLYFFDNMVSTL 323
           +    Q  ++ L   DN V+++
Sbjct: 131 ISSFWQDNIRVLSLKDNNVTSI 152

>YJL005W (CYR1) [2897] chr10 (425072..431152) Adenylate cyclase,
           generates cAMP in response to ras activation [6081 bp,
           2026 aa]
          Length = 2026

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 47/103 (45%), Gaps = 5/103 (4%)

Query: 227 RMVGPKDAKHDDQLWHALDLSNLQ-----VFNLTESLFRYEFLTRLYLNGNNLTVLPKAV 281
           RMV  + +K    +  A  L +L+     +  +  S+ +   LT L L  N L  LP   
Sbjct: 846 RMVNIRASKFPSNITKAYKLVSLELQRNFIRKVPNSIMKLSNLTILNLQCNELESLPAGF 905

Query: 282 KSLKNLRVLDLSHNRLTELPSELGLCHQLKYLYFFDNMVSTLP 324
             LKNL++LDLS N+    P  +  C  L  +    N + +LP
Sbjct: 906 VELKNLQLLDLSSNKFMHYPEVINYCTNLLQIDLSYNKIQSLP 948

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 46/86 (53%), Gaps = 8/86 (9%)

Query: 233  DAKHDDQLWHALD-LSNLQVFNLTESLF------RYEFLTRLYLNGNNLTVLP-KAVKSL 284
            D + DD +W   +   NL+V NL+ + F      + E +T LYL+GN LT L    V   
Sbjct: 1174 DNQFDDAMWPLFNCFVNLKVLNLSYNNFSDVSHMKLESITELYLSGNKLTTLSGDTVLKW 1233

Query: 285  KNLRVLDLSHNRLTELPSELGLCHQL 310
             +L+ L L+ N++  LP+EL    QL
Sbjct: 1234 SSLKTLMLNSNQMLSLPAELSNLSQL 1259

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 34/65 (52%)

Query: 256  ESLFRYEFLTRLYLNGNNLTVLPKAVKSLKNLRVLDLSHNRLTELPSELGLCHQLKYLYF 315
            E L +  FL +L LN NNLT LP+ +  L  L  L ++ N+L  +P EL     L+ L  
Sbjct: 1058 ELLTKLSFLEKLELNQNNLTRLPQEISKLTKLVFLSVARNKLEYIPPELSQLKSLRTLDL 1117

Query: 316  FDNMV 320
              N +
Sbjct: 1118 HSNNI 1122

>Kwal_33.15153
          Length = 1861

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 46/95 (48%), Gaps = 8/95 (8%)

Query: 227  RMVGPKDAKHDDQLWHALDL-SNLQVFNLTE------SLFRYEFLTRLYLNGNNLTVLP- 278
            R +   D    DQ W   ++  +L+  NL+       S F+ E LT LYL+GN    L  
Sbjct: 1009 RFLSMADNNLGDQFWTLFNMYEDLRTLNLSYNNLSDLSNFKLEKLTELYLSGNKFISLQG 1068

Query: 279  KAVKSLKNLRVLDLSHNRLTELPSELGLCHQLKYL 313
              V   K+L+VL L+ N L  LPSEL    QL  L
Sbjct: 1069 DTVLKWKSLKVLMLNGNNLLSLPSELSQLTQLNVL 1103

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 38/82 (46%)

Query: 243 ALDLSNLQVFNLTESLFRYEFLTRLYLNGNNLTVLPKAVKSLKNLRVLDLSHNRLTELPS 302
           +LDL    +  +  S+     LT L L  N L  LP     LKNLR+LD+S N   + P 
Sbjct: 709 SLDLERNFIKRIPPSISNLSELTILNLQCNELDRLPTGFTELKNLRLLDISSNNFVQYPE 768

Query: 303 ELGLCHQLKYLYFFDNMVSTLP 324
            +  C  L  +    N + +LP
Sbjct: 769 VINHCTNLLQVDLSYNKIQSLP 790

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 14/67 (20%)

Query: 245  DLSNLQVFNLTE--------------SLFRYEFLTRLYLNGNNLTVLPKAVKSLKNLRVL 290
            DLSN ++  LTE              ++ +++ L  L LNGNNL  LP  +  L  L VL
Sbjct: 1044 DLSNFKLEKLTELYLSGNKFISLQGDTVLKWKSLKVLMLNGNNLLSLPSELSQLTQLNVL 1103

Query: 291  DLSHNRL 297
            D+  N+L
Sbjct: 1104 DVGSNQL 1110

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 32/68 (47%)

Query: 256 ESLFRYEFLTRLYLNGNNLTVLPKAVKSLKNLRVLDLSHNRLTELPSELGLCHQLKYLYF 315
           E L +   L +L +NGNNLT +P  +  L  L  L  + N+L  +   +     L+ L  
Sbjct: 900 ELLCKLPRLEKLEVNGNNLTQIPPEISKLTKLVYLSAARNKLESISENIAELKNLRTLDV 959

Query: 316 FDNMVSTL 323
             N +S L
Sbjct: 960 HSNNLSNL 967

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 59/120 (49%), Gaps = 9/120 (7%)

Query: 204 PSVLLQHKKLSQYNIDEDDEIEHRMVGPKDAKHDDQLWHALDLSNLQVFNLTESLFRYEF 263
           P+   + K L   +I  ++ +++    P+   H   L   +DLS  ++ +L  S+ +   
Sbjct: 744 PTGFTELKNLRLLDISSNNFVQY----PEVINHCTNLLQ-VDLSYNKIQSLPASINQLTK 798

Query: 264 LTRLYLNGNNLTVLPKAVKSLKNLRVLDLSHNRLTELPSELGLCHQLKYLYFFDNMVSTL 323
           L ++ L+ N LT +   +  + NLR L+L  NR+T + SE      L+ L   +N +S L
Sbjct: 799 LAKMNLSNNKLTHIGN-LSGMVNLRTLNLKFNRITSMASE---NPNLQNLSLSNNRMSVL 854

>CAGL0D03168g complement(324192..330440) similar to sp|P08678
            Saccharomyces cerevisiae YJL005w CYR1 adenylate cyclase,
            hypothetical start
          Length = 2082

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 48/93 (51%), Gaps = 11/93 (11%)

Query: 233  DAKHDDQLWHALD-LSNLQVFNLTE------SLFRYEFLTRLYLNGNNLTVLP-KAVKSL 284
            D + DD  W   +  +NL++ NL+       +  + E LT L+L+GN +  LP   V   
Sbjct: 1229 DNQFDDDAWPLFNCFTNLKLLNLSYNNLQDITKMKLENLTELFLSGNKINTLPGDTVSKW 1288

Query: 285  KNLRVLDLSHNRLTELPSELGLCHQLKYLYFFD 317
            K L+ L L+ N+L  LP+EL    QL  L  FD
Sbjct: 1289 KYLKTLMLNGNQLLSLPAELS---QLPQLNVFD 1318

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 46/103 (44%), Gaps = 5/103 (4%)

Query: 227  RMVGPKDAKHDDQLWHALDLSNLQ-----VFNLTESLFRYEFLTRLYLNGNNLTVLPKAV 281
            RMV  + ++    +  A  L +L+     +  +  S+ +   LT L L  N L  LP   
Sbjct: 902  RMVNIRASRFPANITEAYKLVSLELQRNFIRKVPSSISKLVNLTILNLQCNGLDRLPSGF 961

Query: 282  KSLKNLRVLDLSHNRLTELPSELGLCHQLKYLYFFDNMVSTLP 324
              LKNL++LDLS NR    P  +  C  L  +    N +  LP
Sbjct: 962  SQLKNLQLLDLSSNRFAHYPEVINFCTNLLQIDLSYNKIHHLP 1004

 Score = 33.5 bits (75), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 9/86 (10%)

Query: 246  LSNLQVFNLTESLFRY-----EFLTRLY---LNGNNLTVLPKAVKSLKNLRVLDLSHNRL 297
            L NLQ+ +L+ + F +      F T L    L+ N +  LPK+ + L  L  ++LSHN+L
Sbjct: 964  LKNLQLLDLSSNRFAHYPEVINFCTNLLQIDLSYNKIHHLPKSCRQLVKLAKMNLSHNKL 1023

Query: 298  TELPSELGLCHQLKYLYFFDNMVSTL 323
            T +  +L     L+ L    N ++T+
Sbjct: 1024 THV-GDLSELKNLRTLNLRFNRINTI 1048

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 14/67 (20%)

Query: 245  DLSNLQVFNLTE--------------SLFRYEFLTRLYLNGNNLTVLPKAVKSLKNLRVL 290
            D++ +++ NLTE              ++ ++++L  L LNGN L  LP  +  L  L V 
Sbjct: 1258 DITKMKLENLTELFLSGNKINTLPGDTVSKWKYLKTLMLNGNQLLSLPAELSQLPQLNVF 1317

Query: 291  DLSHNRL 297
            D+  N+L
Sbjct: 1318 DIGSNQL 1324

>Scas_619.8
          Length = 894

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 30/59 (50%)

Query: 266 RLYLNGNNLTVLPKAVKSLKNLRVLDLSHNRLTELPSELGLCHQLKYLYFFDNMVSTLP 324
           RL L  N L  LP     L+ LR LDL  NRL ++P  L  C QL+ L    N +  LP
Sbjct: 101 RLSLRKNRLISLPPNFSQLQKLRYLDLHDNRLFDIPPVLLQCPQLEILDLSSNRIQGLP 159

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 2/79 (2%)

Query: 244 LDLSNLQVFNLTESLFRYEFLTRLYLNGNNLTVLPKAVKSLKNLRVLDLSHNRLTELPSE 303
           L L   ++ +L  +  + + L  L L+ N L  +P  +     L +LDLS NR+  LP+E
Sbjct: 102 LSLRKNRLISLPPNFSQLQKLRYLDLHDNRLFDIPPVLLQCPQLEILDLSSNRIQGLPNE 161

Query: 304 LGLC--HQLKYLYFFDNMV 320
           +  C    L+ L   +N V
Sbjct: 162 MTTCWMKNLRVLSLKNNNV 180

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 9/78 (11%)

Query: 244 LDLSNLQVFNLTESLFRYEFLTRLYLNGNNLTVLPKAVKS--LKNLRVLDLSHNRLTELP 301
           LDL + ++F++   L +   L  L L+ N +  LP  + +  +KNLRVL L +N +  + 
Sbjct: 125 LDLHDNRLFDIPPVLLQCPQLEILDLSSNRIQGLPNEMTTCWMKNLRVLSLKNNNVLSI- 183

Query: 302 SELGLCHQLKYLYFFDNM 319
                 + LK L + +N+
Sbjct: 184 ------YSLKSLIYLENL 195

>Sklu_2261.2 YOR353C, Contig c2261 1277-4051 reverse complement
          Length = 924

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 40/73 (54%), Gaps = 2/73 (2%)

Query: 253 NLTESLFRYEFLTRLYLNGNNLTVLPKAVKSLKNLRVLDLSHNRLTELPSELG--LCHQL 310
           +L  S  +   L  L L+GN L  +P  +     L +LDLS NR+++LP EL    C+ L
Sbjct: 105 SLPSSFDKLTQLRYLDLHGNKLHEIPHILLQNPQLEILDLSSNRISQLPQELSPLWCNNL 164

Query: 311 KYLYFFDNMVSTL 323
           K L   +N V++L
Sbjct: 165 KVLSLKNNRVASL 177

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 31/59 (52%)

Query: 266 RLYLNGNNLTVLPKAVKSLKNLRVLDLSHNRLTELPSELGLCHQLKYLYFFDNMVSTLP 324
           RL L  N LT LP +   L  LR LDL  N+L E+P  L    QL+ L    N +S LP
Sbjct: 95  RLSLQRNLLTSLPSSFDKLTQLRYLDLHGNKLHEIPHILLQNPQLEILDLSSNRISQLP 153

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 24/46 (52%)

Query: 279 KAVKSLKNLRVLDLSHNRLTELPSELGLCHQLKYLYFFDNMVSTLP 324
           +AV+ LK +  L L  N LT LPS      QL+YL    N +  +P
Sbjct: 85  EAVELLKPVERLSLQRNLLTSLPSSFDKLTQLRYLDLHGNKLHEIP 130

>Scas_669.13
          Length = 1948

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 243  ALDLSNLQVFNLTESLFR-YEFLTRLYLNGNNLTVLPKAVKSLKNLRVLDLSHNRLTELP 301
            +L LS  ++ ++   LF+   +L +L LN NNL+ LP  +  L  L  L ++ N+L  LP
Sbjct: 968  SLSLSKAKLASVPGDLFKNLPYLEKLELNENNLSRLPVEITYLTKLVYLSVARNKLEFLP 1027

Query: 302  SELGLCHQLKYLYFFDNMV 320
            +E      L+ L    N V
Sbjct: 1028 TEFSSLKSLRSLDIHSNNV 1046

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 44/80 (55%), Gaps = 4/80 (5%)

Query: 244 LDLSNLQVFNLTESLFRYEFLTRLYLNGNNLTVLPKAVKSLKNLRVLDLSHNRLTELPSE 303
           +DLS  ++ +L  S+ + + + ++ L+ N LT++   +  +KNLR L+L  NR+  L S 
Sbjct: 855 VDLSYNKIQSLPSSINQLKKIAKINLSHNKLTII-NDLSGMKNLRTLNLRFNRIAHLKSN 913

Query: 304 LGLCHQLKYLYFFDNMVSTL 323
                 L+ L+  DN ++  
Sbjct: 914 ---SSTLQNLFLTDNRIAAF 930

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 47/123 (38%), Gaps = 37/123 (30%)

Query: 233  DAKHDDQLWHALD-LSNLQVFNLT------ESLFRYEFLTRLYL---------------- 269
            D + DD +W   +  +NL+V NL+       S  R   L+ LYL                
Sbjct: 1098 DNQFDDGMWSLFNCFTNLKVLNLSYNNFADVSFLRLANLSELYLSGNKLTALPGDTVLHW 1157

Query: 270  --------NGNNLTVLPKAVKSLKNLRVLDLSHNRLTELPS------ELGLCHQLKYLYF 315
                    NGN L  LP  +  L++L + D+  N+L    S        G    LKYL F
Sbjct: 1158 KALKTLMVNGNQLLTLPAELSQLQHLTIFDIGSNQLKYNISNHHYDWNWGQNKDLKYLNF 1217

Query: 316  FDN 318
              N
Sbjct: 1218 SGN 1220

>KLLA0D02816g complement(238050..239138) similar to sp|P36047
           Saccharomyces cerevisiae YKL193c SDS22 regulatory
           subunit for the mitotic function of type I protein
           phosphatase singleton, hypothetical start
          Length = 362

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 50/107 (46%), Gaps = 26/107 (24%)

Query: 242 HALDLSNLQVFNLTE-SLFRYEFLTRLYLNGN------NLTVLP---------------- 278
             +DL +L+V  L + +L R++ L +LYL  N       L VLP                
Sbjct: 69  EVIDLVHLKVLALEDLNLLRFKNLKKLYLRQNLIESIAELEVLPLENMEEIDFYDNRIKH 128

Query: 279 --KAVKSLKNLRVLDLSHNRLTELPSELGLCHQLKYLYFFDNMVSTL 323
             K+V    NL+ LDLS N++  + +   L + L+ LYF  N +S +
Sbjct: 129 ISKSVNLFSNLKTLDLSFNKIRTIKNVDKLVN-LENLYFVQNKISKI 174

>AER010C [2515] [Homologous to ScYBR007C - SH] (650061..652355)
           [2295 bp, 764 aa]
          Length = 764

 Score = 34.7 bits (78), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 30/46 (65%), Gaps = 4/46 (8%)

Query: 177 GNNNASSSAVSTPITPNAEL---SNGHPTTPSVLLQ-HKKLSQYNI 218
           G NN SS+ +STP TP   L   S GHP++PS+  + HKK + +++
Sbjct: 300 GPNNGSSTLLSTPKTPGKSLECDSPGHPSSPSIWNKGHKKKNSFSL 345

>AFR110C [3302] [Homologous to ScYGR157W (CHO2) - SH]
           (633808..636339) [2532 bp, 843 aa]
          Length = 843

 Score = 33.1 bits (74), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 76/187 (40%), Gaps = 20/187 (10%)

Query: 108 IWKLQLQLAAVSRQSLGRANVY-----ARQSAMRKYLLNKTQGASSGGTLNEMSASLVDH 162
           IW L   +     +S   A VY     ARQS + K LL  T        L++ S SL+D 
Sbjct: 535 IWTLSNHIMVTFVESPHVAKVYGNEMLARQSGVGKTLLGFTPIKHFSDWLDKFSGSLID- 593

Query: 163 TKQLLLDMAGESPLGNNNASS-SAVSTPITPNAELSNGHPTTPSVLLQHKKLSQYNIDED 221
              L +   G   L +  A++  A +  ++P++E      +      ++     ++    
Sbjct: 594 --MLNVSTEGRDQLEDVIAAALQATTRKLSPDSEFEINRDS------ENNSDGDFSFTIG 645

Query: 222 DEIEHRMVGPKDAKHDDQLWHALDLSNLQVFNLTESLFRYEFLTRLYLNGNNLTVLPKAV 281
           D IE     P++  HD+  W  L     +V    E  +R    +R +    N    PK+V
Sbjct: 646 DSIEISWKLPRELYHDED-WIGL----YRVLETGEDRYRTLVSSRDHWCATNTMGYPKSV 700

Query: 282 KSLKNLR 288
           K++  ++
Sbjct: 701 KAIGAVK 707

>AAR141W [328] [Homologous to ScYKR071C (DRE2) - SH]
           complement(594767..595678) [912 bp, 303 aa]
          Length = 303

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 151 TLNEMSASLVDHTKQLLLD-MAGESPLGNNNASSSAVSTPIT 191
           TL+E+  + VD  K  LLD  AG++P+  N+      STPIT
Sbjct: 157 TLDEVPPAAVDPVKAALLDSAAGDAPIAENDLVVGHDSTPIT 198

>Scas_700.5
          Length = 450

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 46/102 (45%), Gaps = 10/102 (9%)

Query: 201 PTTPS-VLLQHKKLSQYNIDEDDEIEHRMVGPKDAKHDDQLWHAL--DLSNLQVFN---- 253
           P  PS V+   K + +YN+  D +I  +  GP D   D  +++       N  V+N    
Sbjct: 151 PKWPSYVMTDSKSVLKYNVVADADIPPKKTGPSD--EDIPIYNTWLGQSCNFVVYNGLKI 208

Query: 254 LTESLFRYEFLTRLYLNGNNLTVLPKAVKSLKNLRVLDLSHN 295
           LT+ LF  +FL         +T LP  +  +    V+ +SHN
Sbjct: 209 LTDPLFS-DFLIHETFGPKRITSLPCEISDVPTPDVILVSHN 249

>Sklu_2339.4 YKL193C, Contig c2339 10414-11475
          Length = 353

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 37/76 (48%), Gaps = 6/76 (7%)

Query: 253 NLTESLFRYEFL-----TRLYLNGNNLTVLPKAVKSLKNLRVLDLSHNRLTELPSELGLC 307
           NL ES+   + L       L L  N +  + K    L NL+ LDLS N++  + + +   
Sbjct: 91  NLIESISEVDVLPVDTMEELDLYDNRIKHISKNTNKLINLKNLDLSFNKIKHIKN-IDQL 149

Query: 308 HQLKYLYFFDNMVSTL 323
             L+ LYF  N +ST+
Sbjct: 150 TNLENLYFVQNKISTI 165

>Kwal_47.16709
          Length = 1688

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 49/121 (40%), Gaps = 15/121 (12%)

Query: 468  EDFWAPLLREEGYTGIFHAKTRARTMQGKDSKK-------VDGCCLFYRDSEFKLIFKDT 520
            E   A  +R EG+  +  +  RAR   GKD  +       +    LFY  S F  I +  
Sbjct: 1189 ETLSAEEIRLEGFRRLISSIYRARLKSGKDEARDFSRKEEIAPEVLFYTGSLFTFIDEQA 1248

Query: 521  VDFSSVWMKHKK--FQRTEDYLNRAMNKDNVALLVKLQHLKSGE-HVWAATTHLHWDPQF 577
                ++  +     F + ED L+R ++  N+A       L+ G+ H+       HW   +
Sbjct: 1249 EILKNLGNRRNASLFVKDEDKLSRNISLTNLA-----HELQRGKNHLILVNRKWHWKKHY 1303

Query: 578  N 578
            N
Sbjct: 1304 N 1304

>CAGL0J06534g 623480..628492 similar to sp|P52593 Saccharomyces
           cerevisiae YML103c NUP188 nuclear pore protein,
           hypothetical start
          Length = 1670

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 22/42 (52%)

Query: 669 GELPFTNLTPTYTDVIDYIWYSSQGLRVRGVLGQIDPDYASK 710
           G LPF NLT    ++ ++ W +     V+  LG ID D A +
Sbjct: 443 GLLPFINLTSINEELAEFNWEAFGSYAVKMPLGSIDYDVADR 484

>Kwal_56.23844
          Length = 1494

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 30/48 (62%), Gaps = 2/48 (4%)

Query: 229  VGPKDAKHDDQLWHALDLSNLQVFNLTESLFRYEFLTRLYLNGNNLTV 276
            + P +   D+++WHAL+L++L+  +  +SL + E  + L   G NL+V
Sbjct: 1347 IDPTNEYTDEEIWHALELAHLK--DHIKSLGKDELESMLTEGGGNLSV 1392

>AER104W [2609] [Homologous to ScYKL193C (SDS22) - SH]
           complement(834813..835862) [1050 bp, 349 aa]
          Length = 349

 Score = 30.0 bits (66), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 6/76 (7%)

Query: 253 NLTESLFRYEFL-----TRLYLNGNNLTVLPKAVKSLKNLRVLDLSHNRLTELPSELGLC 307
           NL ES+   E L       L L  N +  + + V  L NL+ LDLS N++  + + +   
Sbjct: 87  NLIESISEVEVLPAETVEELDLYDNRIKHISRNVNKLVNLKSLDLSFNKIKNIKN-IDKL 145

Query: 308 HQLKYLYFFDNMVSTL 323
            +L+ +YF  N ++ +
Sbjct: 146 TKLERVYFVQNKIAVI 161

>CAGL0E01595g 152176..153582 similar to sp|Q08271 Saccharomyces
           cerevisiae YOL132w, start by similarity
          Length = 468

 Score = 30.0 bits (66), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 49/119 (41%), Gaps = 16/119 (13%)

Query: 589 LDHMEKVIKEHSGYNNSQELKKVPVIICGDFNSQVDSAVYELLSTGSVRQHCDIEGRDF- 647
           L+H+ KV+ + SGYNN+        +I  D  S  +S +Y     G ++++  I      
Sbjct: 136 LEHVFKVVSQFSGYNNTLGFFAGNEVI-NDEESATNSPIYVKKLIGDIKEYIAITCDRLI 194

Query: 648 --GFMSQKNYAHNLPLKSSYECIGELPFTNLTPTYTDVID------YIWYSSQGLRVRG 698
             G+ +  +  + + L    EC      TN    Y D +D      Y W   Q +R  G
Sbjct: 195 PVGYSAADDLNYRVSLSQYLEC-----STNSNKVY-DSVDFYGVNSYQWCGEQTIRTSG 247

>YOR373W (NUD1) [5148] chr15 (1036830..1039385) Spindle pole body
           protein required for nuclear division [2556 bp, 851 aa]
          Length = 851

 Score = 30.0 bits (66), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 30/60 (50%)

Query: 264 LTRLYLNGNNLTVLPKAVKSLKNLRVLDLSHNRLTELPSELGLCHQLKYLYFFDNMVSTL 323
           + +L+ + N +T    ++    +L  LDLS+N L      L LCH L+ +    N + +L
Sbjct: 522 VVQLFCSNNKITSAHCSLAGFHDLECLDLSYNLLNTSLKFLSLCHHLQEVNLSYNSIQSL 581

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.133    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 24,336,079
Number of extensions: 1076935
Number of successful extensions: 3492
Number of sequences better than 10.0: 64
Number of HSP's gapped: 3499
Number of HSP's successfully gapped: 110
Length of query: 731
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 622
Effective length of database: 12,822,747
Effective search space: 7975748634
Effective search space used: 7975748634
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)