Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.710574072938670.0
YAL023C (PMT2)75972429710.0
KLLA0F15829g74169929230.0
Scas_505.275273528550.0
CAGL0J08734g74273127890.0
ACR290W75573227350.0
Scas_643.2476975125910.0
YOR321W (PMT3)75373225800.0
CAGL0F00759g73472421290.0
Kwal_33.1547175575417970.0
KLLA0F21978g75774717340.0
YGR199W (PMT6)75974917320.0
CAGL0K00979g73073315870.0
Scas_408.1*3913919301e-119
CAGL0L07216g8587219681e-119
YDL095W (PMT1)8177219101e-111
KLLA0E01342g8387348851e-107
ADR279C8176838391e-100
Kwal_23.36238766828371e-99
YDL093W (PMT5)7437397521e-88
KLLA0B03762g7727137504e-88
CAGL0M00220g7656987285e-85
YJR143C (PMT4)7627017242e-84
ABL085W7576987041e-81
Scas_710.19197266902e-78
Kwal_47.167347926976832e-78
Scas_442.13092986446e-78
Scas_719.807627536577e-75
CAGL0L07172g7776925612e-61
Scas_30.11281063881e-43
Scas_329.12732313772e-40
Sklu_2215.66534373912e-39
AAL050W6573642971e-27
Scas_588.77266052766e-25
Kwal_33.143576574252516e-22
KLLA0C14828g6294872363e-20
YDR307W6623812052e-16
Scas_710.0d2711471272e-07
CAGL0J11044g7362041231e-06
Kwal_56.2293430766850.033
YOR220W265113730.80
CAGL0C01881g99986702.7
ADR091W66480675.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.7105
         (729 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.7105                                                         1494   0.0  
YAL023C (PMT2) [45] chr1 complement(106275..108554) Mannosyltran...  1149   0.0  
KLLA0F15829g complement(1464112..1466337) similar to sp|P31382 S...  1130   0.0  
Scas_505.2                                                           1104   0.0  
CAGL0J08734g 860389..862617 highly similar to sp|P31382 Saccharo...  1078   0.0  
ACR290W [1337] [Homologous to ScYAL023C (PMT2) - SH; ScYOR321W (...  1058   0.0  
Scas_643.24                                                          1002   0.0  
YOR321W (PMT3) [5103] chr15 (916025..918286) Mannosyltransferase...   998   0.0  
CAGL0F00759g complement(85452..87656) similar to sp|P31382 Sacch...   824   0.0  
Kwal_33.15471                                                         696   0.0  
KLLA0F21978g 2042656..2044929 similar to sp|P42934 Saccharomyces...   672   0.0  
YGR199W (PMT6) [2149] chr7 (897505..899784) Protein with similar...   671   0.0  
CAGL0K00979g complement(97306..99498) similar to sp|P42934 Sacch...   615   0.0  
Scas_408.1*                                                           362   e-119
CAGL0L07216g complement(799529..802105) similar to sp|P33775 Sac...   377   e-119
YDL095W (PMT1) [773] chr4 (287059..289512) Mannosyltransferase (...   355   e-111
KLLA0E01342g complement(134691..137207) similar to sp|P33775 Sac...   345   e-107
ADR279C [2020] [Homologous to ScYDL095W (PMT1) - SH; ScYDL093W (...   327   e-100
Kwal_23.3623                                                          327   1e-99
YDL093W (PMT5) [774] chr4 (289909..292140) Member of the PMT O-m...   294   1e-88
KLLA0B03762g 339424..341742 similar to sp|P46971 Saccharomyces c...   293   4e-88
CAGL0M00220g 28137..30434 similar to sp|P46971 Saccharomyces cer...   285   5e-85
YJR143C (PMT4) [3035] chr10 complement(698241..700529) Mannosylt...   283   2e-84
ABL085W [507] [Homologous to ScYJR143C (PMT4) - SH] complement(2...   275   1e-81
Scas_710.1                                                            270   2e-78
Kwal_47.16734                                                         267   2e-78
Scas_442.1                                                            252   6e-78
Scas_719.80                                                           257   7e-75
CAGL0L07172g complement(796354..798687) similar to sp|P33775 Sac...   220   2e-61
Scas_30.1                                                             154   1e-43
Scas_329.1                                                            149   2e-40
Sklu_2215.6 YDR307W, Contig c2215 9395-11356 reverse complement       155   2e-39
AAL050W [137] [Homologous to ScYDR307W - SH] complement(256490.....   119   1e-27
Scas_588.7                                                            110   6e-25
Kwal_33.14357                                                         101   6e-22
KLLA0C14828g complement(1292713..1294602) weakly similar to sp|Q...    96   3e-20
YDR307W (YDR307W) [1135] chr4 (1075857..1077845) Protein contain...    84   2e-16
Scas_710.0d                                                            54   2e-07
CAGL0J11044g complement(1073988..1076198) weakly similar to sp|Q...    52   1e-06
Kwal_56.22934                                                          37   0.033
YOR220W (YOR220W) [5012] chr15 (755328..756125) Protein of unkno...    33   0.80 
CAGL0C01881g 196299..199298 similar to sp|P38041 Saccharomyces c...    32   2.7  
ADR091W [1832] [Homologous to ScYDL194W (SNF3) - SH; ScYDL138W (...    30   5.7  

>Kwal_26.7105
          Length = 740

 Score = 1494 bits (3867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 722/729 (99%), Positives = 722/729 (99%)

Query: 1   MSATGFDSRISDGTLKQRKVTTVDEIPDIEVDDRIEEKSVEVNPLLRLESIAMPMIFTAV 60
           MSATGFDSRISDGTLKQRKVTTVDEIPDIEVDDRIEEKSVEVNPLLRLESIAMPMIFTAV
Sbjct: 1   MSATGFDSRISDGTLKQRKVTTVDEIPDIEVDDRIEEKSVEVNPLLRLESIAMPMIFTAV 60

Query: 61  GFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWMAGYNGSW 120
           GFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWMAGYNGSW
Sbjct: 61  GFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWMAGYNGSW 120

Query: 121 DFPSGEEYPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTILVIFENSYA 180
           DFPSGEEYPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTILVIFENSYA
Sbjct: 121 DFPSGEEYPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTILVIFENSYA 180

Query: 181 TLGRFILLDSMLLFFTVASMFCFVTFHNQRSKPFSRKWWKWLLLTGVSLGCTISVKMVGL 240
           TLGRFILLDSMLLFFTVASMFCFVTFHNQRSKPFSRKWWKWLLLTGVSLGCTISVKMVGL
Sbjct: 181 TLGRFILLDSMLLFFTVASMFCFVTFHNQRSKPFSRKWWKWLLLTGVSLGCTISVKMVGL 240

Query: 241 FIITLVGIYTVIELWTLLGDKKVSKKAYAGHWLARILCLIIVPFLIFLACFKVHFDLLSH 300
           FIITLVGIYTVIELWTLLGDKKVSKKAYAGHWLARILCLIIVPFLIFLACFKVHFDLLSH
Sbjct: 241 FIITLVGIYTVIELWTLLGDKKVSKKAYAGHWLARILCLIIVPFLIFLACFKVHFDLLSH 300

Query: 301 SGTGDANMPSLFQAGLAGSDVGDGPRDIAVGSSIVSIKNQALGGSLLHSHVQGYPEGSNQ 360
           SGTGDANMPSLFQAGLAGSDVGDGPRDIAVGSSIVSIKNQALGGSLLHSHVQGYPEGSNQ
Sbjct: 301 SGTGDANMPSLFQAGLAGSDVGDGPRDIAVGSSIVSIKNQALGGSLLHSHVQGYPEGSNQ 360

Query: 361 QQVTCYGHKDSNNNWLFDRIRPLTPWSEEETEIEFVKPGSSYRLVHPNTGKNLHTHPIAA 420
           QQVTCYGHKDSNNNWLFDRIRPLTPWSEEETEIEFVKPGSSYRLVHPNTGKNLHTHPIAA
Sbjct: 361 QQVTCYGHKDSNNNWLFDRIRPLTPWSEEETEIEFVKPGSSYRLVHPNTGKNLHTHPIAA 420

Query: 421 PITKSEWEVSGYGTAEVGDPKDHWVVEVVAQHGSEDESRLHPLTSSFRIKNAELGCYLAQ 480
           PITKSEWEVSGYGTAEVGDPKDHWVVEVVAQHGSEDESRLHPLTSSFRIKNAELGCYLAQ
Sbjct: 421 PITKSEWEVSGYGTAEVGDPKDHWVVEVVAQHGSEDESRLHPLTSSFRIKNAELGCYLAQ 480

Query: 481 TGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVETHTNEKLPGRPADFKYPKINFIKNFIH 540
           TGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVETHTNEKLPGRPADFKYPKINFIKNFIH
Sbjct: 481 TGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVETHTNEKLPGRPADFKYPKINFIKNFIH 540

Query: 541 LNLAMMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLCGWGDDTVKYFLMGSPASTWLS 600
           LNLAMMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLCGWGDDTVKYFLMGSPASTWLS
Sbjct: 541 LNLAMMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLCGWGDDTVKYFLMGSPASTWLS 600

Query: 601 TIAVVGFMGXXXXXXXRWQRQYQDLSDAHDFNLFMMGGFYPLLGWGLHYMPFVIMSRVTY 660
           TIAVVGFMG       RWQRQYQDLSDAHDFNLFMMGGFYPLLGWGLHYMPFVIMSRVTY
Sbjct: 601 TIAVVGFMGLVVLLLLRWQRQYQDLSDAHDFNLFMMGGFYPLLGWGLHYMPFVIMSRVTY 660

Query: 661 VHHYLPALYFALLILSYLFEAGLKGLNKTKGGQLARTLIYVTYGAIVIYGFYYFSPISFG 720
           VHHYLPALYFALLILSYLFEAGLKGLNKTKGGQLARTLIYVTYGAIVIYGFYYFSPISFG
Sbjct: 661 VHHYLPALYFALLILSYLFEAGLKGLNKTKGGQLARTLIYVTYGAIVIYGFYYFSPISFG 720

Query: 721 LSGPSSNYA 729
           LSGPSSNYA
Sbjct: 721 LSGPSSNYA 729

>YAL023C (PMT2) [45] chr1 complement(106275..108554)
           Mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase),
           responsible for initiation of O-glycosylation [2280 bp,
           759 aa]
          Length = 759

 Score = 1149 bits (2971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/724 (73%), Positives = 621/724 (85%), Gaps = 6/724 (0%)

Query: 11  SDGTLKQRKVTTVDEI------PDIEVDDRIEEKSVEVNPLLRLESIAMPMIFTAVGFFT 64
            + TL+QR+ +++          + + +D  +EK    + LLRLES+ MP+IFTA+  FT
Sbjct: 19  QENTLRQRESSSISVSEELSSADERDAEDFSKEKPAAQSSLLRLESVVMPVIFTALALFT 78

Query: 65  RMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWMAGYNGSWDFPS 124
           RMYKIG+NNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSG++AGYNGSWDFPS
Sbjct: 79  RMYKIGINNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPS 138

Query: 125 GEEYPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTILVIFENSYATLGR 184
           GE YPDYLDYVKMR+FNA+FSALC+PLAYFTAKAIGFSLPTVWL T+LV+FENSY+TLGR
Sbjct: 139 GEIYPDYLDYVKMRLFNASFSALCVPLAYFTAKAIGFSLPTVWLMTVLVLFENSYSTLGR 198

Query: 185 FILLDSMLLFFTVASMFCFVTFHNQRSKPFSRKWWKWLLLTGVSLGCTISVKMVGLFIIT 244
           FILLDSMLLFFTVAS F FV FHNQRSKPFSRKWWKWLL+TG+SLGCTISVKMVGLFIIT
Sbjct: 199 FILLDSMLLFFTVASFFSFVMFHNQRSKPFSRKWWKWLLITGISLGCTISVKMVGLFIIT 258

Query: 245 LVGIYTVIELWTLLGDKKVSKKAYAGHWLARILCLIIVPFLIFLACFKVHFDLLSHSGTG 304
           +VGIYTVI+LWT L DK +S K Y  HWLARI  LIIVPF IFL CFK+HFDLLSHSGTG
Sbjct: 259 MVGIYTVIDLWTFLADKSMSWKTYINHWLARIFGLIIVPFCIFLLCFKIHFDLLSHSGTG 318

Query: 305 DANMPSLFQAGLAGSDVGDGPRDIAVGSSIVSIKNQALGGSLLHSHVQGYPEGSNQQQVT 364
           DANMPSLFQA L GSDVG GPRDIA+GSS+VSIKNQALGGSLLHSH+Q YP+GSNQQQVT
Sbjct: 319 DANMPSLFQARLVGSDVGQGPRDIALGSSVVSIKNQALGGSLLHSHIQTYPDGSNQQQVT 378

Query: 365 CYGHKDSNNNWLFDRIRPLTPWSEEETEIEFVKPGSSYRLVHPNTGKNLHTHPIAAPITK 424
           CYG+KD+NN W F+R R L  WSE ET+IE++KPG+SYRLVH +TG+NLHTHP+AAP++K
Sbjct: 379 CYGYKDANNEWFFNRERGLPSWSENETDIEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSK 438

Query: 425 SEWEVSGYGTAEVGDPKDHWVVEVVAQHGSEDESRLHPLTSSFRIKNAELGCYLAQTGAH 484
           ++WEVSGYG   VGD KD+WV+E++ Q G ED  +LH LT+SFRIKN E+GCYLAQTG  
Sbjct: 439 TQWEVSGYGDNVVGDNKDNWVIEIMDQRGDEDPEKLHTLTTSFRIKNLEMGCYLAQTGNS 498

Query: 485 LPEWGFRQSEVACLKNPFKRDKRTWWNVETHTNEKLPGRPADFKYPKINFIKNFIHLNLA 544
           LPEWGFRQ EV C+KNPFKRDKRTWWN+ETH NE+LP RP DF+YPK NF+K+FIHLNLA
Sbjct: 499 LPEWGFRQQEVVCMKNPFKRDKRTWWNIETHENERLPPRPEDFQYPKTNFLKDFIHLNLA 558

Query: 545 MMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLCGWGDDTVKYFLMGSPASTWLSTIAV 604
           MMATNNALVPDPDK D LASSAWQWPTLNVG+RLCGWGDD  KYFL+G+PASTW S++AV
Sbjct: 559 MMATNNALVPDPDKFDYLASSAWQWPTLNVGLRLCGWGDDNPKYFLLGTPASTWASSVAV 618

Query: 605 VGFMGXXXXXXXRWQRQYQDLSDAHDFNLFMMGGFYPLLGWGLHYMPFVIMSRVTYVHHY 664
           + FM        RWQRQY DL +  ++N+F+MGGFYPLL WGLHYMPFVIMSRVTYVHHY
Sbjct: 619 LAFMATVVILLIRWQRQYVDLRNPSNWNVFLMGGFYPLLAWGLHYMPFVIMSRVTYVHHY 678

Query: 665 LPALYFALLILSYLFEAGLKGLNKTKGGQLARTLIYVTYGAIVIYGFYYFSPISFGLSGP 724
           LPALYFAL+IL+Y F+AGL+  +++K G++ R ++Y  + A+VI  F+YFSPISFG+ GP
Sbjct: 679 LPALYFALIILAYCFDAGLQKWSRSKCGRIMRFVLYAGFMALVIGCFWYFSPISFGMEGP 738

Query: 725 SSNY 728
           SSN+
Sbjct: 739 SSNF 742

>KLLA0F15829g complement(1464112..1466337) similar to sp|P31382
           Saccharomyces cerevisiae YAL023c PMT2
           mannosyltransferase, start by similarity
          Length = 741

 Score = 1130 bits (2923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/699 (74%), Positives = 602/699 (86%)

Query: 30  EVDDRIEEKSVEVNPLLRLESIAMPMIFTAVGFFTRMYKIGVNNHVVWDEAHFGKFGSYY 89
           E +D  ++K V  +PLL+LESI MP+IFT + FF RMYKIG N+HVVWDEAHFGKFGSYY
Sbjct: 30  EAEDLSKQKHVNESPLLKLESILMPIIFTGLAFFIRMYKIGANDHVVWDEAHFGKFGSYY 89

Query: 90  LRHEFYHDVHPPLGKMLVGLSGWMAGYNGSWDFPSGEEYPDYLDYVKMRIFNATFSALCI 149
           LRHEFYHDVHPPLGKMLVG SG++AGYNGSWDFPSGE+YP+Y+D+VKMR+FNA FSALC+
Sbjct: 90  LRHEFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPSGEQYPEYIDFVKMRLFNALFSALCV 149

Query: 150 PLAYFTAKAIGFSLPTVWLFTILVIFENSYATLGRFILLDSMLLFFTVASMFCFVTFHNQ 209
           P+AYFTAK+IGFSLPTVWLFT LV+FENSY TLGRFILLDSMLLFFTV SMFCFV FHN 
Sbjct: 150 PVAYFTAKSIGFSLPTVWLFTTLVLFENSYTTLGRFILLDSMLLFFTVLSMFCFVKFHNV 209

Query: 210 RSKPFSRKWWKWLLLTGVSLGCTISVKMVGLFIITLVGIYTVIELWTLLGDKKVSKKAYA 269
           RSKPF++KWWKWL  TG SLGCTISVKMVGL IIT+VGIYTV++LW +L D K+SKK YA
Sbjct: 210 RSKPFTKKWWKWLFYTGFSLGCTISVKMVGLLIITMVGIYTVVDLWNMLADTKMSKKVYA 269

Query: 270 GHWLARILCLIIVPFLIFLACFKVHFDLLSHSGTGDANMPSLFQAGLAGSDVGDGPRDIA 329
            HW +R + LI+VPF +FLACFK+HFDLLSHSGTGDANMPSLFQA L GSDVG+GPRD+A
Sbjct: 270 AHWASRFVFLILVPFAVFLACFKIHFDLLSHSGTGDANMPSLFQANLIGSDVGEGPRDVA 329

Query: 330 VGSSIVSIKNQALGGSLLHSHVQGYPEGSNQQQVTCYGHKDSNNNWLFDRIRPLTPWSEE 389
           +GSS ++IKNQALGG LLHSH+Q YPEGS QQQVT YGHKDSNN W FDR R   P+ + 
Sbjct: 330 LGSSEITIKNQALGGGLLHSHIQTYPEGSQQQQVTTYGHKDSNNVWTFDRQRFSAPYDKN 389

Query: 390 ETEIEFVKPGSSYRLVHPNTGKNLHTHPIAAPITKSEWEVSGYGTAEVGDPKDHWVVEVV 449
           ETE EFV  G+ YRLVH NTG+NLHTHP  AP+  + WEVSGYG A+VGDPKD W++E+V
Sbjct: 390 ETETEFVTDGARYRLVHLNTGRNLHTHPHRAPVQANAWEVSGYGDAKVGDPKDDWIIEIV 449

Query: 450 AQHGSEDESRLHPLTSSFRIKNAELGCYLAQTGAHLPEWGFRQSEVACLKNPFKRDKRTW 509
            Q G EDE++LHPLTSSFR+KNAE+GCYL+QTG  LP+WGFRQ+EVAC+KNPFKRDKRTW
Sbjct: 450 DQKGPEDETKLHPLTSSFRLKNAEMGCYLSQTGNTLPQWGFRQNEVACVKNPFKRDKRTW 509

Query: 510 WNVETHTNEKLPGRPADFKYPKINFIKNFIHLNLAMMATNNALVPDPDKLDNLASSAWQW 569
           WN+ET+ NEKLP RP +FKYPK +FIK+FIHLNLAMMATNNALVP+ +KLD LASSAWQW
Sbjct: 510 WNIETNVNEKLPPRPENFKYPKTSFIKDFIHLNLAMMATNNALVPNAEKLDKLASSAWQW 569

Query: 570 PTLNVGIRLCGWGDDTVKYFLMGSPASTWLSTIAVVGFMGXXXXXXXRWQRQYQDLSDAH 629
           PTLNVGIRLCGWG+  +KYFL+GSPASTW STIAV+ FM        RWQRQY DL++  
Sbjct: 570 PTLNVGIRLCGWGEQNIKYFLIGSPASTWPSTIAVLAFMVLVAVYLIRWQRQYSDLTNPE 629

Query: 630 DFNLFMMGGFYPLLGWGLHYMPFVIMSRVTYVHHYLPALYFALLILSYLFEAGLKGLNKT 689
           D NLF+MGG YPLL WGLH++PF+IMSRVTYVHHYLPALYFALL+L+YLFE  +K  NK+
Sbjct: 630 DINLFLMGGIYPLLAWGLHFVPFIIMSRVTYVHHYLPALYFALLVLAYLFEISMKKWNKS 689

Query: 690 KGGQLARTLIYVTYGAIVIYGFYYFSPISFGLSGPSSNY 728
           K G++ R  IY +Y AIVIYGFYYF+PISFG+SGPS++Y
Sbjct: 690 KCGKVMRYTIYGSYMAIVIYGFYYFAPISFGMSGPSTDY 728

>Scas_505.2
          Length = 752

 Score = 1104 bits (2855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/735 (70%), Positives = 605/735 (82%), Gaps = 7/735 (0%)

Query: 2   SATGFDSRISDGT-LKQRKVTTVD---EIPDIEVDDRIEEKSVE---VNPLLRLESIAMP 54
           SATGF +R  D   +K R+   +D   EI D + D + E  S E    N LLR+ESI MP
Sbjct: 3   SATGFKAREKDTEEVKARQDINIDTHEEIIDEKEDLKKEIVSTEKKESNTLLRVESIIMP 62

Query: 55  MIFTAVGFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWMA 114
           ++FT +  F RMYKIG+N+HVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSG++A
Sbjct: 63  LVFTGLAIFIRMYKIGINDHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLA 122

Query: 115 GYNGSWDFPSGEEYPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTILVI 174
           GYNGS+DF SG EYPDY+DYVKMRIFNA FSA+C+P+AYFTAKAIGFS+PTVWLFTI V+
Sbjct: 123 GYNGSFDFSSGAEYPDYVDYVKMRIFNAAFSAMCVPVAYFTAKAIGFSIPTVWLFTITVL 182

Query: 175 FENSYATLGRFILLDSMLLFFTVASMFCFVTFHNQRSKPFSRKWWKWLLLTGVSLGCTIS 234
           FENSY TLG+FILLDSMLLFFTV S  CFV FHNQRSKPFSRKWWKW+LLTG+S+GC IS
Sbjct: 183 FENSYTTLGKFILLDSMLLFFTVLSYMCFVIFHNQRSKPFSRKWWKWMLLTGLSMGCAIS 242

Query: 235 VKMVGLFIITLVGIYTVIELWTLLGDKKVSKKAYAGHWLARILCLIIVPFLIFLACFKVH 294
           VKMVGLFIIT+VGIYT+I+LW  LGDK +S KAY GHWLARI+CLIIVPFL+FLACFK+H
Sbjct: 243 VKMVGLFIITVVGIYTIIDLWNFLGDKTMSWKAYIGHWLARIICLIIVPFLVFLACFKIH 302

Query: 295 FDLLSHSGTGDANMPSLFQAGLAGSDVGDGPRDIAVGSSIVSIKNQALGGSLLHSHVQGY 354
           FDLL+HSGTGDANM SLFQA L GSDVG GPRD+AVGSSI+SIKNQALGG+LLHSH   Y
Sbjct: 303 FDLLTHSGTGDANMSSLFQANLIGSDVGAGPRDVAVGSSIISIKNQALGGALLHSHYNAY 362

Query: 355 PEGSNQQQVTCYGHKDSNNNWLFDRIRPLTPWSEEETEIEFVKPGSSYRLVHPNTGKNLH 414
           PEGSNQQQVT Y +KD+NN W FDR R    + E ET+IE+V   S YRLVH  TGKNLH
Sbjct: 363 PEGSNQQQVTAYSYKDANNEWFFDRPRGEPFYHENETDIEYVLGDSQYRLVHHKTGKNLH 422

Query: 415 THPIAAPITKSEWEVSGYGTAEVGDPKDHWVVEVVAQHGSEDESRLHPLTSSFRIKNAEL 474
           THP+ API+ ++WEVSGYG AE GD +D+W++E+V Q G ED+++LHPLT+SFRI N ++
Sbjct: 423 THPVRAPISSTQWEVSGYGDAEQGDSRDNWLIEIVDQRGDEDKTKLHPLTTSFRIYNPDM 482

Query: 475 GCYLAQTGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVETHTNEKLPGRPADFKYPKINF 534
            CYL+QTG HLPEWGF+Q EVAC++NPF+RDKRTWWN+ET+ N+ LP RPADFK+PK NF
Sbjct: 483 DCYLSQTGNHLPEWGFKQFEVACVQNPFRRDKRTWWNIETNENDVLPPRPADFKFPKTNF 542

Query: 535 IKNFIHLNLAMMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLCGWGDDTVKYFLMGSP 594
            K+FI LNLAMMATNNALVPDP+K D LASSAWQWPTL  G+R+C WG+D VKYFL+G+P
Sbjct: 543 FKDFIQLNLAMMATNNALVPDPEKFDILASSAWQWPTLYWGLRICSWGEDVVKYFLLGTP 602

Query: 595 ASTWLSTIAVVGFMGXXXXXXXRWQRQYQDLSDAHDFNLFMMGGFYPLLGWGLHYMPFVI 654
           ASTW S++AVVG M        RWQRQY DL D  D N FMMG FYPLL WGLHY PFVI
Sbjct: 603 ASTWGSSLAVVGLMVYIVVLLIRWQRQYSDLQDPKDLNTFMMGAFYPLLAWGLHYAPFVI 662

Query: 655 MSRVTYVHHYLPALYFALLILSYLFEAGLKGLNKTKGGQLARTLIYVTYGAIVIYGFYYF 714
           MSRVTYVHHYLPALYFAL+IL+Y+F+AGLK L KTK  Q+ R +IY+     VI  F+YF
Sbjct: 663 MSRVTYVHHYLPALYFALIILAYVFDAGLKFLTKTKSTQILRIVIYLAAYVTVIGCFWYF 722

Query: 715 SPISFGLSGPSSNYA 729
           SPISFG+ GP  NY+
Sbjct: 723 SPISFGMVGPMENYS 737

>CAGL0J08734g 860389..862617 highly similar to sp|P31382
           Saccharomyces cerevisiae YAL023c PMT2 or sp|P47190
           Saccharomyces cerevisiae YOR321w PMT3, hypothetical
           start
          Length = 742

 Score = 1078 bits (2789), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/731 (68%), Positives = 610/731 (83%), Gaps = 5/731 (0%)

Query: 1   MSATGFD-SRISDGTLKQRKVTTVDEIPDIEVDD--RIEEKSVEVNPLLRLESIAMPMIF 57
           MS+TGF  S  SD  LK RK T+VD++   E +D  ++++  V  +PLL+LE+  MP++F
Sbjct: 1   MSSTGFQGSEKSDAELKARKQTSVDDVLIEEKEDTSKLKDAKVSQSPLLQLEAYLMPLVF 60

Query: 58  TAVGFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWMAGYN 117
           T +  F RMY+IG+N +VVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSG++AGYN
Sbjct: 61  TGLALFVRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYN 120

Query: 118 GSWDFPSGEEYPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTILVIFEN 177
           GS+DF SG EYP+Y+D+VKMR+FNA+FSA+C+PLAYFTAKAIGFSLP VWLFT +V+FEN
Sbjct: 121 GSFDFESGHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIGFSLPAVWLFTCMVLFEN 180

Query: 178 SYATLGRFILLDSMLLFFTVASMFCFVTFHNQRSKPFSRKWWKWLLLTGVSLGCTISVKM 237
           SY+TLGRFILLDSMLLFFTVAS+F FV FHNQRS+PFSRKWWKWLLLTG++LGCTISVKM
Sbjct: 181 SYSTLGRFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWWKWLLLTGINLGCTISVKM 240

Query: 238 VGLFIITLVGIYTVIELWTLLGDKKVSKKAYAGHWLARILCLIIVPFLIFLACFKVHFDL 297
           VGLF+ITLVGIYTVI+L  +L +KK+S K+Y GHWLARI+ LI VP  +F+ CFK+HFDL
Sbjct: 241 VGLFVITLVGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVALICVPMAVFMICFKLHFDL 300

Query: 298 LSHSGTGDANMPSLFQAGLAGSDVGDGPRDIAVGSSIVSIKNQALGGSLLHSHVQGYPEG 357
           L HSGTGDANMPSLFQAGL GSDVG GPRD+A+GSS VSIKNQAL G+LLHSHVQ YPEG
Sbjct: 301 LWHSGTGDANMPSLFQAGLVGSDVGGGPRDVAIGSS-VSIKNQALSGALLHSHVQTYPEG 359

Query: 358 SNQQQVTCYGHKDSNNNWLFDRIRPLTPWSEEETEIEFVKPGSSYRLVHPNTGKNLHTHP 417
           SNQQQVT Y +KD+NNNW+F R+R  + W   ET+IE+V  G+ YRLVH NT KNLHTH 
Sbjct: 360 SNQQQVTAYSYKDANNNWVFHRVREESLWDINETDIEYVVDGAVYRLVHANTQKNLHTHS 419

Query: 418 IAAPITKSEWEVSGYGTAEVGDPKDHWVVEVVAQHGSEDESRLHPLTSSFRIKNAELGCY 477
           IAAP+ K  WEVSGYG   +GD KD+WV+E+V Q GSE+ +++HPLT+SFR++N EL CY
Sbjct: 420 IAAPVDKKNWEVSGYGNHTIGDAKDYWVLEIVDQKGSENTTQVHPLTTSFRLRNKELDCY 479

Query: 478 LAQTGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVETHTNEKLPGRPADFKYPKINFIKN 537
           LAQTG HLPEWGFRQ E++C+K+PF+RDKRTWWNVE+H NEKLP  P +FKYP   F+K+
Sbjct: 480 LAQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVESHENEKLP-TPEEFKYPGSGFLKD 538

Query: 538 FIHLNLAMMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLCGWGDDTVKYFLMGSPAST 597
           FIHLNLAMMATNNALVP+ DK D LASSAW+WPTL+VG+RLCGWGD+  KYFL+G+P +T
Sbjct: 539 FIHLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVGLRLCGWGDNNPKYFLLGTPVTT 598

Query: 598 WLSTIAVVGFMGXXXXXXXRWQRQYQDLSDAHDFNLFMMGGFYPLLGWGLHYMPFVIMSR 657
           W S++AV+ FM        RWQRQY D S+  DFNLF+MGGFYP+LGWGLH++PFVIMSR
Sbjct: 599 WASSVAVISFMILFVVLLLRWQRQYNDFSNKDDFNLFLMGGFYPILGWGLHFVPFVIMSR 658

Query: 658 VTYVHHYLPALYFALLILSYLFEAGLKGLNKTKGGQLARTLIYVTYGAIVIYGFYYFSPI 717
           VTYVHHYLPALYFAL+IL+Y+ +A  K   K+K G + R +++    A V+  F+YFSPI
Sbjct: 659 VTYVHHYLPALYFALIILTYIIDATTKRWMKSKCGSIMRLVVFAISIASVVGCFWYFSPI 718

Query: 718 SFGLSGPSSNY 728
           SFG++GP+ NY
Sbjct: 719 SFGMTGPAINY 729

>ACR290W [1337] [Homologous to ScYAL023C (PMT2) - SH; ScYOR321W
           (PMT3) - SH] complement(886525..888792) [2268 bp, 755
           aa]
          Length = 755

 Score = 1058 bits (2735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/732 (68%), Positives = 589/732 (80%), Gaps = 5/732 (0%)

Query: 1   MSATGFDSRISDGTLKQRKVTTVDEIPDIEVDD--RIEEKSVEVNPLLRLESIAMPMIFT 58
           MS TG+  R   G   +R   + ++   ++ +D  ++ E   E NPL +LE+  MP++FT
Sbjct: 13  MSTTGYQ-RHEAGPANKRGKASAEDGAGVQEEDVSKLREVQQERNPLYKLEAFVMPVLFT 71

Query: 59  AVGFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWMAGYNG 118
            +  +TRM+KIG NN VVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSG++AGYNG
Sbjct: 72  LLALYTRMHKIGANNRVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYIAGYNG 131

Query: 119 SWDFPSGEEYPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTILVIFENS 178
           SWDFPSGEEYP+Y+DYVKMR+FNA FSA+C P+AYFT KAIGFSLPTVWLF+ILV+FENS
Sbjct: 132 SWDFPSGEEYPEYIDYVKMRMFNAVFSAMCAPVAYFTGKAIGFSLPTVWLFSILVVFENS 191

Query: 179 YATLGRFILLDSMLLFFTVASMFCFVTFHNQRSKPFSRKWWKWLLLTGVSLGCTISVKMV 238
           YATLGRFILLDSMLLFFTV S + FV FHN+R +PF RKWWKWL   GVSLGCTISVKMV
Sbjct: 192 YATLGRFILLDSMLLFFTVCSFYTFVLFHNERHRPFGRKWWKWLFFLGVSLGCTISVKMV 251

Query: 239 GLFIITLVGIYTVIELWTLLGDKKVSKKAYAGHWLARILCLIIVPFLIFLACFKVHFDLL 298
           GLFII++VGIYTV++LW  L +  +S   +AGH+ AR LCLI+VPF++FL CFK+HF+ L
Sbjct: 252 GLFIISVVGIYTVVDLWNKLSEPNMSVSRFAGHFSARALCLIVVPFMVFLFCFKLHFEFL 311

Query: 299 SHSGTGDANMPSLFQAGLAGSDVGDGPRDIAVGSSIVSIKNQALGGSLLHSHVQGYPEGS 358
           S SGTGDA MPSLFQAGL+GS VG GPRDIAVGSS+VSIKNQALGG+LLHSHVQ YP GS
Sbjct: 312 SVSGTGDAMMPSLFQAGLSGSSVGIGPRDIAVGSSLVSIKNQALGGTLLHSHVQTYPSGS 371

Query: 359 NQQQVTCYGHKDSNNNWLFDRIRPLTPWSEEETEIEFVKPGSSYRLVHPNTGKNLHTHPI 418
           +QQQVT YGH DSNNNW+FDRIR L  WS  ETE EFV+ G  YRLVH NTG+NLHTHPI
Sbjct: 372 SQQQVTTYGHNDSNNNWVFDRIRGLPAWSINETEHEFVQDGRPYRLVHANTGRNLHTHPI 431

Query: 419 AAPITKSEWEVSGYGTAEVGDPKDHWVVEVVAQHGSEDESRLHPLTSSFRIKNAELGCYL 478
            AP++K+ WEVSGYG A+VGDPKD+W++E V+Q   ED+S LH +++SFRIKN E+GCYL
Sbjct: 432 PAPVSKTHWEVSGYGDAQVGDPKDNWIIEFVSQPSDEDKSVLHTISTSFRIKNVEMGCYL 491

Query: 479 AQTGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVETHTNEKLPGRPADFKYPKINFIKNF 538
           AQTG  LPEWGFRQ EVAC+ NPFKRDKRTWWN+ET+ NE+LP  P DFKYPK +F K+F
Sbjct: 492 AQTGPSLPEWGFRQGEVACISNPFKRDKRTWWNIETNVNERLPPMPEDFKYPKTSFFKDF 551

Query: 539 IHLNLAMMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLCGWGDDTVKYFLMGSPASTW 598
           +HLNLAMMATNNALVPDPDKLD LASSAWQWPTLNVGIRLC W DD  KYFL+GSPASTW
Sbjct: 552 VHLNLAMMATNNALVPDPDKLDQLASSAWQWPTLNVGIRLCSWADDVRKYFLIGSPASTW 611

Query: 599 LSTIAVVGFMGXXXXXXXRWQRQYQDLSDAHDFNLFMMGGFYPLLGWGLHYMPFVIMSRV 658
            ST AV  F         +WQRQ      + D N+F+MGG YPLLGWGLHY+PF +M RV
Sbjct: 612 PSTAAVGVFCLITVYYLLKWQRQLVLFQASDDANIFLMGGIYPLLGWGLHYLPFAVMGRV 671

Query: 659 TYVHHYLPALYFALLILSYLFEAGLKGLNKTKGG--QLARTLIYVTYGAIVIYGFYYFSP 716
           TYVHHYLPALYFALLIL+Y+FEA L+   +++    ++   ++Y  Y   +I GFYYF P
Sbjct: 672 TYVHHYLPALYFALLILAYVFEASLRAARQSQKSYWKILVYVVYAVYYCTIICGFYYFYP 731

Query: 717 ISFGLSGPSSNY 728
           I+ G+ GPSSNY
Sbjct: 732 ITVGMEGPSSNY 743

>Scas_643.24
          Length = 769

 Score = 1002 bits (2591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/751 (64%), Positives = 576/751 (76%), Gaps = 28/751 (3%)

Query: 2   SATGFDSRISDGTLKQRKVTTV--------DEIPDIEVDDRIEEKS--VEVNPLLRLESI 51
           + +GF+ +     LK R+  +         D     E D+ ++++    E +PL ++E+ 
Sbjct: 7   AVSGFEPKKEASDLKVRQHNSSAATSKAAKDSASIDEKDENVKKQQPPSEESPLCKVEAW 66

Query: 52  AMPMIFTAVGFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSG 111
            MP++FT + FFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSG
Sbjct: 67  VMPIVFTGLSFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSG 126

Query: 112 WMAGYNGSWDFPSGEEYPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTI 171
           ++AGYNGSWDFPSGEEYPDYLDYVKMR+F ATFS+LC+P+AY TAKAIGFS+P VWLFT 
Sbjct: 127 YLAGYNGSWDFPSGEEYPDYLDYVKMRLFQATFSSLCVPMAYITAKAIGFSIPAVWLFTC 186

Query: 172 LVIFENSYATLGRFILLDSMLLFFTVASMFCFVTFHNQRSKPFSRKWWKWLLLTGVSLGC 231
           LV+FENSYATLGRFILLDSML FFTVAS   F+ FH QR  PFS KWW  L L G +LGC
Sbjct: 187 LVLFENSYATLGRFILLDSMLQFFTVASFMFFILFHTQRKNPFSIKWWTTLALLGFNLGC 246

Query: 232 TISVKMVGLFIITLVGIYTVIELWTLLGDKKVSK-------KAYAGHWLARILCLIIVPF 284
            ISVKMVGLFIITLVGIYTV +LWTLL  +   K       K Y  HW+ARI+CLII+PF
Sbjct: 247 AISVKMVGLFIITLVGIYTVADLWTLLPKQATLKTKKLQAWKVYGCHWIARIVCLIIIPF 306

Query: 285 LIFLACFKVHFDLLSHSGTGDANMPSLFQAGLAGSDVGDGPRDIAVGSSIVSIKNQALGG 344
           L+FL CF++HF LLSHSGTGDANMPSLFQA L GSDVG GPRD+A+GSS VSIKNQALGG
Sbjct: 307 LVFLTCFRIHFALLSHSGTGDANMPSLFQATLDGSDVGKGPRDVALGSSFVSIKNQALGG 366

Query: 345 SLLHSHVQGYPEGSNQQQVTCYGHKDSNNNWLFDRIR--PLTPWSEE-ETEIEFVKPGSS 401
           +LLHSHVQ +P+GSNQQQVT Y + D NN W FDRIR     PWS E ET+IE+V+ G+ 
Sbjct: 367 ALLHSHVQTFPQGSNQQQVTGYAYNDDNNIWFFDRIRIPGNQPWSNETETDIEYVRVGNE 426

Query: 402 YRLVHPNTGKNLHTHPIAAPITKSEWEVSGYGTA-EVGDPKDHWVVEVVAQHGSEDESRL 460
           YRLVH +T KNLH   I AP++K++WEV+G+G   EVGD  D+W++EV+ Q G ED+S +
Sbjct: 427 YRLVHRSTRKNLHADKIVAPVSKNDWEVAGFGYGFEVGDDMDNWIIEVIEQAGDEDKSMI 486

Query: 461 HPLTSSFRIKNAELGCYLAQTGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVETHTNEKL 520
           HPLT++F IK+A LGCYL QT   LPEWGFRQSE+ C     K DKRTWWNVE+H NEKL
Sbjct: 487 HPLTTTFHIKHAVLGCYLTQTLKQLPEWGFRQSEMTCSHKISKNDKRTWWNVESHENEKL 546

Query: 521 PGRPADFKYPKINFIKNFIHLNLAMMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLCG 580
           P   A F YPK NF K+F+ LN  MMATNNALVPD DK D+LAS+AWQWPTLNVG+RLCG
Sbjct: 547 PDPDASFHYPKTNFFKDFLFLNRIMMATNNALVPDSDKYDSLASAAWQWPTLNVGLRLCG 606

Query: 581 WGDDTVKYFLMGSPASTWLSTIAVVGFMGXXXXXXXRWQRQYQDLSDAHDFNLFMMGGFY 640
           W DDTVKYFL+GSPASTW ST++V+  M        RWQRQ  + ++    N FMMG FY
Sbjct: 607 WNDDTVKYFLLGSPASTWPSTVSVIVLMIFIVVLAFRWQRQLTNFANDKALNTFMMGAFY 666

Query: 641 PLLGWGLHYMPFVIMSRVTYVHHYLPALYFALLILSYLFEAGLKGLNKTKGGQLARTLIY 700
           PLL WGLH+MPFVIM+RVTYVHHYLPALYFALL+L+Y FEA    + +   G LA+ + Y
Sbjct: 667 PLLAWGLHFMPFVIMARVTYVHHYLPALYFALLVLAYFFEA----IIRRPKGTLAKYITY 722

Query: 701 VT---YGAIVIYGFYYFSPISFGLSGPSSNY 728
           +T   Y A+VI GF+YFSPISFG+ GPS NY
Sbjct: 723 ITLVLYFAVVIGGFFYFSPISFGMDGPSKNY 753

>YOR321W (PMT3) [5103] chr15 (916025..918286) Mannosyltransferase
           (dolichyl phosphate-D-mannose:protein
           O-D-mannosyltransferase), involved in initiation of
           O-glycosylation [2262 bp, 753 aa]
          Length = 753

 Score =  998 bits (2580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/732 (64%), Positives = 567/732 (77%), Gaps = 6/732 (0%)

Query: 3   ATGFDSRISDGTLKQRKVTTVDEIPD----IEVDDRIEEKSVEVNPLLRLESIAMPMIFT 58
           ATG+  + +D  L  R     +E+ D    ++ D  + +K    + +  L++I MP+IFT
Sbjct: 6   ATGYSEKSTDDDLIWRTPIVKEELEDADNFLKDDAELYDKVKNESAVSHLDTIVMPIIFT 65

Query: 59  AVGFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWMAGYNG 118
            +G FTRMYKIG NNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSG++AGYNG
Sbjct: 66  VLGMFTRMYKIGRNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNG 125

Query: 119 SWDFPSGEEYPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTILVIFENS 178
           SWDFPSGE YPDY+DYVKMR+F A FS+LC+PLAYFT +AIGFS  +VWLFTILVIFENS
Sbjct: 126 SWDFPSGEVYPDYIDYVKMRLFQAMFSSLCVPLAYFTGRAIGFSRLSVWLFTILVIFENS 185

Query: 179 YATLGRFILLDSMLLFFTVASMFCFVTFHNQRSKPFSRKWWKWLLLTGVSLGCTISVKMV 238
           YATLG+FILLDSMLLFFTV+S FC   FH  R  PFS +WW WL LTG++LGC ISVKMV
Sbjct: 186 YATLGKFILLDSMLLFFTVSSYFCLAKFHTMRKSPFSARWWLWLCLTGLNLGCAISVKMV 245

Query: 239 GLFIITLVGIYTVIELWTLLGDKKVSKKAYAGHWLARILCLIIVPFLIFLACFKVHFDLL 298
           GLFII++VGIYT+ ELW LL D+ VS K Y  HWLARI  LII+P  +FL CFK+HFDLL
Sbjct: 246 GLFIISVVGIYTISELWNLLSDRSVSWKVYVNHWLARIFGLIIIPVCVFLLCFKIHFDLL 305

Query: 299 SHSGTGDANMPSLFQAGLAGSDVGDGPRDIAVGSSIVSIKNQALGGSLLHSHVQGYPEGS 358
           S+SG GD+ MPSLFQA L G+ VG GPRD+A+GSSI+SIKNQALGG+LLHSHVQ +PEGS
Sbjct: 306 SNSGPGDSTMPSLFQASLNGTKVGKGPRDVALGSSIISIKNQALGGALLHSHVQPFPEGS 365

Query: 359 NQQQVTCYGHKDSNNNWLFDRIRPLTPWSEEETE-IEFVKPGSSYRLVHPNTGKNLHTHP 417
            QQQVT YG+ D+NN W F RIR + PW++ E + IEFVK G  YRL+H  TGKNLHTH 
Sbjct: 366 EQQQVTVYGYSDANNEWFFQRIRGVEPWTDAENKTIEFVKGGEMYRLMHRLTGKNLHTHE 425

Query: 418 IAAPITKSEWEVSGYGTAEVGDPKDHWVVEVVAQHGSEDESRLHPLTSSFRIKNAELGCY 477
           + API+KSE+EVS YG  ++GD KD+W++E+V Q G ED + LHPL++SFRIKN+ LGCY
Sbjct: 426 VPAPISKSEYEVSAYGDVDLGDYKDNWIIEIVEQVGEEDPTLLHPLSTSFRIKNSILGCY 485

Query: 478 LAQTGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVETHTNEKLPGRPADFKYPKINFIKN 537
           LAQ+G HLPEWGFRQ EV CLK+  KRDKRTWWN+ETH NE+LP +  DF YPK +F +N
Sbjct: 486 LAQSGKHLPEWGFRQGEVVCLKHASKRDKRTWWNIETHENERLP-QGEDFVYPKTSFFRN 544

Query: 538 FIHLNLAMMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLCGWGDDTVKYFLMGSPAST 597
           F+ LN AMMATNNALVP+P+K D +ASSAWQWPTLNVG+RLC W + ++KYFL+GSPAS 
Sbjct: 545 FMQLNSAMMATNNALVPNPEKFDGIASSAWQWPTLNVGVRLCEWSEKSIKYFLLGSPASV 604

Query: 598 WLSTIAVVGFMGXXXXXXXRWQRQYQDLSDAHDFNLFMMGGFYPLLGWGLHYMPFVIMSR 657
           W S+IAV   +        +WQRQ   LSD  + ++F+M  FYPLL W LHYMPFV+MSR
Sbjct: 605 WPSSIAVCALIIHVIFLTLKWQRQCVILSDPVERDVFVMAAFYPLLAWLLHYMPFVVMSR 664

Query: 658 VTYVHHYLPALYFALLILSYLFEAGLKGLNKTKGGQLARTLIYVTYGAIVIYGFYYFSPI 717
           V Y HHYLP LYFAL+ILSY F+   K       G+  R   Y+ YG+IVI GF+YFSP 
Sbjct: 665 VVYAHHYLPTLYFALMILSYYFDMITKRWATRNTGKFLRLGAYIVYGSIVIAGFFYFSPF 724

Query: 718 SFGLSGPSSNYA 729
           SFG+ GP  +YA
Sbjct: 725 SFGMDGPVDDYA 736

>CAGL0F00759g complement(85452..87656) similar to sp|P31382
           Saccharomyces cerevisiae YAL023c PMT2 or sp|P47190
           Saccharomyces cerevisiae YOR321w PMT3, hypothetical
           start
          Length = 734

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/724 (55%), Positives = 512/724 (70%), Gaps = 10/724 (1%)

Query: 12  DGTLKQRKVTTVDEIPDIEVD-------DRIEEKSVEVNPLLRLESIAMPMIFTAVGFFT 64
           D  L+ RK  +V E+  +E D       D  E+K+      LRLE +AMP++FT +    
Sbjct: 2   DSELRARKAPSVSEV-KVEHDHGHDLANDNKEQKASNKQFWLRLERVAMPIVFTLLALLV 60

Query: 65  RMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWMAGYNGSWDFPS 124
           R+Y++ V   V WDEAHFGKFGSYYLRH FYHDVHPPLGKMLVG SG++AGYNGSWDFPS
Sbjct: 61  RLYRLDVVKKVTWDEAHFGKFGSYYLRHTFYHDVHPPLGKMLVGFSGYLAGYNGSWDFPS 120

Query: 125 GEEYPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTILVIFENSYATLGR 184
           G+ YPDY+ +VKMRIF    SALC+P+ YF AKAIGFSLPTVWL TILV+ ENSY TLG+
Sbjct: 121 GQPYPDYVPFVKMRIFQGAVSALCVPMTYFAAKAIGFSLPTVWLTTILVLCENSYTTLGK 180

Query: 185 FILLDSMLLFFTVASMFCFVTFHNQRSKPFSRKWWKWLLLTGVSLGCTISVKMVGLFIIT 244
            ILLDS+LLFFTVA+  CF  FH+   KPFS +W  WL LTG S+GC ISVKMVGLF+IT
Sbjct: 181 LILLDSLLLFFTVATFMCFQKFHSYHRKPFSFQWCLWLFLTGASMGCAISVKMVGLFVIT 240

Query: 245 LVGIYTVIELWTLLGDKKVSKKAYAGHWLARILCLIIVPFLIFLACFKVHFDLLSHSGTG 304
           LVGI+T++ELWTLLGDK ++ K YA HW+ARI+CLI+ PFLIF  CFK+HF LL  SG G
Sbjct: 241 LVGIHTIVELWTLLGDKNITWKRYANHWIARIICLIVTPFLIFALCFKIHFALLWGSGPG 300

Query: 305 DANMPSLFQAGLAGSDVGDGPRDIAVGSSIVSIKNQALGGSLLHSHVQGYPEGSNQQQVT 364
           D  MP  FQA L G+++G GPRD+++GS+I +++N    G+ LHSH Q YPEGS Q+QVT
Sbjct: 301 DHEMPPRFQAALNGTNIGQGPRDVSIGSTI-TLQNMKPRGAYLHSHHQTYPEGSKQRQVT 359

Query: 365 CYGHKDSNNNWLFDRIRPLTPWSEEETEIEFVKPGSSYRLVHPNTGKNLHTHPIAAPITK 424
           CY + D NN+W+  R      W   +TE E ++ G + RLVH  TG NLH+H + AP+ K
Sbjct: 360 CYNYVDGNNDWIVYRPHGKPIWHVNDTEHEAIRNGDTIRLVHKGTGSNLHSHQVEAPLNK 419

Query: 425 SEWEVSGYGTAEVGDPKDHWVVEVVAQHGSEDESRLHPLTSSFRIKNAELGCYLAQTGAH 484
            ++EVSGYG   +GD KDHWVVE++   G+ED++ +HP+T+  R ++A L CYLAQ+  H
Sbjct: 420 LDYEVSGYGNLTIGDLKDHWVVEIIKDDGNEDKNLIHPITTHVRFRHAVLNCYLAQSNEH 479

Query: 485 LPEWGFRQSEVACLKNPFKRDKRTWWNVETHTNEKLPGRPADFKYPKINFIKNFIHLNLA 544
           LPEWGF Q+EV C++ P K D +T W V+THT+  L   P +F YP+ +F  +F  LN  
Sbjct: 480 LPEWGFSQAEVRCIREPEKNDIKTMWIVDTHTHPNLEA-PENFIYPRRSFWSDFFELNKR 538

Query: 545 MMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLCGWGDDTVKYFLMGSPASTWLSTIAV 604
           MMATNNAL    DK D L S +W+WPTL   +R+  W ++  +Y L+GSPASTW ST+AV
Sbjct: 539 MMATNNALTVSKDKHDYLRSESWEWPTLYRSLRINSWNENDTRYLLLGSPASTWPSTVAV 598

Query: 605 VGFMGXXXXXXXRWQRQYQDLSDAHDFNLFMMGGFYPLLGWGLHYMPFVIMSRVTYVHHY 664
           +  +        +W RQ Q   + HD  LF+ GG YPLLGW LH+ PFVIM RV YVHHY
Sbjct: 599 LFLVFALLYKVLKWNRQMQIFQNEHDEELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHY 658

Query: 665 LPALYFALLILSYLFEAGLKGLNKTKGGQLARTLIYVTYGAIVIYGFYYFSPISFGLSGP 724
           LPALYFAL +L+Y+F+AGL+  NKTK  ++ +  IY  Y ++VI GF  F+P S+G++G 
Sbjct: 659 LPALYFALFVLAYIFDAGLRYYNKTKTQRIIKFCIYAGYMSVVIGGFILFAPFSYGMTGK 718

Query: 725 SSNY 728
             NY
Sbjct: 719 LENY 722

>Kwal_33.15471
          Length = 755

 Score =  696 bits (1797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/754 (47%), Positives = 486/754 (64%), Gaps = 38/754 (5%)

Query: 1   MSATGFDSRISDGTLKQR-KVTTVDEI---PDIEVDDRIEEK-----------SVEVNPL 45
           MS++GF  + S+  L++R K  T +E+   P+  +D  ++EK           S+  N L
Sbjct: 1   MSSSGFLPKSSELNLRERQKNFTENELSIPPNESLDSDVDEKNSKNKTKFASSSISRNVL 60

Query: 46  LRLESIAMPMIFTAVGFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKM 105
           L++  +   ++ T + F+ R  KI  N+ VVWDEAHFGKFGSYY+++EFYHDVHPPLGKM
Sbjct: 61  LQVTGV---ILLTILSFYVRFNKIDANDEVVWDEAHFGKFGSYYIKNEFYHDVHPPLGKM 117

Query: 106 LVGLSGWMAGYNGSWDFPSGEEYPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPT 165
           L+ LS ++AG+NG + F SG  YP  ++Y  MR FNATF ALC P+   TAK +GFS   
Sbjct: 118 LIALSQYLAGFNGDFAFDSGAPYPSGMNYKFMRQFNATFGALCAPIMLLTAKNLGFSNLG 177

Query: 166 VWLFTILVIFENSYATLGRFILLDSMLLFFTVASMFCFVTFHNQRSKPFSRKWWKWLLLT 225
            +   ++V  E S+  L +FILLDSMLLFFT  +  C    H  R++PF+R+W  W+LL 
Sbjct: 178 SYFLGMMVALELSFVALSKFILLDSMLLFFTATTFHCITELHKVRNRPFTRRWSLWMLLL 237

Query: 226 GVSLGCTISVKMVGLFIITLVGIYTVIELWTLLGDKKVSKKAYAGHWLARILCLIIVPFL 285
           G+S+GC  SVK VGLFI  + GIYTV++L++   DK++S+ +Y  HWL RI+ LI++PFL
Sbjct: 238 GLSVGCVCSVKWVGLFITVIAGIYTVVDLFSYHYDKELSRLSYYKHWLVRIIDLIVIPFL 297

Query: 286 IFLACFKVHFDLLSHSGTGDANMPSLFQAGLAGSDVGDGPRDIAVGSSIVSIKNQALGGS 345
           ++L CFK+HF +L  SGTGDA   +LFQ  L G+ +  GPR++A GS  V+I++  L  +
Sbjct: 298 VYLFCFKIHFAILHKSGTGDAATNTLFQVNLDGNKIEIGPRNVAFGSE-VTIRSHGLSPN 356

Query: 346 LLHSHVQGYPEGSNQQQVTCYGHKDSNNNWLFDRIRPLTPWSEE----ETEIEFVKPGSS 401
           LLHSHVQ YP GS Q QVT YGH D NNNW+    R     + E    + + + +  GS 
Sbjct: 357 LLHSHVQLYPFGSGQHQVTGYGHSDDNNNWVIKYPREGGLKAAENGLQDVQSDLLTEGSE 416

Query: 402 YRLVHPNTGKNLHTHPIAAPITKSEWEVSGYGTAEVGDPKDHWVVEVVAQHGS------- 454
            RLVH NTG NLH+H I A ++K  +EVSGYG  E+GD KD WVVE+V Q  S       
Sbjct: 417 IRLVHKNTGANLHSHEIPAHVSKGSFEVSGYGDEEIGDIKDDWVVEIVQQLDSDNSSFPK 476

Query: 455 EDESRLHPLTSSFRIKNAELGCYLAQTGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVET 514
           ED S LHP+++SFR+++  LGCYLA TG   P WGF+Q+E+ C     KRDK TWWN+E 
Sbjct: 477 EDPSLLHPISTSFRLRHKYLGCYLATTGLAYPAWGFKQAEIVCKHTWMKRDKSTWWNIED 536

Query: 515 HTNEKLPGRPADFKYPKINFIKNFIHLNLAMMATNNALVPDPDKLDNLASSAWQWPTLNV 574
           H N  L  +   +  PK  F  +FI +N AM ++NNALVPD DK D+LAS AWQWPTL+V
Sbjct: 537 HWNPNLE-KSEGYVPPKSKFWPDFILINFAMASSNNALVPDEDKYDSLASEAWQWPTLHV 595

Query: 575 GIRLCGWGDDTVKYFLMGSPASTWLSTIAVVGFMGXXXXXXXRWQRQYQDLSDAHDFNLF 634
           G+R+C W +DTVKYFL+GSP  TWLST+++  F+        +WQRQ  +L+  ++ +  
Sbjct: 596 GLRMCSWSNDTVKYFLLGSPFQTWLSTLSLFIFVLILLRLAFKWQRQTVNLT-GNELSEI 654

Query: 635 MMGGFYPLLGWGLHYMPFVIMSRVTYVHHYLPALYFALLILSYLFEAGLKGLNKTKGGQL 694
            M G  P L W LHY+PFV+M RVTYVHHY+PALYFA+L+  ++ E  L           
Sbjct: 655 SMQGVLPFLAWLLHYLPFVLMGRVTYVHHYVPALYFAILVFGFVLETCL------PKRYF 708

Query: 695 ARTLIYVTYGAIVIYGFYYFSPISFGLSGPSSNY 728
              ++Y    A  IY +  FSPI+ G+ GP+ N+
Sbjct: 709 LNYIVYTALYAGCIYIYVLFSPIAQGIDGPAHNF 742

>KLLA0F21978g 2042656..2044929 similar to sp|P42934 Saccharomyces
           cerevisiae YGR199w PMT6 putative mannosyltransferase,
           start by similarity
          Length = 757

 Score =  672 bits (1734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/747 (46%), Positives = 473/747 (63%), Gaps = 30/747 (4%)

Query: 3   ATGFDSRISDGTLKQRKV----TTV--DEIPDIE-VDDRIEE---KSVEVNPLLRLESIA 52
           ++GF    SD  L++RK     T V  D + D E V+D++ +    S+  N   R  +  
Sbjct: 5   SSGFLPNSSDLRLRERKAQFDGTEVLEDFLRDNEPVEDKLVKPLKSSIFSNRNHRFHTYV 64

Query: 53  MPMIFTAVGFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGW 112
             ++ T V F  R YKI  +N VVWDEAHFGKFGSYYL+HEFYHDVHPPLGKML+GL  +
Sbjct: 65  C-LLLTLVSFVLRFYKIDRSNIVVWDEAHFGKFGSYYLKHEFYHDVHPPLGKMLIGLGEY 123

Query: 113 MAGYNGSWDFPSGEEYPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTIL 172
           +AG++G++DF S   YPD +++  MR FNA FS+LC PLA++ A+ + FS+PTV+L  ++
Sbjct: 124 LAGFDGNFDFSSNSSYPDEVNFKIMRQFNAIFSSLCTPLAFYAARNLNFSMPTVYLVALM 183

Query: 173 VIFENSYATLGRFILLDSMLLFFTVASMFCFVTFHNQRSKPFSRKWWKWLLLTGVSLGCT 232
           V FE+SY  LG+F+LLDSMLLFFTV + +C    +  R    + KW  W+L TG S+GC 
Sbjct: 184 VCFEHSYIVLGKFVLLDSMLLFFTVLTFYCLSQLYRLRECQLTVKWLAWILATGFSIGCV 243

Query: 233 ISVKMVGLFIITLVGIYTVIELWTLLGDKKVSKKAYAGHWLARILCLIIVPFLIFLACFK 292
            SVK VGL I  LVGIYTV EL+ L  D+ +SK  Y GHW+ RI  LI+ P ++++  FK
Sbjct: 244 CSVKWVGLLITALVGIYTVSELYCLHCDRSLSKTKYLGHWIVRISALIVFPLILYMVFFK 303

Query: 293 VHFDLLSHSGTGDANMPSLFQAGLAGSDVGDGPRDIAVGSSIVSIKNQALGGSLLHSHVQ 352
           +HF LL  +GTGD++  SLFQA L G+ +   PRDIA GS I S+++  L   LLHSH Q
Sbjct: 304 IHFTLLYKTGTGDSSTHSLFQANLEGAQIKPSPRDIAFGSCI-SLRSHGLSPGLLHSHPQ 362

Query: 353 GYPEGSNQQQVTCYGHKDSNNNWLFDRIRPLTPWSEEET----EIEFVKPGSSYRLVHPN 408
            YP+GSNQ+QVT Y ++D NNNW+    R     S EE      I F+K G   RLVH  
Sbjct: 363 TYPDGSNQRQVTGYSYRDGNNNWIVKYSRSSGKASAEERVYSDNILFLKDGDLLRLVHEK 422

Query: 409 TGKNLHTHPIAAPITKSEWEVSGYGTAEVGDPKDHWVVEVVAQ-----HGSEDESRLHPL 463
           T  NLHTH I + ++K  +EVSGYG   VGD KD W++EVV Q     +  E+++ +HPL
Sbjct: 423 TKNNLHTHQIPSHVSKGHYEVSGYGNDAVGDLKDDWIIEVVEQLPTGNNTMENKALIHPL 482

Query: 464 TSSFRIKNAELGCYLAQTGAHLPEWGFRQSEVACLKNPF-KRDKRTWWNVETHTNEKLPG 522
           T+SFR++N ELGCYLA TG   P WG+ Q+E+ C K P+ +RDK TWWNVE H N  L  
Sbjct: 483 TTSFRLRNKELGCYLAATGLSYPGWGYNQAEIVC-KYPWNQRDKSTWWNVEDHINSNL-H 540

Query: 523 RPADFKYPKINFIKNFIHLNLAMMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLCGWG 582
               F  P   F  +F+ +N AM A+NNAL+PD DK D +AS  W+WP L  G+R+C W 
Sbjct: 541 IDQTFTPPPTKFWTDFVVINFAMAASNNALIPDLDKYDRIASEPWEWPILYKGLRMCNWN 600

Query: 583 DDTVKYFLMGSPASTWLSTIAVVGFMGXXXXXXXRWQRQYQDLSDAHDFNLFMMGGFYPL 642
           D TVKY+L+GSP +TWLST A+   +        R+QRQ   L++   +NLF   G    
Sbjct: 601 DKTVKYYLLGSPFNTWLSTAALPILLILVSMELFRYQRQSLQLNEKKAWNLFACAGL-SF 659

Query: 643 LGWGLHYMPFVIMSRVTYVHHYLPALYFALLILSYLFEAGLKGLNKTKGGQLARTLIYVT 702
           +GW LHY PF IM RVTY+HHY+PAL+FA++  +Y+ +  L   N+       + + Y +
Sbjct: 660 IGWLLHYAPFFIMGRVTYIHHYVPALFFAIMTFAYVVDFALANSNR-----YLKVVAYSS 714

Query: 703 YGAIVIYGFYYFSPISFGLSGPSSNYA 729
             A   + ++YF+P   G+  P+  Y 
Sbjct: 715 LYAGCTFTYWYFAPFCQGMPEPNLTYV 741

>YGR199W (PMT6) [2149] chr7 (897505..899784) Protein with similarity
           to O-mannosyltransferases Pmt1p, Pmt2p, Pmt3p, Pmt4p and
           Pmt5p [2280 bp, 759 aa]
          Length = 759

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/749 (45%), Positives = 478/749 (63%), Gaps = 31/749 (4%)

Query: 3   ATGFDS-RISDGTLKQRKVT----TVDEIPDIEVD--DRIEEK-----SVEVNPLLRLES 50
            TGF S    D  L++R V        +I D ++D  +++EEK     + E   L  L  
Sbjct: 6   GTGFSSIDTEDENLRERYVNQPKANASDIQDEQLDCFEQLEEKHRTKKNEEYTALKILRD 65

Query: 51  IAMPMIFTAVGFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLS 110
           +  P++ T   F+ R   I  NN+VVWDEAHFGKFGSYY++HE+YHDVHPPLGKML+ LS
Sbjct: 66  VIGPLLLTITSFYLRFQHIDQNNYVVWDEAHFGKFGSYYIKHEYYHDVHPPLGKMLIALS 125

Query: 111 GWMAGYNGSWDFPSGEEYPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFT 170
            WMAG++G +DF S   YP+ +++  MR FNATF ALC P+A+FTAK +GF+  TV+L  
Sbjct: 126 EWMAGFDGQFDFSSNNAYPENVNFKLMRQFNATFGALCTPVAFFTAKWMGFNYFTVYLIA 185

Query: 171 ILVIFENSYATLGRFILLDSMLLFFTVASMFCFVTFHNQRSKPFSRKWWKWLLLTGVSLG 230
            +V  E+SY  L +FILLDSMLLFF++ +  C +  +  R +  ++KW  W+LLTG+S+G
Sbjct: 186 TMVTLEHSYIVLSKFILLDSMLLFFSMTTFACMIKLYTLRKQQMTKKWSLWMLLTGLSIG 245

Query: 231 CTISVKMVGLFIITLVGIYTVIELWTLLGDKKVSKKAYAGHWLARILCLIIVPFLIFLAC 290
           C  SVK VGLFI  +VG+YT IEL+ L  DK++ +  Y  HWL RI+ LI++PFLI+L C
Sbjct: 246 CVCSVKWVGLFITVVVGLYTCIELFLLYCDKELPRIKYYKHWLIRIINLIVIPFLIYLYC 305

Query: 291 FKVHFDLLSHSGTGDANMPSLFQAGLAGSDVGDGPRDIAVGSSIVSIKNQALGGSLLHSH 350
           FK+HF LL  SGTGD+   +LFQ  L G+ +  GPRD+A GS + +I++  L  +LLHSH
Sbjct: 306 FKIHFVLLYKSGTGDSTTNTLFQINLEGTQIEAGPRDVAFGSEL-TIRSHGLSPNLLHSH 364

Query: 351 VQGYPEGSNQQQVTCYGHKDSNNNWLFDRIR----PLTPWSEEETEIEFVKPGSSYRLVH 406
           +Q YPEGS Q+Q+T YG  DSNN W F+  R     L        +I  +  G   RL H
Sbjct: 365 IQVYPEGSGQRQITGYGFADSNNVWKFEFSRSSGLELDQNGTLNGKIIPITDGVEVRLSH 424

Query: 407 PNTGKNLHTHPIAAPITKSEWEVSGYGTAEVGDPKDHWVVEVVAQ-------HGSEDESR 459
            NTG NLH+H + + +++  +EVSGYG+  VGD KD W+VE+V Q       + +E+ + 
Sbjct: 425 KNTGSNLHSHDVPSHVSRGNYEVSGYGSQSVGDEKDDWIVEIVKQMDSPNPVYSNENSTI 484

Query: 460 LHPLTSSFRIKNAELGCYLAQTGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVETHTNEK 519
           LHP+++ FR+++  LGCYLA TG   P WGF+Q+E+ C  +  +RDK TWWNVE H N  
Sbjct: 485 LHPVSTFFRLRHKVLGCYLASTGLTYPAWGFKQAEIVCKDSWSRRDKSTWWNVEDHWNHN 544

Query: 520 LPGRPADFKYPKINFIKNFIHLNLAMMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLC 579
           L     D+  PK NF  +FI  N AM ++NNALVPD DK D+L+S AW+WPTL+ G+R+C
Sbjct: 545 LE-TAEDYVPPKSNFWTDFILTNFAMASSNNALVPDEDKYDSLSSDAWEWPTLHKGLRMC 603

Query: 580 GWGDDTVKYFLMGSPASTWLSTIAVVGFMGXXXXXXXRWQRQYQDLSDAHDFNLFMMGGF 639
            W     +Y+LMGSP +TW+ST++++ F         RW+RQ   LSD   + +  + G 
Sbjct: 604 SWAGYITRYYLMGSPFNTWISTVSLIIFPFIILFILYRWRRQTLYLSDDQIWQI-TIQGI 662

Query: 640 YPLLGWGLHYMPFVIMSRVTYVHHYLPALYFALLILSYLFEAGLKGLNKTKGGQLARTLI 699
           +P + W  HY+PF +M RVTYVHHY+PALYFA+L+  ++ +  L     T+   + +  I
Sbjct: 663 FPFISWMTHYLPFAMMGRVTYVHHYVPALYFAMLVFGFVLDFTL-----TRVHWMVKYPI 717

Query: 700 YVTYGAIVIYGFYYFSPISFGLSGPSSNY 728
           Y++     IY +  F+PI  G+ G  + Y
Sbjct: 718 YLSLFGGCIYIYNLFAPICQGMHGDKAEY 746

>CAGL0K00979g complement(97306..99498) similar to sp|P42934
           Saccharomyces cerevisiae YGR199w
           Dolichyl-phosphate-mannose--protein mannosyltransferase
           6, hypothetical start
          Length = 730

 Score =  615 bits (1587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/733 (45%), Positives = 463/733 (63%), Gaps = 31/733 (4%)

Query: 10  ISDGTLKQRKVTTVDEIPDIEVDDRIEEKSVEVNPLLRLESIAMPMIFTAVGFFTRMYKI 69
           + D    ++   T +  PD     ++  ++       +   +   + FT + F  R   I
Sbjct: 2   VEDKLADEKTTETKENTPD---QTKVVPRACN---FAKYRDLIACLGFTVLSFVLRFQGI 55

Query: 70  GVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWMAGYNGSWDFPSGEEYP 129
             NN VVWDEAHFGKFGSYY+RHEFYHDVHPPLGKML+ LS W+AG++G +DF SG +YP
Sbjct: 56  DKNNSVVWDEAHFGKFGSYYIRHEFYHDVHPPLGKMLIALSEWLAGFDGEFDFESGHQYP 115

Query: 130 DYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTILVIFENSYATLGRFILLD 189
           D +++  MR FNATF ALC P+ +FTAK +  S P V+L T++V  E+S+  L +FILLD
Sbjct: 116 DGVNFKFMRQFNATFGALCTPVVFFTAKTMNLSWPIVYLVTLMVTLEHSFIALSKFILLD 175

Query: 190 SMLLFFTVASMFCFVTFHNQRSKPFSRKWWKWLLLTGVSLGCTISVKMVGLFIITLVGIY 249
           SMLLFFT  +  C V     R    +R+W  WLLLTG+S+GC  SVK VGLFI  +VG++
Sbjct: 176 SMLLFFTATTFACMVKLIQLRGCQLTRQWLWWLLLTGLSIGCVCSVKWVGLFITLVVGLF 235

Query: 250 TVIELWTLLGDKKVSKKAYAGHWLARILCLIIVPFLIFLACFKVHFDLLSHSGTGDANMP 309
           T+I+L     +KK S+K Y  HW+ RI+ LII+PFL++L CFK+HF LL  SGTGDA+  
Sbjct: 236 TIIDLLEHYWNKKESRKIYYKHWILRIINLIIIPFLVYLFCFKIHFLLLYKSGTGDASTN 295

Query: 310 SLFQAGLAGSDVGDGPRDIAVGSSIVSIKNQALGGSLLHSHVQGYPEGSNQQQVTCYGHK 369
           SLFQ  L G+ + + PR +  GS  V+I++  L  +LLHSHVQ YP+GS Q+QVT YGH 
Sbjct: 296 SLFQVNLEGTQIQNSPRTVMYGSE-VTIRSHGLSPNLLHSHVQLYPDGSRQRQVTGYGHS 354

Query: 370 DSNNNWLFDRIRPLTPWSEEET-----EIEFVKPGSSYRLVHPNTGKNLHTHPIAAPITK 424
           D NNNW+    R    + +E+      E+  V+ G + RL H   G NLH+H I++ ++K
Sbjct: 355 DGNNNWMIKFGRTTGRYLDEDNKRLNGELVPVRDGDTIRLFHVRMGCNLHSHTISSHVSK 414

Query: 425 SEWEVSGYGTAEVGDPKDHWVVEVVAQ-------HGSEDESRLHPLTSSFRIKNAELGCY 477
             +EVSGYG+ EVGD KD W++E++ Q        G ED   LHP+++ FR+++ +LGCY
Sbjct: 415 GNYEVSGYGSEEVGDEKDDWIIEIMEQLDSANTNFGKEDNEVLHPISTMFRLRHKDLGCY 474

Query: 478 LAQTGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVETHTNEKLPGRPADFKY--PKINFI 535
           LA TG   P WGF Q+E+ C  +  KRDK TWWNVE H N++L     D +Y  PK  F 
Sbjct: 475 LASTGLSYPTWGFHQAEIVCKYSWGKRDKSTWWNVEDHWNDQL---VVDEEYVPPKSKFW 531

Query: 536 KNFIHLNLAMMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLCGWGDDTVKYFLMGSPA 595
            +FI +N AM ++NNALVPD DK D LAS AW+WP L+ G+RLCGW    V+Y+L+GSP 
Sbjct: 532 TDFILINFAMASSNNALVPDEDKYDYLASKAWEWPILHKGLRLCGWSSAGVRYYLLGSPF 591

Query: 596 STWLSTIAVVGFMGXXXXXXXRWQRQYQDLSDAHDFNLFMMGGFYPLLGWGLHYMPFVIM 655
           +TWLS+IA++  +        +W+RQ   +++   + L      +P L W  ++MP+V+M
Sbjct: 592 NTWLSSIALLVNILLGMVVAIKWRRQSIVINEESCWKL-FTLLLFPFLAWLANFMPYVMM 650

Query: 656 SRVTYVHHYLPALYFALLILSYLFEAGLKGLNKTKGGQLARTLIYVTYGAIVIYGFYYFS 715
            RVTYVHHY+PALYFA++    + E  L      K      +++  TY    IY  +YF+
Sbjct: 651 GRVTYVHHYMPALYFAIIAFGSITEYLLADYCTVKAFLAFLSMVGCTY----IY--WYFA 704

Query: 716 PISFGLSGPSSNY 728
           PI  GL G  S+Y
Sbjct: 705 PICQGLHGIGSHY 717

>Scas_408.1*
          Length = 391

 Score =  362 bits (930), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 186/391 (47%), Positives = 265/391 (67%), Gaps = 19/391 (4%)

Query: 1   MSATGFDSRIS----DGTLKQRKVTTVD----EIPDIEVDDRIEEKS-------VEVNPL 45
           M+    DS +S    D +L++RK  T      +I   E DD  + KS        +++  
Sbjct: 1   MADISKDSTVSIHPTDSSLRERKAVTQTSTELDIKQHEPDDSKQNKSRYPYVTTAKISSS 60

Query: 46  LRLESIAMPMIFTAVGFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKM 105
           +R  S   P++ T + F  R + IG NNHVVWDEAHFGKFGSYY+ HEFYHDVHPPLGKM
Sbjct: 61  MR--SYIGPLLLTILSFQLRFHDIGKNNHVVWDEAHFGKFGSYYITHEFYHDVHPPLGKM 118

Query: 106 LVGLSGWMAGYNGSWDFPSGEEYPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPT 165
           L+ LS ++AG++G ++F S E YP+ ++Y+ MR FNA F ALC+P+  FT +++GF+  T
Sbjct: 119 LIALSEYLAGFDGHFNFDSNEAYPEEVNYIFMRQFNAMFGALCVPVTLFTTRSMGFNWLT 178

Query: 166 VWLFTILVIFENSYATLGRFILLDSMLLFFTVASMFCFVTFHNQRSKPFSRKWWKWLLLT 225
            +L T++V  E+SY  L +FILLDS+LLFFT+ +  C V  +  + +  +++W  W+LLT
Sbjct: 179 SYLVTLMVTLEHSYIVLSKFILLDSILLFFTLTTFACMVKLYTLKKRQLTKQWSLWMLLT 238

Query: 226 GVSLGCTISVKMVGLFIITLVGIYTVIELWTLLGDKKVSKKAYAGHWLARILCLIIVPFL 285
           G+S+GC  SVK VGLFI  +VG++T++EL+T   DK + +  Y  HW+ RI+ LII+PFL
Sbjct: 239 GLSVGCVCSVKWVGLFITIIVGLFTIMELFTHHYDKTLPRVKYYKHWMIRIIDLIIIPFL 298

Query: 286 IFLACFKVHFDLLSHSGTGDANMPSLFQAGLAGSDVGDGPRDIAVGSSIVSIKNQALGGS 345
           I++ CFK+HF LL  SGTGD+   +LFQ  L G+ + +GPRD+  GS  V+I++  L  +
Sbjct: 299 IYMFCFKIHFTLLYKSGTGDSATNTLFQVNLEGTTIENGPRDVMYGSE-VTIRSHGLSPN 357

Query: 346 LLHSHVQGYPEGSNQQQVTCYGHKDSNNNWL 376
           LLHSHVQ YP+GS Q+Q+T YGH DS ++WL
Sbjct: 358 LLHSHVQLYPDGSRQRQITGYGHSDS-SSWL 387

>CAGL0L07216g complement(799529..802105) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase or sp|P52867 Saccharomyces
           cerevisiae YDL093w, hypothetical start
          Length = 858

 Score =  377 bits (968), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 243/721 (33%), Positives = 377/721 (52%), Gaps = 47/721 (6%)

Query: 23  VDEIPDIEV---------DDRIEEKSVEVNPLLRLESIAMPMIFTAVGFFTRMYKIGVNN 73
           VD +P++++         D   +  + ++  +  L+   M  I   +  F R+YK+   +
Sbjct: 24  VDPVPEVKINKGPLRPYIDFEGDYDTAKLRTVKTLKEKLMVAILLIITAFVRLYKLSWPS 83

Query: 74  HVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWMAGYNGSWDF-PSGEEYPDYL 132
            VV+DE HFG F S Y++ +F+ DVHPPL KML    G +AGY G + F P GEEYPD +
Sbjct: 84  SVVFDEVHFGGFASKYIKGDFFMDVHPPLAKMLFAGVGALAGYTGDFSFKPIGEEYPDTV 143

Query: 133 DYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTILVIFENSYATLGRFILLDSML 192
            +  MR+F+A+     + + Y T +A G  L   +LF ++  FENS+ T+ R+ILLD+ L
Sbjct: 144 PFYTMRLFSASLGVFTVLMLYLTLRASGVRLGVAYLFALVFAFENSFVTISRYILLDAPL 203

Query: 193 LFFTVASMFCFVTFHNQRSKPFSRKWWKWLLLTGVSLGCTISVKMVGLFIITLVGIYTVI 252
           + F  A+++ +       +  F  +  K LL TG++LG   S K VGLF +  VG+  V 
Sbjct: 204 ICFIAAAVYSYKKSELYPTNSF--RALKSLLATGIALGLASSSKWVGLFTVAWVGLLCVW 261

Query: 253 ELWTLLGDKKVSKKAYAGHWLARILCLIIVPFLIFLACFKVHFDLLSHSGTGDANMPSLF 312
           +LW ++GD   S        + +++ L+ VP L+++A F VHF  L H G+G +  PS F
Sbjct: 262 KLWFMIGDLNKSPCTIVKAAIGKLVLLLGVPILLYVAFFYVHFQALIHDGSGSSFFPSEF 321

Query: 313 QAGLAGSDV-GDGPRDIAVGSSIVSIKNQALGGSLLHSHVQGYPEGSNQQQVTCYGHKDS 371
           +A L G+ +  D   D+ VG SIV++K+ +  G  LHSH   YP GS QQQ+T Y   D 
Sbjct: 322 RATLEGNQIPSDVVYDVGVG-SIVTLKHLSTEGGYLHSHSHAYPTGSEQQQITLYPFLDD 380

Query: 372 NNNWLFDRIRPLTPWSEEETEIEFVKPGSSYRLVHPNTGKNLHTHPIAAPITKS-EW--E 428
           NN W+ +R     P +  +  I  +K G S  L+H  TG  LH+H    P+++S +W  E
Sbjct: 381 NNKWVIERSH--LPGASLKDFIG-LKNGESISLLHLATGVRLHSHDHKPPVSESADWQKE 437

Query: 429 VSGYG-TAEVGDPKDHWVVEV--------VAQHGSEDESRLHPLTSSFRIKNAELGCYLA 479
           VSGYG     GD  DHW +E+        +AQH       +  + + F++++A  GCYL 
Sbjct: 438 VSGYGYLGFTGDINDHWTIEIDQSSSKPGIAQH------EVRAIDTKFKLRHAT-GCYLF 490

Query: 480 QTGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVETHTNEKLPGRPADFKYPKINFIKNFI 539
                LP+WGF Q EV C      + +   W +E   N +LP       Y  +NFI+ FI
Sbjct: 491 SHEVKLPKWGFDQQEVTCATQ--GKPELLLWYIEGSENPQLPENTPRISYKPMNFIEKFI 548

Query: 540 HLNLAMMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLCGWGDDTVKYFLMGSPASTWL 599
             +  M   N  L           S A++WP +  GI    WG+   K +L+G+  + W 
Sbjct: 549 ENHKKMWKINKGLT----GTHYYESLAYEWPLMRRGIGY--WGEHHRKIYLLGNAVTWWA 602

Query: 600 STIAVVGFMGXXXXXXXRWQRQYQDLSDAHDFNLFMMGGFYPLLGWGLHYMPFVIMSRVT 659
            +  ++ +          +      L D +  N F +   + LLG+ +HY+PF +M R  
Sbjct: 603 VSAFILVYAAILAFEAGSFLVGKPILQDKNVIN-FHVQVLHYLLGFAIHYVPFFLMGRQL 661

Query: 660 YVHHYLPALYFALLILSYLFEAGLKGLNKTKGGQLARTLIYVTYGAIVIYGFYYFSPISF 719
           ++HHYLPA YF +L L++ F+  +  + K +  Q A  L+ + + A  IY F+  SPI++
Sbjct: 662 FLHHYLPAYYFGILALAHAFDIIITFVCKNR-KQAAYALL-ILFTAASIYFFHAHSPIAY 719

Query: 720 G 720
           G
Sbjct: 720 G 720

>YDL095W (PMT1) [773] chr4 (287059..289512) Mannosyltransferase
           (dolichyl phosphate-D-mannose:protein
           O-D-mannosyltransferase), first step in O-glycosylation
           [2454 bp, 817 aa]
          Length = 817

 Score =  355 bits (910), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 237/721 (32%), Positives = 370/721 (51%), Gaps = 36/721 (4%)

Query: 18  RKVTTVDEIPDIEVDDR------IEEKSVEVNPLLRLESIAMPMIFTAVGFFT---RMYK 68
           ++V   D +P++++         + + S E+  L  + ++   ++   +  FT   R++ 
Sbjct: 8   KRVEQDDPVPELDIKQGPVRPFIVTDPSAELASLRTMVTLKEKLLVACLAVFTAVIRLHG 67

Query: 69  IGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWMAGYNGSWDFPS-GEE 127
           +   + VV+DE HFG F S Y+R  ++ DVHPPL KML      + G+ G +DF + G+ 
Sbjct: 68  LAWPDSVVFDEVHFGGFASQYIRGTYFMDVHPPLAKMLYAGVASLGGFQGDFDFENIGDS 127

Query: 128 YPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTILVIFENSYATLGRFIL 187
           +P    YV MR F+A+  AL + L Y T +  G  +    +  I    ENSY T+ R+IL
Sbjct: 128 FPSTTPYVLMRFFSASLGALTVILMYMTLRYSGVRMWVALMSAICFAVENSYVTISRYIL 187

Query: 188 LDSMLLFFTVASMFCFVTFHNQRSKPFSRKWWKWLLLTGVSLGCTISVKMVGLFIITLVG 247
           LD+ L+FF  A+++ F  +    +   S   +K LL TG++LG   S K VGLF +T VG
Sbjct: 188 LDAPLMFFIAAAVYSFKKYEMYPAN--SLNAYKSLLATGIALGMASSSKWVGLFTVTWVG 245

Query: 248 IYTVIELWTLLGDKKVSKKAYAGHWLARILCLIIVPFLIFLACFKVHFDLLSHSGTGDAN 307
           +  +  LW ++GD   S K+      A++  L+ VPF ++L  F +HF  L+  G G + 
Sbjct: 246 LLCIWRLWFMIGDLTKSSKSIFKVAFAKLAFLLGVPFALYLVFFYIHFQSLTLDGDGASF 305

Query: 308 MPSLFQAGLAGSDVGDG-PRDIAVGSSIVSIKNQALGGSLLHSHVQGYPEGSNQQQVTCY 366
               F++ L  + +      D+ +G SI+S+++ +  G  LHSH   YP GS QQQ T Y
Sbjct: 306 FSPEFRSTLKNNKIPQNVVADVGIG-SIISLRHLSTMGGYLHSHSHNYPAGSEQQQSTLY 364

Query: 367 GHKDSNNNWLFDRIRPLTPWSEEETEIEFVKPGSSYRLVHPNTGKNLHTHPIAAPITK-S 425
            H D+NN+WL +      P  E  T  + +  G+  RL H  T   LH+H    P+++ S
Sbjct: 365 PHMDANNDWLLELYN--AP-GESLTTFQNLTDGTKVRLFHTVTRCRLHSHDHKPPVSESS 421

Query: 426 EW--EVSGYGTAEV-GDPKDHWVVEVVAQHGSED--ESRLHPLTSSFRIKNAELGCYLAQ 480
           +W  EVS YG +   GD  D WVVE+  ++ +    + R+  L + FR+++A  GCYL  
Sbjct: 422 DWQKEVSCYGYSGFDGDANDDWVVEIDKKNSAPGVAQERVIALDTKFRLRHAMTGCYLFS 481

Query: 481 TGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVETHTNEKLPGRPADFKYPKINFIKNFIH 540
               LP WGF Q EV C  +   R   T W VE ++N  LP       Y   +FI  FI 
Sbjct: 482 HEVKLPAWGFEQQEVTCASS--GRHDLTLWYVENNSNPLLPEDTKRISYKPASFISKFIE 539

Query: 541 LNLAMMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLCGWGDDTVKYFLMGSPASTWLS 600
            +  M   N  LV +P   ++  +S   WP L  GI    WG++    +L+G+ A  W +
Sbjct: 540 SHKKMWHINKNLV-EPHVYESQPTS---WPFLLRGISY--WGENNRNVYLLGN-AIVWWA 592

Query: 601 TIAVVGFMGXXXXXXX-RWQRQYQDLSDAHDFNLFMMGGFYPLLGWGLHYMPFVIMSRVT 659
             A +G  G         WQ     L D+   N F +   + LLG+ +HY P  +M R  
Sbjct: 593 VTAFIGIFGLIVITELFSWQLGKPILKDSKVVN-FHVQVIHYLLGFAVHYAPSFLMQRQM 651

Query: 660 YVHHYLPALYFALLILSYLFEAGLKGLNKTKGGQLARTLIYVTYGAIVIYGFYYFSPISF 719
           ++HHYLPA YF +L L +  +  +  + ++K  Q+   ++ +T+ A  +Y F  FSPI +
Sbjct: 652 FLHHYLPAYYFGILALGHALDIIVSYVFRSK-RQMGYAVV-ITFLAASVYFFKSFSPIIY 709

Query: 720 G 720
           G
Sbjct: 710 G 710

>KLLA0E01342g complement(134691..137207) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase, start by similarity
          Length = 838

 Score =  345 bits (885), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 245/734 (33%), Positives = 366/734 (49%), Gaps = 42/734 (5%)

Query: 9   RISDGTLKQRKVTTVDEIPDIEVDDRIEEKSVEVNPLLRLESIA---------MPMIFTA 59
           +    T  Q  V  VD + DI+V+       +   P   L+SI          + +    
Sbjct: 3   KTKTSTKVQDCVLDVDSVGDIQVEKGPLRPFLVTEPPKNLKSIRTMTSSKERLVVIALAV 62

Query: 60  VGFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWMAGYNGS 119
           +    R++ +   N VV+DE HFGKF + Y++  F+ DVHPPL KML    G +AG+ G 
Sbjct: 63  IASVVRLWNLSDPNSVVFDEVHFGKFAAKYIKGIFFTDVHPPLAKMLFAGIGSLAGFTGD 122

Query: 120 WDFPS-GEEYPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTILVIFENS 178
           ++F   G  +P    Y  MR F+A      + L YFT +A G  +   ++ +++   ENS
Sbjct: 123 FEFKDIGLAFPASTPYFAMRFFSAFLGLATVLLMYFTLRASGIRIWIAFVASLMFALENS 182

Query: 179 YATLGRFILLDSMLLFFTVASMFCFVTFHNQRSKPFSRKWWKWLLLTGVSLGCTISVKMV 238
           + T+ R+ILLD+ L+FF  A+ + +  +    S+ F+   +K LL TG+SLG  +S K V
Sbjct: 183 FVTISRYILLDAPLIFFIAAAAYSYKKYEIHPSESFNS--YKALLATGLSLGLAVSSKWV 240

Query: 239 GLFIITLVGIYTVIELWTLLGDKKVSKKAYAGHWLARILCLIIVPFLIFLACFKVHFDLL 298
           GLF I  VG  ++ +LW  +GD K   ++   H + +   L+  P  ++L  F +HF  L
Sbjct: 241 GLFTIAWVGALSLFKLWFDIGDLKKPVQSTLRHTVVKATLLLAAPAALYLFFFYIHFQTL 300

Query: 299 SHSGTGDANMPSLFQAGLAGSDV-GDGPRDIAVGSSIVSIKNQALGGSLLHSHVQGYPEG 357
            ++  G     S F++ L G+++  + P D+ VGSS VSI++    G  LHSH   Y  G
Sbjct: 301 IYNSDGAGFFSSAFRSTLIGNNIPSNIPYDVGVGSS-VSIRHTGTMGGYLHSHKHIYETG 359

Query: 358 SNQQQVTCYGHKDSNNNWLFDRIRPLTPWSEEETEIEFVKPGSSYRLVHPNTGKNLHTHP 417
           S QQQVT Y H D+NN+W+ +      P    ET  E +K G+  RL H  T + LH+H 
Sbjct: 360 SKQQQVTLYSHLDANNDWVIELYD--QPEVIPET-FEGLKDGTKIRLRHRLTDRRLHSHD 416

Query: 418 IAAPITK-SEW--EVSGYGTAE-VGDPKDHWVVEVVAQHGSEDESR--LHPLTSSFRIKN 471
              P+++ S+W  EVS YG     GD  D WV+E+  +  +  E++  +  L + FR+++
Sbjct: 417 HKPPVSESSDWQKEVSAYGADNFTGDANDDWVIEIDHEASAPGEAQEYVKALDTKFRLRH 476

Query: 472 AELGCYLAQTGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVETHTNEKLPGRPADFKYPK 531
           A  GC L      LP+WGF Q EV C  +       T W VE ++N  LP   A   Y  
Sbjct: 477 AMTGCRLFSHEVKLPKWGFEQQEVTCASSGVP--SLTLWYVEHNSNPLLPEDAAKISYQT 534

Query: 532 INFIKNFIHLNLAMMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLCGWGDDTVKYFLM 591
             F++ FI  +  M   N  L     +     S    WP L  GI    W  D  + +L+
Sbjct: 535 PTFLEKFIESHQRMWHINKNL----KEHHVYQSDPATWPLLLRGISY--WSQDHKQIYLL 588

Query: 592 GSPASTWLSTIAVVG-FMGXXXXXXXRWQRQYQDLSDAHDFNLFMMGGFYPLLGWGLHYM 650
           G+ A  W S  A +G F+         WQ     L D H  N F +  F  LLGWGLHY 
Sbjct: 589 GN-AVVWWSVTAFIGVFVLVIVAELLAWQLGKSILQDKHVLN-FHIQTFQYLLGWGLHYA 646

Query: 651 PFVIMSRVTYVHHYLPALYFALLILSYLFEAGLKGLNKTKGGQLARTLIY---VTYGAIV 707
           P  +M R  ++HHYLPA YF +L  ++  E  +  + K K     +T+ Y   +T+ A  
Sbjct: 647 PSFLMGRQLFLHHYLPAYYFGILAFAHALEIIVSYVFKNK-----KTVGYGVVITFLAAA 701

Query: 708 IYGFYYFSPISFGL 721
              FY + P+ +GL
Sbjct: 702 TAFFYVYKPLIYGL 715

>ADR279C [2020] [Homologous to ScYDL095W (PMT1) - SH; ScYDL093W
           (PMT5) - SH] (1177907..1180360) [2454 bp, 817 aa]
          Length = 817

 Score =  327 bits (839), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 226/683 (33%), Positives = 335/683 (49%), Gaps = 34/683 (4%)

Query: 59  AVGFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWMAGYNG 118
            V    R+Y +   + VV+DE HFG + S Y++  F+ DVHPPL KML+  +G +AGY G
Sbjct: 57  GVAAAVRLYNLAYPDSVVFDEVHFGGYASKYIQGAFFLDVHPPLAKMLLAGAGKLAGYGG 116

Query: 119 SWDFPS-GEEYPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTILVIFEN 177
            + F   G +YP  + Y  MR   A    L + L + T +A G      +  +++   EN
Sbjct: 117 EFGFEDIGIDYPATVPYQVMRFLPAALGVLTVLLMFLTLRASGVRKWVAFAVSLVFTVEN 176

Query: 178 SYATLGRFILLDSMLLFFTVASMFCFVTFHNQRSKPFSRKWWKWLLLTGVSLGCTISVKM 237
           S+ T+ R+ILLDS LLFF  A+++ F      ++   S +++K L  TG++LG  +S K 
Sbjct: 177 SFVTISRYILLDSPLLFFIAAAVYSFKRLELHQTG--SLQYYKCLAATGMALGLAMSSKW 234

Query: 238 VGLFIITLVGIYTVIELWTLLGD--KKVSKKAYAGHWLARILCLIIVPFLIFLACFKVHF 295
           VG F    VG+ +V++LW  +GD  K V          A ILC  ++P  +++  F++HF
Sbjct: 235 VGFFTFAWVGVVSVMQLWFQVGDLNKPVPSILKQSAIKASILC--VLPMCLYVLFFRIHF 292

Query: 296 DLLSHSGTGDANMPSLFQAGLAGSDVGDGPRDIAVG---SSIVSIKNQALGGSLLHSHVQ 352
             L +      N  S F+  L G  +   P +I  G    S V+I++    G  LHSH  
Sbjct: 293 QSLPNVTDAAGNFSSAFRTTLHGHTI---PANIYAGVGIGSTVTIRHIGTMGGYLHSHNH 349

Query: 353 GYPEGSNQQQVTCYGHKDSNNNWLFDRIRPLTPWSEEETEIEFVKPGSSYRLVHPNTGKN 412
            Y  GS QQQVT Y H D NN+W    I      +   T  E ++ G+  RL H  TG  
Sbjct: 350 MYQGGSEQQQVTLYPHLDQNNHWY---IEHYNASNTVPTTFEGLEHGTKIRLKHVLTGHR 406

Query: 413 LHTHPIAAPIT-KSEW--EVSGYGTAEV-GDPKDHWVVEVVAQHGS--EDESRLHPLTSS 466
           LH+H    P++  S+W  EVSGYG  E  GD  D W+VE+  +  +  E   R+  + + 
Sbjct: 407 LHSHDHKPPVSVSSDWQKEVSGYGFPEFEGDANDDWIVEIDQEKSTPGEARERVRAIETK 466

Query: 467 FRIKNAELGCYLAQTGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVETHTNEKLPGRPAD 526
           FR+++A  GC L      LP+WGF Q EV C      R   T W +E +TN  L      
Sbjct: 467 FRLRHAMTGCMLFSHQVKLPKWGFEQQEVTCATQ--GRPDLTLWYIEENTNPLLSEDSEK 524

Query: 527 FKYPKINFIKNFIHLNLAMMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLCGWGDDTV 586
             Y   NF +  + ++  M   N +L           S   QWP L  GI    W  D+ 
Sbjct: 525 ISYKTPNFWEKLVEIHRKMWHINKSLT----DAHMYQSDPIQWPFLLRGISY--WSKDSR 578

Query: 587 KYFLMGSPASTWLSTIAVVGFMGXXXXXXXRWQRQYQDLSDAHDFNLFMMGGFYPLLGWG 646
           + +L+G+    +  T+ VV F          WQ     LSD    N F +   + LLG+ 
Sbjct: 579 QVYLLGNAVVWYSVTLFVVIFGLICVGELFVWQLGKPILSDTKILN-FHIQTIHYLLGYF 637

Query: 647 LHYMPFVIMSRVTYVHHYLPALYFALLILSYLFEAGLKGLNKTKGGQLARTLIYVTYGAI 706
           +HY+P  +M R  ++HHYLPA YF +L L++  +  +  LN+ +        ++V  G+I
Sbjct: 638 IHYLPSFLMGRQMFLHHYLPAYYFGILALAHGLDGLVTFLNRKRPIAYGLVAMFVL-GSI 696

Query: 707 VIYGFYYFSPISFGLSGPSSNYA 729
               F  +SP+ +GL    S  A
Sbjct: 697 AF--FVTYSPLVYGLQWTRSQCA 717

>Kwal_23.3623
          Length = 876

 Score =  327 bits (837), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 222/682 (32%), Positives = 349/682 (51%), Gaps = 34/682 (4%)

Query: 50  SIAMPMIFTAVGFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGL 109
           +IA   + T V    R+Y +   N VV+DE HFG F + Y++  F+ DVHPPL KML   
Sbjct: 97  TIAALAVITGV---IRLYGLSNPNSVVFDEVHFGGFAAKYIKGIFFMDVHPPLAKMLFAA 153

Query: 110 SGWMAGYNGSWDFPS-GEEYPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWL 168
            G +AG+ G +DF   G+ +P+   Y  MR+F A    L + L Y T +  G  +P  ++
Sbjct: 154 IGSIAGFTGDFDFEKIGQHFPESTPYYFMRLFPALLGTLTVLLMYLTLRCSGVRIPIAFI 213

Query: 169 FTILVIFENSYATLGRFILLDSMLLFFTVASMFCFVTFHNQRSKPFSRKWW---KWLLLT 225
            ++    ENS+ T+ R+ILLD+ LLFF  ++++ F     ++ + + +  W   K LL  
Sbjct: 214 ASLCFAIENSFVTISRYILLDAPLLFFIASAVYSF-----KKYEIYPQGSWGSLKALLSG 268

Query: 226 GVSLGCTISVKMVGLFIITLVGIYTVIELWTLLGDKKVSKKAYAGHWLARILCLIIVPFL 285
           G++LG  +S K VGLF I  VG+  +  LW ++GD      +       +++  + +P  
Sbjct: 269 GLALGMALSSKWVGLFTIAWVGVLCIWRLWFMVGDLSKPLSSTLKEASRKLMFFLALPLA 328

Query: 286 IFLACFKVHFDLLSHSGTGDANMPSLFQAGLAGSDV-GDGPRDIAVGSSIVSIKNQALGG 344
           ++   F VHF+ L+ +  G     S F+  L G+ +  D   D+ +GS+I S+++ A  G
Sbjct: 329 LYAVFFYVHFETLTINSDGAGFFSSAFRTTLHGNTIPKDILADVGIGSTI-SMRHVATMG 387

Query: 345 SLLHSHVQGYPEGSNQQQVTCYGHKDSNNNWLFDRIRPLTPWSEEETEIEFVKPGSSYRL 404
             LHSH   Y +GS QQQVT Y H D NN+W+ +   P  P ++  T  E +K G+  RL
Sbjct: 388 GYLHSHNHMYEKGSQQQQVTLYPHLDGNNDWVIE--LPDQP-NKAVTSFEGLKDGTVIRL 444

Query: 405 VHPNTGKNLHTHPIAAPITKS-EW--EVSGYGTAEV-GDPKDHWVVEV--VAQHGSEDES 458
            H  T + LH+H   AP+++S +W  EVS YG  +  GD  D W +E+   A    E + 
Sbjct: 445 KHAITQRRLHSHDHKAPVSESADWQKEVSCYGFEDFEGDGNDDWTIEIDQDASEPGEAQK 504

Query: 459 RLHPLTSSFRIKNAELGCYLAQTGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVETHTNE 518
           R+  L + FR+K+  + C+L      LP+WGF Q EV C      +   T W +E +++ 
Sbjct: 505 RVKALDTKFRLKHNIMNCHLFSHEVKLPKWGFEQQEVTCASQ--GKPYLTLWYIEGNSHP 562

Query: 519 KLPGRPADFKYPKINFIKNFIHLNLAMMATNNALVPDPDKLDNLASSAWQWPTLNVGIRL 578
            L G      Y K NF +  I  +  M   N  LV +P   ++   S   WP L  GI  
Sbjct: 563 LLTGDQERVSYKKPNFFEKLIESHQRMWHINKNLV-EPHIYESKPHS---WPFLLRGINY 618

Query: 579 CGWGDDTVKYFLMGSPASTWLSTIAVVGFMGXXXXXXXRWQRQYQDLSDAHDFNLFMMGG 638
             WG++  + +L+G+    W  T  +  F          WQ     L D+   N F +  
Sbjct: 619 --WGENHKQVYLLGNAIVWWSVTAFIALFATIVVFELFAWQLGKPILQDSKVVN-FHVQV 675

Query: 639 FYPLLGWGLHYMPFVIMSRVTYVHHYLPALYFALLILSYLFEAGLKGLNKTKGGQLARTL 698
            + LLG+GLHY+P  +M R  ++HHYLPA YF +L  ++  +  +  + + K   +   +
Sbjct: 676 IHYLLGYGLHYIPSFLMGRQLFLHHYLPAYYFGILAFAHALDITVTYVFR-KREVIGYAV 734

Query: 699 IYVTYGAIVIYGFYYFSPISFG 720
           I V + A V+Y F  +  + +G
Sbjct: 735 IGVFFSA-VVYFFVSYRALIYG 755

>YDL093W (PMT5) [774] chr4 (289909..292140) Member of the PMT
           O-mannosyltransferases family [2232 bp, 743 aa]
          Length = 743

 Score =  294 bits (752), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 215/739 (29%), Positives = 342/739 (46%), Gaps = 53/739 (7%)

Query: 15  LKQRKVTTVDEIPDIEVDDRIEEKSVEVNPLLRLES------------IAMPMIFTAVGF 62
           + +  +  VD IPD+ +        +   P   L S            +   +IFTA+  
Sbjct: 1   MNKEHLLKVDPIPDVTIKRGPLRSFLITKPCDNLSSLRTVTSSKEKLLVGCLLIFTAI-- 58

Query: 63  FTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWMAGYNGSWDF 122
             R++ I + N VV+ E   G F S Y+ + F+ DVHPPL  ML      + GY G +++
Sbjct: 59  -VRLHNISLPNSVVFGENEVGTFVSQYVNNIFFTDVHPPLVAMLYATVSSVFGYKGLFNY 117

Query: 123 PS-GEEYPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTILVIFENSYAT 181
            + G EY   + YV MR F+AT   + + + Y T +  G  +    +  +    ENS+ T
Sbjct: 118 GNIGTEYTANVPYVAMRFFSATLGIVSVLVLYLTLRVSGVKIAVAAICAVCFAIENSFVT 177

Query: 182 LGRFILLDSMLLFFTVASMFCFVTFHNQRSK---PFSRKWWKWLLLTGVSLGCTISVKMV 238
           L RF L++   +FF   +++ F     +RS+   P S K  K LL   ++LG  +S K  
Sbjct: 178 LSRFTLIEGPFVFFMACAVYFF-----RRSELYLPNSCKANKSLLAASIALGFAVSSKWA 232

Query: 239 GLFIITLVGIYTVIELWTLLGDKKVSKKAYAGHWLARILCLIIVPFLIFLACFKVHFDLL 298
           GLF I   GI  +  +W ++GD      +   +   +  CL+ +P  I+   F VH   L
Sbjct: 233 GLFTIAWAGIIVLWRVWFMIGDLSRPIGSSIKYMAFQFTCLLAIPAFIYFLIFSVHIKTL 292

Query: 299 SHSGTGDANMPSLFQAGLAGSDV-GDGPRDIAVGSSIVSIKNQALGGSLLHSHVQGYPEG 357
           + +G   +  P+ F+  L  ++V  +   ++AVGS+ VS+ +    G  LHSH+  YP G
Sbjct: 293 NVNGISSSFFPAEFRKTLKYNNVIKETVAEVAVGSA-VSLNHVGTAGGYLHSHLHNYPAG 351

Query: 358 SNQQQVTCYGHKDSNNNWLFDRIRPLTPWSEEETEIEFVKPGSSYRLVHPNTGKNLHTHP 417
           S QQQVT Y H D NN W+ +      P +E  T  + +  G+  +L     G  LH+H 
Sbjct: 352 SMQQQVTLYPHIDQNNKWIIELAE--HP-NENVTSFQNLTDGTIIKLRQLKNGCRLHSHD 408

Query: 418 IAAPITK-SEW--EVSGYGTAEV-GDPKDHWVVEVVAQHGSEDESRLH--PLTSSFRIKN 471
              P+++ ++W  EVS YG     GD  D W++E+  +      ++ H   + + FR+K+
Sbjct: 409 HKPPVSQNADWQKEVSCYGYEGFEGDINDDWIIEIDKKRSEPGPAQEHIRAIETKFRLKH 468

Query: 472 AELGCYLAQTGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVETHTNEKLPGRPADFKYPK 531
              GCYL      LPEWGF Q EV C    F R+  T W +E + NE     P    Y K
Sbjct: 469 YLTGCYLFSHPEKLPEWGFGQQEVTCAY--FAREDLTSWYIEENENEISLPNPEKVSYKK 526

Query: 532 INFIKNFIHLNLAMMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLCGWGDDTVKYFLM 591
           ++F + F+ ++  M   NN +    D     +S    WP +  GI    W ++  + + +
Sbjct: 527 MSFWQKFVAIHKFMFYLNNYM----DTSHAYSSEPKTWPLMLRGIDF--WNENGREVYFL 580

Query: 592 GSPASTWLSTIAVVGFMGXXXXXXXRWQRQYQDLSDAHDFNLFMMGGFYPLLGWGLHYMP 651
           G+    W  T  +  F+         W+     L D H  N F    F  LLG+  HY P
Sbjct: 581 GNAVLWWSVTAFICTFIIGVAVELLAWKLGVNILRDKHIIN-FHYQVFQYLLGFAAHYFP 639

Query: 652 FVIMSRVTYVHHYLPALYFALLILSYLFEAGLKGLNKTKGGQLARTLIYVTYGAIVIYGF 711
           +  + +  +++ YLPA YF +L   +  +     L  T          Y+     ++  F
Sbjct: 640 YFFVGQKLFLYDYLPAYYFGILAFGHALD-----LISTYISNKRNNTGYIVVAIFMVVCF 694

Query: 712 YYF---SPISFGLSGPSSN 727
           Y+F   SP+ +  +G SSN
Sbjct: 695 YFFSEHSPLIYA-TGWSSN 712

>KLLA0B03762g 339424..341742 similar to sp|P46971 Saccharomyces
           cerevisiae YJR143c PMT4
           dolichyl-phosphate-mannose--protein O-mannosyl
           transferase, start by similarity
          Length = 772

 Score =  293 bits (750), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 227/713 (31%), Positives = 325/713 (45%), Gaps = 65/713 (9%)

Query: 52  AMPMIFTAVGFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSG 111
            M  + T +    R+++I     VV+DE HFGKF SYYL   ++ DVHPP+ KML+   G
Sbjct: 63  VMNYLVTGLALVLRLWRISEPREVVFDEVHFGKFASYYLERTYFFDVHPPMAKMLIAAIG 122

Query: 112 WMAGYNGSWDFPS-GEEYPDYLD-YVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLF 169
           W+ GYNGS+ F   G  Y  Y   +V  R  +A    L + + + T K + F   T ++ 
Sbjct: 123 WLTGYNGSFKFDDIGYSYDTYYAPFVAYRSLSAVLGVLTVSVVFQTMKELNFKAVTCFIA 182

Query: 170 TILVIFENSYATLGRFILLDSMLLFFTVASMFCFVTFHN-QRSKPFSRKWWKWLLLTGVS 228
             L+  +N++ T  R ILLD+ML+F    S++C+V F+  Q + PFS +W+ WL LTG S
Sbjct: 183 AFLIAVDNAHVTDTRLILLDAMLIFSIALSIYCYVRFYKLQLTSPFSSEWYLWLYLTGFS 242

Query: 229 LGCTISVKMVGLFIITLVGIYTVIELWTLLGDKK-VSKKAYAGHWLARILCLIIVPFLIF 287
           L   +S K VGL     +G+  V+ LW LL  +  +S +    H L RI  LII PF+++
Sbjct: 243 LSMVMSTKYVGLLTYCTIGLAVVVNLWQLLDIRSGLSMRKVVKHTLVRINGLIIFPFVVY 302

Query: 288 LACFKVHFDLLSHSGTGDANMPSLFQAGLAGSDVGDGPRDIAVGS----SIVSIKNQALG 343
           L  F  HF +L+ SG GDA M S FQ  L      D P  + + S     I++IK++A  
Sbjct: 303 LFWFWCHFAILNQSGPGDAFMSSDFQDTLL-----DAPGAVEIKSINYHDIITIKHKA-T 356

Query: 344 GSLLHSHVQGYPE-------GSNQQQVTCYGHKDSNNNWLFDRIRPLTPWSEEETEIEFV 396
            + LHSH+  YP         SN QQVTCY H+D NN W       L P   +  +   V
Sbjct: 357 DAFLHSHLAKYPVRYEDGRISSNGQQVTCYSHEDINNQW-----EILPPSGSKFKKGAPV 411

Query: 397 KPGSSYRLVHPNTGKNLHTHPIAAPITKSEWEVSGYGTAEV-GDPKDHWVVEVVAQHGSE 455
           K  +  RL H  T   L  H +A+P   +  EV+     E  G+  D  +          
Sbjct: 412 KLDADIRLRHVGTNTYLLAHDVASPYYPTNEEVTTVSEEEANGESYDFTLFRFQPILPKN 471

Query: 456 DESRLHPLTSSFRIKNAELGCYL-AQTGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVET 514
                    S+FRI + +    L       LPEWGF Q EV    N   +D    W V++
Sbjct: 472 SGRVAKTKNSAFRIFHVQTAVALWTHNDKLLPEWGFSQQEVN--GNKKVQDPENNWFVDS 529

Query: 515 HTN--EKLPGRPADFKYP-KINFIKNFIHLNLAMMATNNALVPDPDKLDNLASSAWQWPT 571
             N  E    R    K P  + F + +  L   M   NN L  +       AS+   WP 
Sbjct: 530 IVNMPENDSRRIYTPKVPTSMPFFQKWYELQFLMFEHNNKLSSE----HPFASNPQSWPL 585

Query: 572 LNVGIRLCGWGDDTVKYFLMGSPASTWLSTIAVVGFMGXXXXXXXRWQRQYQDLSDAHDF 631
              G+      +   + F  G+    W   ++V  ++G         QR    L+     
Sbjct: 586 SLSGVSFWTKEEGRKQIFFTGNIVGWWFEIVSVALYLGLVVADLITRQRAVYALNKMARQ 645

Query: 632 NLFMMGGFYPLLGWGLHYMPFVIMSRVTYVHHYLPALYFALLILSYLFEAGLKGLNKTKG 691
            L+    F  + GW +HY PF +M+R  ++HHYLP    A LIL+ +F A L  +  T  
Sbjct: 646 KLYGPMAFL-IFGWCIHYFPFFLMARQKFLHHYLP----AHLILA-MFSAALWEIVFTDN 699

Query: 692 GQL------------------ARTLIYVTYGAIVIYG----FYYFSPISFGLS 722
             L                    T+ Y  +   VI      F YF+P+ +GLS
Sbjct: 700 QSLDFDLDEEDSKNPHDAEPKVYTIAYYLFCLSVIVNVGGCFIYFAPLVYGLS 752

>CAGL0M00220g 28137..30434 similar to sp|P46971 Saccharomyces
           cerevisiae YJR143c PMT4
           dolichyl-phosphate-mannose--protein O-mannosyl
           transferase, hypothetical start
          Length = 765

 Score =  285 bits (728), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 212/698 (30%), Positives = 329/698 (47%), Gaps = 51/698 (7%)

Query: 56  IFTAVGFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWMAG 115
           + TA+ F  R YKI     VV+DE HFGKF SYYL   F+ DVHPPL KM++   GW+  
Sbjct: 64  LVTAIAFAVRFYKIYYPREVVFDEVHFGKFASYYLERTFFFDVHPPLAKMMIAFIGWLCN 123

Query: 116 YNGSWDFPS-GEEYPDY-LDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTILV 173
           Y+GS+ F   G  Y  +   ++  R FNA    L + + + + K + F   T +L ++LV
Sbjct: 124 YDGSFKFEEIGLSYDKHPAPFLAYRSFNALLGTLTVSIMFESMKELNFKAITCFLASMLV 183

Query: 174 IFENSYATLGRFILLDSMLLFFTVASMFCFVTFHN-QRSKPFSRKWWKWLLLTGVSLGCT 232
             +N++ T  R ILLD++LL    A+++ ++ F+  Q  +PFS  W+ WL LTG SL C 
Sbjct: 184 AIDNAHVTETRLILLDAILLISVAATVYSYIRFYKLQLKEPFSWNWYIWLYLTGFSLSCV 243

Query: 233 ISVKMVGLFIITLVGIYTVIELWTLLG-DKKVSKKAYAGHWLARILCLIIVPFLIFLACF 291
           IS K +G+     +GI  V+ LW LL  + K+S +    H   R+  LI++PF+I+L  F
Sbjct: 244 ISTKYIGVMTYAAIGIPVVVNLWQLLDINAKLSIRMLIKHIGRRLNGLILIPFIIYLFWF 303

Query: 292 KVHFDLLSHSGTGDANMPSLFQAGLAGSDVGDGPRDIAVGSSIVSIKNQALGGSLLHSHV 351
            VHF +L+ SG GD  M S FQ  L  S+     +++     IV+ +NQ   G+ LHSH+
Sbjct: 304 YVHFAILNVSGPGDVFMSSEFQDTLHDSEATKLSKEVQF-FDIVTFENQD-TGAFLHSHL 361

Query: 352 QGYP-------EGSNQQQVTCYGHKDSNNNWLFDRIRPLTPWSEEETEIEFVKPGSSYRL 404
             YP         S  QQVTCY H+D NN W    I P+     ++ + + ++ G  +RL
Sbjct: 362 ARYPLRYEDDRVSSQGQQVTCYTHEDVNNQW---EILPVA----DKAKGDNIRFGDEFRL 414

Query: 405 VHPNTGKNLHTHPIAAPITKSEWEVSGYGTAEVGDPKDHWVVEVVAQHGSEDESR-LHPL 463
            H  T   L  H +A+P+  +  E++     +    + +  +        +DE   +   
Sbjct: 415 RHVGTDSYLLAHDVASPLYPTNEEITTVHKDDALGARANSTIFRFQPINKKDEGHIIKSK 474

Query: 464 TSSFRIKNAELGCYL-AQTGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVETHTN---EK 519
            +  RI + E    L +     LP+WGF Q EV    N    D    W +++  N   ++
Sbjct: 475 NAVLRIIHKETVVALWSHNDELLPDWGFGQQEVN--GNKKMTDSGNAWTIDSIMNLDEKR 532

Query: 520 LPGRPADFKYPKINFIKNFIHLNLAMMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLC 579
               P + K   + F   ++ L   M   NN L  +       AS    WP    G+   
Sbjct: 533 SAYAPKEIK--SMPFFNKWLELQKLMFEQNNKLTSE----HPFASQPESWPGSMSGVSFW 586

Query: 580 GWGDDTVKYFLMGSPASTWLSTIAVVGFMGXXXXXXXRWQRQYQDLSDAHDFNLFMMGGF 639
              ++  + + +G+    W   I+   ++G         QR Y  L+      L+     
Sbjct: 587 TKNEERRQIYFIGNIIGFWFQVISFAVYVGIIIADQITRQRGYFALNKVTREKLYGPLA- 645

Query: 640 YPLLGWGLHYMPFVIMSRVTYVHHYLPALYFALLILSYLFEAGLKGL-------NKTKGG 692
           Y   GW  HY PF +M R  ++HHYLPA   A L  + L+E             ++ K G
Sbjct: 646 YLFCGWACHYFPFFLMGRQKFLHHYLPAHLIAALFAAGLWETVFSRCKSDDPYKDEEKPG 705

Query: 693 ------QLARTLIYVTYG----AIVIYGFYYFSPISFG 720
                     T  Y+T+     A +++ F +FSP+ + 
Sbjct: 706 VSFEKYPAIYTAAYITFNITVLAALVWCFVFFSPLIYA 743

>YJR143C (PMT4) [3035] chr10 complement(698241..700529)
           Mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase),
           involved in initiation of O-glycosylation [2289 bp, 762
           aa]
          Length = 762

 Score =  283 bits (724), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 221/701 (31%), Positives = 331/701 (47%), Gaps = 55/701 (7%)

Query: 56  IFTAVGFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWMAG 115
           I T + F  R YKI     VV+DE HFGKF SYYL   ++ DVHPP  KM++   GW+ G
Sbjct: 58  IVTLLAFAARFYKIWYPKEVVFDEVHFGKFASYYLERSYFFDVHPPFAKMMIAFIGWLCG 117

Query: 116 YNGSWDFP----SGEEYPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTI 171
           Y+GS+ F     S E +P    Y+  R FNA    L +P+ + T K + F   T    ++
Sbjct: 118 YDGSFKFDEIGYSYETHP--APYIAYRSFNAILGTLTVPIMFNTLKELNFRAITCAFASL 175

Query: 172 LVIFENSYATLGRFILLDSMLLFFTVASMFCFVTFHN-QRSKPFSRKWWKWLLLTGVSLG 230
           LV  + ++ T  R ILLD++L+    A+M+C+V F+  Q  +PF+  W+ WL  TG+SL 
Sbjct: 176 LVAIDTAHVTETRLILLDAILIISIAATMYCYVRFYKCQLRQPFTWSWYIWLHATGLSLS 235

Query: 231 CTISVKMVGLFIITLVGIYTVIELWTLLGDKK-VSKKAYAGHWLARILCLIIVPFLIFLA 289
             IS K VG+   + +G   V+ LW LL  K  +S + +  H+  R+  L+++PF+I+L 
Sbjct: 236 FVISTKYVGVMTYSAIGFAAVVNLWQLLDIKAGLSLRQFMRHFSKRLNGLVLIPFVIYLF 295

Query: 290 CFKVHFDLLSHSGTGDANMPSLFQAGLAGSDVGDGPRDIAVGSSIVSIKNQALGGSLLHS 349
            F VHF +L+ SG GDA M + FQ  L  S +    + +     I++IK+Q    + LHS
Sbjct: 296 WFWVHFTVLNTSGPGDAFMSAEFQETLKDSPLSVDSKTVNYF-DIITIKHQD-TDAFLHS 353

Query: 350 HVQGYPE-------GSNQQQVTCYGHKDSNNNWLFDRIRPLTPWSEEETEIEFVKPGSSY 402
           H+  YP+        S  QQVT Y H D NN W       L P   +  + + V      
Sbjct: 354 HLARYPQRYEDGRISSAGQQVTGYTHPDFNNQW-----EVLPPHGSDVGKGQAVLLNQHI 408

Query: 403 RLVHPNTGKNLHTHPIAAPITKSEWEVSGYGTAEVGD----PKDHWVVEVVAQHGSEDES 458
           RL H  T   L  H +A+P   +  E++   T E GD    P+  +  + + +  S++  
Sbjct: 409 RLRHVATDTYLLAHDVASPFYPTNEEITTV-TLEEGDGELYPETLFAFQPLKK--SDEGH 465

Query: 459 RLHPLTSSFRIKNAELGCYL-AQTGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVETHTN 517
            L   T SFR+ + +    L       LP+WGF+Q E+   K     D    W V+   N
Sbjct: 466 VLKSKTVSFRLFHVDTSVALWTHNDELLPDWGFQQQEINGNKKVI--DPSNNWVVDEIVN 523

Query: 518 EKLPGRPADFKYPK-INFIKNFIHLNLAMMATNNALVPDPDKLDNLASSAWQWPTLNVGI 576
                +    K  K + F+K +I    +M   NN L  +       AS  + WP    G+
Sbjct: 524 LDEVRKVYIPKVVKPLPFLKKWIETQKSMFEHNNKLSSE----HPFASEPYSWPGSLSGV 579

Query: 577 RLCGWGDDTVKYFLMGSPASTWLSTIAVVGFMGXXXXXXXRWQRQYQDLSDAHDFNLFMM 636
                GD+  + + +G+    W   I++  F+G          R Y  L+      L+  
Sbjct: 580 SFWTNGDEKKQIYFIGNIIGWWFQVISLAVFVGIIVADLITRHRGYYALNKMTREKLYGP 639

Query: 637 GGFYPLLGWGLHYMPFVIMSRVTYVHHYLPALYFALLILSYLFE---AGLKGLNKTK--- 690
             F+  + W  HY PF +M+R  ++HHYLPA   A L    L+E   +  K L+  K   
Sbjct: 640 LMFF-FVSWCCHYFPFFLMARQKFLHHYLPAHLIACLFSGALWEVIFSDCKSLDLEKDED 698

Query: 691 --GGQLAR---------TLIYVTYGAIVIYGFYYFSPISFG 720
             G    R         T+  V     V + F YFSP+ +G
Sbjct: 699 ISGASYERNPKVYVKPYTVFLVCVSCAVAWFFVYFSPLVYG 739

>ABL085W [507] [Homologous to ScYJR143C (PMT4) - SH]
           complement(237967..240240) [2274 bp, 757 aa]
          Length = 757

 Score =  275 bits (704), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 208/698 (29%), Positives = 322/698 (46%), Gaps = 53/698 (7%)

Query: 58  TAVGFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWMAGYN 117
           TA+ F  R +K+   + VV+DE HFGK  SYYL   ++ DVHPP  KML+   GW+ GY+
Sbjct: 55  TAIAFAVRFHKLYHPSEVVFDEVHFGKCASYYLERTYFFDVHPPFSKMLIAFVGWLVGYD 114

Query: 118 GSWDFPS-GEEYPDY-LDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTILVIF 175
           G++ F   G  Y  + + Y+  R  +A    L +PL +   + + F   T     +LV  
Sbjct: 115 GAFKFDDIGYSYETHQVPYIAYRSLSAILGTLTVPLVFSILRELNFKAITCAFGALLVAV 174

Query: 176 ENSYATLGRFILLDSMLLFFTVASMFCFVTFHN-QRSKPFSRKWWKWLLLTGVSLGCTIS 234
           +N++    R ILLD+ L+     S++ ++ F+  Q   P S +W+ WL  TG+SL   IS
Sbjct: 175 DNAHVIDSRLILLDATLVISVALSIYTYIRFYKAQLRAPLSSEWYFWLYATGLSLSFVIS 234

Query: 235 VKMVGLFIITLVGIYTVIELWTLLGDKK-VSKKAYAGHWLARILCLIIVPFLIFLACFKV 293
            K VG+F   ++G   ++ LW LL  +  +S + +  H++ R   L+  PF ++L  F V
Sbjct: 235 TKYVGVFTFAMIGTAVIVNLWQLLDVRAGLSLRMFFRHFVQRFNGLVCFPFAVYLFWFYV 294

Query: 294 HFDLLSHSGTGDANMPSLFQAGLAGSDVGDGPRDIAVGSSIVSIKNQALGGSLLHSHVQG 353
           HF +L+ SG GD  M S FQ  LA S +    +D+     IV+ +++   G+LLHSH   
Sbjct: 295 HFAILTKSGPGDDFMSSAFQETLADSPLAKDSKDVHY-YDIVTFQHRD-TGALLHSHNAY 352

Query: 354 YP-------EGSNQQQVTCYGHKDSNNNWLFDRIRPLTPWSEEETEIEFVKPGSSYRLVH 406
           YP         S  QQVT Y H+D NN W     + L+  + +   ++ V      RL H
Sbjct: 353 YPLRYEDGRVSSQGQQVTGYSHEDINNQWEILPTKELSSRTGQPVLLDDV-----LRLRH 407

Query: 407 PNTGKNLHTHPIAAPITKSEWEVSGYGTAEV-GDPKDHWVVEVVAQHGSEDESRLHPLTS 465
             TG  L TH +A+P   +  EV+        G+     + ++   +  +    +   TS
Sbjct: 408 IATGTYLLTHDVASPYYPTNEEVTTISEELANGERYKQTLFKLQPPNKKDGGHTVKSKTS 467

Query: 466 SFRIKNAELGCYL-AQTGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVETHTN---EKLP 521
            FR+ + +    L       LPEWGF+Q EV    N    D    W V +  N   E+  
Sbjct: 468 MFRMFHVDTAVALWTHNDVFLPEWGFKQQEVNG--NKKVTDPANIWTVNSILNLSEERKV 525

Query: 522 GRPADFKYPKINFIKNFIHLNLAMMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLCGW 581
             P   K  K+ F   ++ L  +M   NN L  +       AS    WP    G+    W
Sbjct: 526 YIPK--KVTKMPFFSKWLELQRSMFEHNNKLSSE----HPFASQPESWPGSLSGVSF--W 577

Query: 582 GDDTVK--YFLMGSPASTWLSTIAVVGFMGXXXXXXXRWQRQYQDLSDAHDFNLFMMGGF 639
            +DT +   +  G+    W+  I++  F+G         QR +  L       ++    F
Sbjct: 578 TNDTERRQIYFTGNIIGWWIELISLALFVGILLADAITRQRSFFVLGKLAREKIYGPLCF 637

Query: 640 YPLLGWGLHYMPFVIMSRVTYVHHYLPALYFALLILSYLFEAGL---KGLNKTKGGQLAR 696
              +GW +HY PF +M R  ++HHYLPA   A +  + L+E      + L   K      
Sbjct: 638 L-YIGWAIHYFPFFLMGRQKFLHHYLPAHLIAAMFTAGLWEVIFTDNRALTTRKDESEPA 696

Query: 697 T-------------LIYVTYGAIVIYGFY-YFSPISFG 720
                         L ++   +I + GF+ YFSPI +G
Sbjct: 697 APHNTNPIVYEYFLLAFLGLLSIAVVGFFIYFSPIVYG 734

>Scas_710.1
          Length = 919

 Score =  270 bits (690), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 209/726 (28%), Positives = 350/726 (48%), Gaps = 34/726 (4%)

Query: 8   SRISDGTLKQRKVTTVDEIPDIEVDDRIEEKSVEVNPLLRLESIAMPMIFTAVGFFTRMY 67
           S +   T++  ++     IP I  D    +  V++  +     I + +   A     R++
Sbjct: 11  SELEKDTIQAIEIKKGRVIPFI--DTEPSQDLVQLRTISTTHEIILVLSLLAFTALIRLH 68

Query: 68  KIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWMAGYNGSWDFPS-GE 126
            +G  N VV+DEA +G   S YL++  + DVHPPL K+L        G+ G ++F   G 
Sbjct: 69  DLGWPNGVVFDEAVYGNIVSKYLKNILFVDVHPPLIKLLYAGIAHFLGFEGQFEFNDIGV 128

Query: 127 EYPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTILVIFENSYATLGRFI 186
            +P    Y  MR+F+AT  +L + L Y T +A G  +      +I ++ ENS+ T+ R I
Sbjct: 129 PFPTTTPYYAMRLFSATLGSLTVLLMYLTLRASGVRIWVALAGSICLVIENSFVTVSRHI 188

Query: 187 LLDSMLLFFTVASMFCFVTFHNQRSKPFSRKWWKWLLLTGVSLGCTISVKMVGLFIITLV 246
           +L+  L+FF  A++  + T  +   K  S   +  + +  V+LG  IS K VG+  +   
Sbjct: 189 MLEGPLMFFIAAAV--YFTKKSDLFKADSCNSYINIGIAAVALGLAISSKWVGVATLIWA 246

Query: 247 GIYTVIELWTLLGDKKVSKKAYAGHWLARILCLIIVPFLIFLACFKVHFDLLSHSGTGDA 306
           G+  V  LW ++G+  +         L +   LI +P ++++  F  HF     +     
Sbjct: 247 GLICVWRLWFMVGNLSMPVCGSFKVALIKAFTLIFLPIILYILTFYFHFQYTGINSDVSQ 306

Query: 307 NMPSLFQAGLAGSDVGDGPR-DIAVGSSIVSIKNQALGGSLLHSHVQGYPEGSNQQQVTC 365
                F+  LA + V +    +IAVG S++++++    G  LHSH   Y +GSNQQQ+TC
Sbjct: 307 LFTPEFRTTLANNSVVNNVVAEIAVG-SMITLRHPGTHGGYLHSHDAFYEKGSNQQQITC 365

Query: 366 YGHKDSNNNW---LFDRIRPLTPWSEEETEIEFVKPGSSYRLVHPNTGKNLHTHPIAAPI 422
           Y + D N+NW   L+D   PL    E  T  + +  G+  RL+H NTG  LH+H    P+
Sbjct: 366 YPYVDKNDNWTVELYD--VPL----ENITSFQNLTDGTKIRLLH-NTGCRLHSHDHKPPV 418

Query: 423 TK-SEW--EVSGYGTAEV-GDPKDHWVVEVVAQHGSEDESRLH--PLTSSFRIKNAELGC 476
           ++ S+W  EVS YG     GD  D W++E+        ES+ H   + + FR+K+A +GC
Sbjct: 419 SENSDWQKEVSCYGYPGFEGDANDDWIIEIDKDASIPGESQEHVRAIETKFRLKHAIMGC 478

Query: 477 YLAQTGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVETHTNEKLPGRPADFKYPKINFIK 536
           YL      LP+ GF Q EV C  +    D  T W+VE + N  +        Y  ++F K
Sbjct: 479 YLFSHNTMLPKLGFEQQEVTCAYSGI--DSLTLWSVENNENPFVSDDAERVSYEPLSFWK 536

Query: 537 NFIHLNLAMMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLCGWGDDTVKYFLMGSPAS 596
            F+  +  M+   + +    D      S    WP +  GI    W +     +L+G+   
Sbjct: 537 KFVETHKRMLEIASGM----DNTHMYESKPATWPFMLRGIDF--WSEQHQDIYLLGNAVL 590

Query: 597 TWLSTIAVVGFMGXXXXXXXRWQRQYQDLSDAHDFNLFMMGGFYPLLGWGLHYMPFVIMS 656
            W  T  +VGF G         Q  Y+   D H  N  +    Y LLG+ L+++P +++ 
Sbjct: 591 WWSVTAFIVGFAGIVVWELVSLQLGYEFSKDPHVINFHIQVIQY-LLGFLLNFIPSLLLE 649

Query: 657 RVTYVHHYLPALYFALLILSYLFEAGLKGLNKTKGGQLARTLIYVTYGAIVIYGFYYFSP 716
              +++HYLPA YF +L L++  +  +  + + +   +  T++++ +  + +Y F   S 
Sbjct: 650 NQIFLYHYLPAYYFGILALTHGLDILVSYIFRRRRS-IGYTIVFL-FATLCVYFFRDRSA 707

Query: 717 ISFGLS 722
           + +G S
Sbjct: 708 LVYGTS 713

>Kwal_47.16734
          Length = 792

 Score =  267 bits (683), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 205/697 (29%), Positives = 312/697 (44%), Gaps = 51/697 (7%)

Query: 58  TAVGFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWMAGYN 117
           T +    R  K+     VV+DE HFGKF SYYL   ++ DVHPP  KML+   GW+ GYN
Sbjct: 90  TLLAAVVRFRKLSYPREVVFDEVHFGKFASYYLERTYFFDVHPPFAKMLIAFVGWLVGYN 149

Query: 118 GSWDFPS-GEEY-PDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTILVIF 175
           G++ F   G  Y  +   +V  R  +A    L +P+ + T K + F   T  L  +LV  
Sbjct: 150 GTFKFDDIGLSYDSNPAPFVAYRSLSAILGTLTVPIIFNTVKELNFRAVTCALAALLVAI 209

Query: 176 ENSYATLGRFILLDSMLLFFTVASMFCFVTFHN-QRSKPFSRKWWKWLLLTGVSLGCTIS 234
           + ++    R ILLD+ LL     S++C+V F+  Q   PFS  W+ WL LTG SL   +S
Sbjct: 210 DCAHVIDSRLILLDATLLIAVACSLYCYVRFYKIQLKAPFSSSWYLWLYLTGTSLSFVMS 269

Query: 235 VKMVGLFIITLVGIYTVIELWTLLGDKK-VSKKAYAGHWLARILCLIIVPFLIFLACFKV 293
            K +G+     +G    + LW LL  +  ++ + +  H L R+  LI  PF+++L  F V
Sbjct: 270 TKYIGVMTYATIGSAVAVNLWQLLDVRAGLTIRQFVKHVLQRLNGLIFAPFVLYLFWFWV 329

Query: 294 HFDLLSHSGTGDANMPSLFQAGLAGSDVGDGPRDIAVGSSIVSIKNQALGGSLLHSHVQG 353
           HF +L  SG GD  M S FQ  L+ S +    R +     I+++K++ +  + LHSH++ 
Sbjct: 330 HFAILIRSGPGDDFMSSQFQETLSDSPLAREARQVNYF-DIITLKHK-VTDAYLHSHLER 387

Query: 354 YP-------EGSNQQQVTCYGHKDSNNNWLFDRIRPLTPWSEEETEIEFVKPGSSYRLVH 406
           YP         SN QQVT Y  +D NN W     + L     +   ++ V      R  H
Sbjct: 388 YPIRYEDGRVSSNGQQVTGYTLEDVNNQWEVLPTKQLPAREGQPVHLDDV-----VRFRH 442

Query: 407 PNTGKNLHTHPIAAPITKSEWEVSGYGTAEVGD----PKDHWVVEVVAQHGSEDESRLHP 462
             T   L  H +A+P+  +  E++     E+ +    P+  + ++ V +  SED   L  
Sbjct: 443 VVTNTFLLAHDVASPLYPTNEEITTV-EEEMANGANYPETLFRLQSVNKGDSEDV--LKS 499

Query: 463 LTSSFRIKNAELGCYL-AQTGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVETHTN-EKL 520
             S FRI + +    L       LPEWGF+Q EV   K     D    W  ET  N ++ 
Sbjct: 500 KASVFRIVHIDTTVALWTHNDVLLPEWGFKQQEVNGNKKII--DPENSWFAETIVNIDEA 557

Query: 521 PGRPADFKYPKINFIKNFIHLNLAMMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLCG 580
                     K+ F   ++ L   M   NN L          ASS   WP    G+    
Sbjct: 558 RSVYVPKTRKKLPFFTKWMELQRLMFEHNNKLSSS----HPFASSPESWPGSLSGVSFWT 613

Query: 581 WGDDTVKYFLMGSPASTWLSTIAVVGFMGXXXXXXXRWQRQYQDLSDAHDFNLFMMGGFY 640
              + ++ + +G+    W   +++  F G         +R    L+      L     F 
Sbjct: 614 KDSERIQIYFIGNIIGWWFQVVSIALFCGVTAADLLVRRRGIFPLNKMAKQKLNAPLSFL 673

Query: 641 PLLGWGLHYMPFVIMSRVTYVHHYLPALYFALLILSYLFEAGL---KGLNKTKGGQ---- 693
             +GW  H++PF +M R  ++HHYLPA   A +  + ++E      K LN  K  +    
Sbjct: 674 -FVGWLCHFVPFFLMGRQKFLHHYLPAHLIASMFSAAMWETIFTDNKSLNLEKDEEDPAN 732

Query: 694 ----------LARTLIYVTYGAIVIYGFYYFSPISFG 720
                     +   L  +     +I+ F YFSPI +G
Sbjct: 733 AHEANPHLNYIPLILFVLVMSGALIWFFVYFSPIVYG 769

>Scas_442.1
          Length = 309

 Score =  252 bits (644), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 128/298 (42%), Positives = 182/298 (61%), Gaps = 14/298 (4%)

Query: 438 GDPKDHWVVEVVAQHGS-------EDESRLHPLTSSFRIKNAELGCYLAQTGAHLPEWGF 490
           GD  D W++E+V Q  S       ED++ +HP+++ FR+++  LGCYLA TG   P WGF
Sbjct: 6   GDVYDDWILEIVDQMDSGNPDFHKEDQNIVHPVSTFFRLRHKVLGCYLASTGLAYPSWGF 65

Query: 491 RQSEVACLKNPFKRDKRTWWNVETHTNEKLPGRPADFKYPKINFIKNFIHLNLAMMATNN 550
           +Q+E+ C K+   RDK TWWNVE H N++LP    D+  PK  F  +FI +N AM ++N+
Sbjct: 66  QQAEIVCKKSWSHRDKATWWNVEDHWNDQLPIE-EDYVPPKSKFWTDFILINFAMASSNS 124

Query: 551 ALVPDPDKLDNLASSAWQWPTLNVGIRLCGWGDDTVKYFLMGSPASTWLSTIAVVGFMGX 610
           ALVPD DK D LAS  W+WPTL+ G+RLC W  D  KY+L+GSP +TWLST+++  F+  
Sbjct: 125 ALVPDADKFDPLASKPWEWPTLHRGLRLCSWSRDVYKYYLLGSPFNTWLSTLSLFLFVFI 184

Query: 611 XXXXXXRWQRQYQDLSDAHDFNLFMMGGFYPLLGWGLHYMPFVIMSRVTYVHHYLPALYF 670
                 +W+RQ+ +L +   + L + G F P L W  H+ PFV+M RVTYVHHYLPALYF
Sbjct: 185 ISKIAYQWRRQHLNLQEDQLWRLGIQGIF-PFLAWITHFFPFVMMGRVTYVHHYLPALYF 243

Query: 671 ALLILSYLFEAGLKGLNKTKGGQLARTLIYVTYGAIVIYGFYYFSPISFGLSGPSSNY 728
           A+L   ++ +  +      +     +  IY+       Y +  F+PI  GL G  + Y
Sbjct: 244 AILTFGFVLDYSIG-----RANPFIKYPIYLALFVGCTYIYVLFAPICQGLHGDVAKY 296

>Scas_719.80
          Length = 762

 Score =  257 bits (657), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 220/753 (29%), Positives = 333/753 (44%), Gaps = 73/753 (9%)

Query: 10  ISDGTLK--QRKVTTVDEIPDIEVDDRIEEKSVEVNPLLRLESIAMPMIFTAVGFFTRMY 67
           + D  LK  +R  T+ +++ +  +     + ++  N LL           T + F  R Y
Sbjct: 18  VDDEALKYAKRSTTSFEQVAEKWLLRPPPDSALRYNALL--------YTVTLIAFVARFY 69

Query: 68  KIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWMAGYNGSWDFPS-GE 126
            I     VV+DE HFGKF SYYL   ++ DVHPP  KM +   GW+ GYNGS+ F   G 
Sbjct: 70  MIWYPKEVVFDEVHFGKFASYYLERTYFFDVHPPFAKMAIAFIGWLVGYNGSFKFDEIGS 129

Query: 127 EYP-DYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTILVIFENSYATLGRF 185
            Y  +   Y+  R FNA    L + + + T K + F   T +   +LV  +N++ T  R 
Sbjct: 130 SYQTNPAPYIAYRSFNAMLGTLTVSIMFNTLKELNFKAITCFFGALLVAVDNAHVTETRL 189

Query: 186 ILLDSMLLFFTVASMFCFVTFHN-QRSKPFSRKWWKWLLLTGVSLGCTISVKMVGLFIIT 244
           ILLD++LL    AS + FV F+  Q   PFS +W+ WL LTG+SL   IS K +G+    
Sbjct: 190 ILLDAILLISIAASFYSFVRFYKAQLRAPFSPQWYIWLHLTGLSLSFVISTKYIGVMTYA 249

Query: 245 LVGIYTVIELWTLLGDK-KVSKKAYAGHWLARILCLIIVPFLIFLACFKVHFDLLSHSGT 303
            +G   ++ LW LL  +  ++ +A+  H++ R+  L+  PF I+L  F VHF +LS SG 
Sbjct: 250 AIGTGVIVNLWQLLDLRANLTLRAFFRHFVKRLNGLVFAPFCIYLFWFWVHFAILSKSGP 309

Query: 304 GDANMPSLFQAGLAGSDVGDGPRDIAVGS----SIVSIKNQALGGSLLHSHVQGYPE--- 356
           GDA M + FQ  L     GD P  I         I+++K++    + LHSH   YP    
Sbjct: 310 GDAFMSAEFQETL-----GDSPMSILSKEVHFYDIITLKHKD-TEAFLHSHQAFYPLRYE 363

Query: 357 ----GSNQQQVTCYGHKDSNNNWLFDRIRPLTPWSEEETEIEFVKPGSSYRLVHPNTGKN 412
                S  QQVT +   D +N+W     R L   S +   +   +P    RL H  +   
Sbjct: 364 DGRISSEGQQVTGFTGTDISNDWEVLPTRELD--SHKGVPVVLNEP---IRLRHVASNTY 418

Query: 413 LHTHPIAAPITKSEWEVSGYGTAEVGDPKDHWVVEVVAQHGSEDESRLHPLTS-SFRIKN 471
           L  H +A+P   +  E++               V         DE  +       F+I +
Sbjct: 419 LLAHDVASPFYPTNEEITTVSEEIANGESYQQTVFTFQPLKKGDEGHVVKTKGVQFKIYH 478

Query: 472 AELGCYL-AQTGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVETHTNEKLPGRPADFKYP 530
                 L       LP+WGF Q EV   KN    D    W+V+  TN     +    K  
Sbjct: 479 PNTDVVLWTHNDVLLPDWGFEQQEVNGSKN--FGDPTNAWSVDEITNLDEDRKKFTPKVV 536

Query: 531 K-INFIKNFIHLNLAMMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLCGWGDDTVKYF 589
           K ++F + +  L  +M   NN L  +       AS    WP    G+      ++  + F
Sbjct: 537 KPMSFFRKWSELQKSMFEQNNKLSAE----HPFASQPQSWPAGLCGVSFWTKSEERKQIF 592

Query: 590 LMGSPASTWLSTIAVVGFMGXXXXXXXRWQRQYQDLSDAHDFNLFMMGGFYPLLGWGLHY 649
              +    W   I++  F+G         +R Y  L       L+    F   + WG HY
Sbjct: 593 FTANIIGWWFQVISMSVFIGILLADQISRKRGYFVLGKITREKLYGPLAFL-FISWGCHY 651

Query: 650 MPFVIMSRVTYVHHYLPALYFALLILSYLFEAGL--------KGLNKTKGGQL------- 694
            PF +M R  ++HHYLP    A LI+S LF AGL        K ++ ++  ++       
Sbjct: 652 APFFLMHRQKFLHHYLP----AHLIIS-LFTAGLWEVVFSDCKSIDASRDEEIEGTPYKA 706

Query: 695 -------ARTLIYVTYGAIVIYGFYYFSPISFG 720
                  + T+ +V     +++ F YFSP+ +G
Sbjct: 707 DPKINSTSLTVFFVAVSIAIVWFFIYFSPLVYG 739

>CAGL0L07172g complement(796354..798687) similar to sp|P33775
           Saccharomyces cerevisiae YDL095w PMT1
           mannosyltransferase or sp|P52867 Saccharomyces
           cerevisiae YDL093w PMT5, start by similarity
          Length = 777

 Score =  220 bits (561), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 188/692 (27%), Positives = 308/692 (44%), Gaps = 46/692 (6%)

Query: 15  LKQRKVT--TVDEIPDIEVDDRIEEKSVEVNP---LLRLESIA------MPMIFTAVGFF 63
           ++QR  T   +  +P +E+ D    K +  +P   L +  +I       +  I       
Sbjct: 14  VQQRAATPELLKTVPQVELKDGPVRKYIVSDPTPELFQFRTIGSKSDGILMAIVALFAIV 73

Query: 64  TRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGLSGWMAGYNGSWDF- 122
           TR Y IG    +V+DE       S Y    F  DV PPLGKM+    G   G++ S+ + 
Sbjct: 74  TRFYDIGFPKAIVYDEGFVIAEVSKYFNKTFSIDVFPPLGKMIYYFVGKYTGFDTSYKYH 133

Query: 123 PSGEEYPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTILVIFENSYATL 182
           P G ++ +   Y+  R   A   A  +   + T +A G S P   +F++ +  ENS+ T 
Sbjct: 134 PVGTQFENASVYLPERYLAAGLGACVVVFFFMTLRASGVSRPIAGIFSVALSLENSFITA 193

Query: 183 GRFILLDSMLLFFTVASMFCFVTFHNQRSKPFSRKWWKWLLLTGVSLGCTISVKMVGLFI 242
            R++ LD+  LFF  A+++      N R+   S ++          LG  IS K  GLF+
Sbjct: 194 SRYVHLDAPFLFFVAAAIYFTKKSDNLRAG--SGRYIFTFTHAACLLGLAISTKWAGLFV 251

Query: 243 ITLVGIYTVIELWTLLGDKKVSKKAYAGHWLARILCLIIVPFLIFLACFKVHFDLLSHSG 302
           +  V I T+  LW L GD  V        ++  +L L +VP +I+ + F  H    +  G
Sbjct: 252 LAWVAIVTLWRLWLLAGDLSVPICRTVKVFIFNLLVLSLVPAVIYFSIFSWHIGSRTVDG 311

Query: 303 TGDANMPSLFQAGLAGSDV-GDGPRDIAVGSSIVSIKNQALGGSLLHSHVQGYPEGSNQQ 361
                M   F++ L  + V  +   D+ VG + V + N  + G  + +    Y  GS Q+
Sbjct: 312 NDSILMKPEFRSELYNNTVIKESFADVVVGGT-VRLNNIGMDGGFVEAAPAYYEAGSKQR 370

Query: 362 QVTCYGHKDSNNNWLFDRIRP--LTPWSEEETEIEFVKPGSSYRLVHPNTGKNLHTHPIA 419
           Q+    ++    +W+ +       TP S E      +K     RL  P     LH+H   
Sbjct: 371 QIDLRKNESVTTDWVVEYYNRSGSTPKSFEN-----LKNHEKIRLYSPKYKCRLHSHDHK 425

Query: 420 APITKS-EW--EVSGYG-TAEVGDPKDHWVVEVVAQHGSEDESR--LHPLTSSFRIKNAE 473
           API++  +W  EVS YG    +GDP D W+VE+        E+R  +  + + FR+K+A 
Sbjct: 426 APISQHVDWQKEVSCYGYEGFMGDPNDDWIVEIDQDLSEPGEAREFVKAIDTKFRLKHAM 485

Query: 474 LGCYLAQTGAHL--PEWGFRQSEVACLKNPFKRDKRTWWNVET---HTNEKLPGRPADFK 528
            GCYL      +  PE+     E+AC  +   + + T WN+E    H N   P  P    
Sbjct: 486 SGCYLFTHDVRMRTPEF-VMDYEIACAHS--GKYELTLWNIEQDQPHPNS--PKNPKRVS 540

Query: 529 YPKINFIKNFIHLNLAMMATNNALVPDPDKLDNLASSAWQWPTLNVGIRLCGWGDDTVKY 588
           Y  ++     + L+ A M     +  D   L    ++   WP L  GI    W     + 
Sbjct: 541 YKPMSLKDKILDLH-AKMIEKAKVRTDKSSLITFPTT---WPLLEKGIPF--WNGFARQI 594

Query: 589 FLMGSPASTWLSTIAVVGFMGXXXXXXXRWQRQYQDLSDAHDFNLFMMGGFYPLLGWGLH 648
           + +G+PA  W  +  +V F+         WQ  ++  S+    N  +    Y  +G+ L+
Sbjct: 595 YFLGNPAMWWSVSAFIVLFVVAFVGELIFWQMGFEISSNPQFINFHIQVLQYG-IGFALN 653

Query: 649 YMPFVIMSRVTYVHHYLPALYFALLILSYLFE 680
           Y+P+++ +   +++ YLPA YF LL L+++FE
Sbjct: 654 YVPYILTTDRHHLYQYLPAYYFGLLALAHVFE 685

>Scas_30.1
          Length = 128

 Score =  154 bits (388), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 71/106 (66%), Positives = 85/106 (80%)

Query: 624 DLSDAHDFNLFMMGGFYPLLGWGLHYMPFVIMSRVTYVHHYLPALYFALLILSYLFEAGL 683
           D ++  D N F+MG FYPLLGWGLHY+PFVIMSRVTYVHHYLPALYFALLIL+YLF+  +
Sbjct: 12  DFANPEDLNTFLMGAFYPLLGWGLHYLPFVIMSRVTYVHHYLPALYFALLILAYLFDFFM 71

Query: 684 KGLNKTKGGQLARTLIYVTYGAIVIYGFYYFSPISFGLSGPSSNYA 729
           K   K+K G + +  IY  Y A++IYGFYYFSPISFG+ GPS NY+
Sbjct: 72  KKWTKSKCGSITKLAIYFCYYAVIIYGFYYFSPISFGMDGPSQNYS 117

>Scas_329.1
          Length = 273

 Score =  149 bits (377), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 132/231 (57%), Gaps = 6/231 (2%)

Query: 38  KSVEVNPLLRLESIAMPMIFTAVGFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHD 97
           K+  V PL    +IA+  +FTA     R+  +   + VV+DE HFGKF SYY++ EF+ D
Sbjct: 48  KARTVFPLKEKLAIAILALFTAS---IRLPNLQKPDSVVFDEVHFGKFASYYIKGEFFMD 104

Query: 98  VHPPLGKMLVGLSGWMAGYNGSWDFPS-GEEYPDYLDYVKMRIFNATFSALCIPLAYFTA 156
           VHPPL KML      +AG+ G++ F + G+ +P  + YV MR F+A   AL + L Y T 
Sbjct: 105 VHPPLAKMLYAGVAALAGFRGNFMFENIGDVFPADVPYVLMRFFSAMLGALTVMLLYLTL 164

Query: 157 KAIGFSLPTVWLFTILVIFENSYATLGRFILLDSMLLFFTVASMFCFVTFHNQRSKPFSR 216
           ++ G      ++       ENSY T+ R+ILLD+ L+FF  A+++ F  + N +S  FS 
Sbjct: 165 RSSGVRPWVAFVSGACFAIENSYVTISRYILLDAPLIFFIAAAVYSFKKYENYKS--FSI 222

Query: 217 KWWKWLLLTGVSLGCTISVKMVGLFIITLVGIYTVIELWTLLGDKKVSKKA 267
              K L + GV+LG   S K VGLF I  VG+  +  LW ++GD   S K+
Sbjct: 223 GSIKSLFVAGVALGMAASAKWVGLFTIAWVGLLCIWRLWFMIGDLSKSTKS 273

>Sklu_2215.6 YDR307W, Contig c2215 9395-11356 reverse complement
          Length = 653

 Score =  155 bits (391), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 127/437 (29%), Positives = 197/437 (45%), Gaps = 41/437 (9%)

Query: 88  YYLRHEFYHDVHPPLGKMLVGLSGWMAGYNGSWDFPSGEEYPDYLDYVKMRIFNATFSAL 147
           +YL HEFY D  PPL   L  L            F  GE     L    +R    +   +
Sbjct: 70  HYLSHEFYLDSRPPLSVQLFSL----------LTFVYGE-----LSVELLRAATTSCGGI 114

Query: 148 CIPLAYFTAKAIG----FSLPTVWLFTILVIFENSYATLGRFILLDSMLLFFTVASMFCF 203
            + L Y   +        S+  V  F+ L +F      +      D   + F   S++ +
Sbjct: 115 ALVLLYLGLRKSSVNRVISVIAVVSFSYLKVFREETLRVST----DIFQVCFLAMSLYSW 170

Query: 204 VTFHNQRSKPFSRKWWKWLLLTGVSLGCTISVKMVGLFIITLVGIYTVIELWTLLGDKKV 263
            +F  + +KPFS+ W K+LL   +SLG +IS K VG    + +   ++++LW ++ D ++
Sbjct: 171 KSF--KAAKPFSKTWHKYLLFLSISLGLSISNKFVGFMTWSWILSLSIVQLWNIIADVRL 228

Query: 264 SKKAYAGHWLARILCLIIVPFLIFLACFKVHFDLLSHSGTGDAN-MPSLFQAGLAGSDVG 322
           + K    H + R + L++VP ++FL  +  H   L+   T  +  M   ++  L  + + 
Sbjct: 229 TGKQVFTHCVLRFMALVLVPAIVFLLSYYAHISTLTQDLTDFSTFMSPYYKHTLENNPLN 288

Query: 323 D--GPRDIAVGSSIVSIKNQALGGSLLHSHVQGYPEGSNQQQVTCYGHKDSNNNWLFDRI 380
               P  +  GS+I      +LGG  LHSH   Y  GS++QQVT Y   D+NN W+ +  
Sbjct: 289 KIVPPGRVYYGSTITIRHKDSLGG-YLHSHELNYQSGSHEQQVTLYDFPDNNNEWIVEHK 347

Query: 381 RPLTPWSEEETEIEFVKPGSSYRLVHPNTGKNLHTHPIAAPITKSEW--EVSGYGTAE-V 437
           +     S +      VK G + RL H  TGK L       P+++ ++  EVS  G A   
Sbjct: 348 KENKDVSSKAVA---VKNGENIRLRHRLTGKLLRASGAKPPVSEQDYDREVSCTGDANYT 404

Query: 438 GDPKDHWVVEVVAQHGSEDESRLHPLTSSFRIKNAELGCYLAQTGAHLPEWGFRQSEVAC 497
           G   + W +      G   E  L PL ++F++ N   GC L      LPEW   Q EV C
Sbjct: 405 GQSDELWKIRF---SGRLLEG-LVPLDTTFQLTNQGQGCTLLSHDLRLPEWALFQQEVLC 460

Query: 498 LKNPFKRDKRTWWNVET 514
           L  P K  +RT + VE+
Sbjct: 461 LDPPTK--ERTLFYVES 475

>AAL050W [137] [Homologous to ScYDR307W - SH]
           complement(256490..258463) [1974 bp, 657 aa]
          Length = 657

 Score =  119 bits (297), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 107/364 (29%), Positives = 161/364 (44%), Gaps = 32/364 (8%)

Query: 199 SMFCFVTFHNQRS----KPFSRKWWKWLLLTGVSLGCTISVKMVGLFIITLVGIYTVIEL 254
           +MF  +  +N +S    +PF + WW  L    V  G     K VGL     V +     +
Sbjct: 176 AMFLAIILYNWKSFKLQEPFGQAWWLRLSAVAVCSGLAAGTKFVGLGTWAWVLLLNSAHI 235

Query: 255 WTLLGDKKVSKKAYAGHWLARILCLIIVPFLIFLACFKVHFDLLSHSGTGDANMPSLFQA 314
           + L+GD +VS +    H L R+  L +VP  I L  +  H    S+S    + MP+LF+A
Sbjct: 236 FQLIGDLEVSTRTVWKHVLIRLPLLTLVPLSIILLGYHSHLQAPSYSSRDSSYMPTLFKA 295

Query: 315 GLAGSDVGDGPRDIAVGSSIVSIKNQALGGSLLHSHVQGYPEGSNQQQVTCYGHKDSNNN 374
            L G  V   P  +  GS +V   + ++GG  LHSH   YP GS +QQ+T Y  +D+NN 
Sbjct: 296 QLDGYQVLQ-PASVYYGSGVVIRHSSSIGG-YLHSHELTYPGGSEEQQITLYDFEDANNK 353

Query: 375 WLFDRIRPLTPWSEEETEI----EFVKPGSSYRLVHPNTGKNLHTHPIAAPITKSEW--E 428
           W  + +     ++E   +I    + V+ G   +L H  TGK L       P+++ ++  E
Sbjct: 354 WTVEPV-----YNEAMDDIINSTQPVRNGDLIKLRHVQTGKLLRASAAKPPVSQRDYDQE 408

Query: 429 VSGYG-TAEVGDPKDHWVVEVVAQHGSEDESRLHPLTSSFRI-KNAELGCYLAQTGAHLP 486
           VS  G +   GD  + W V++      ED      +  S R+ K   L   L+  G    
Sbjct: 409 VSCTGDSGYSGDSDETWRVDIQDAEYHEDPKAWFCIHFSPRVNKGPVLPPLLSHDGQAAE 468

Query: 487 EWGFRQSEVACLKNP------FKRDKRTWWNVETHTNEKLPGRPADF------KYPKINF 534
                + EV CL +P      F  D     + ET    +L   PA F      +Y    F
Sbjct: 469 VGPCTRQEVICLASPVHKYSLFYVDSSEMMHNETMQLPRL-SFPAKFWAYIHAQYKYDYF 527

Query: 535 IKNF 538
           +KNF
Sbjct: 528 VKNF 531

>Scas_588.7
          Length = 726

 Score =  110 bits (276), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 133/605 (21%), Positives = 238/605 (39%), Gaps = 70/605 (11%)

Query: 88  YYLRHEFYHDVHPPLGKMLVGLSGWMAGYNGSWDFPSGEEYPDYLDYVKMRIFNATFSAL 147
           YY + +F  +  PPLG  L  L             P G        Y  MR+ + + S+ 
Sbjct: 142 YYQKDKFILNSFPPLGIQLYSL------------LPVGS-------YSAMRLMSLSASSF 182

Query: 148 CIPLAYFTAKAIGFSLPTVWLFTILVIFENSYATLGRFILLDSMLLFFTVASMFCFVTFH 207
            +   Y   + +        + T+ ++    +      I LD++  F+   S++ + +  
Sbjct: 183 SLLFLYLAFRRVNVPYLIALVSTVCILSIPLFRKESTRISLDTLQWFWLSISIYSWASL- 241

Query: 208 NQRSKPFSRKWWKWLLLTGVSLGCTISVKMVGLFIITLVGIYTVIELWTLLGDKKVSKKA 267
            +    FS KW    L+  +S+GC+++ K +G        + + I  W ++GD ++S   
Sbjct: 242 -KCFSHFSIKWTIHSLIFAMSIGCSMATKYIGFATWGWAILISSIYFWQMIGDVRLSTSH 300

Query: 268 YAGHWLARILCLIIVPFLIFLACFKVHFDLLSHSGTGDAN----MPSLFQAGLAGSDVGD 323
              H   +I CL+++P  IF     +    ++HS          M S ++  L       
Sbjct: 301 IVKHTTFQIFCLLVIPMTIFATTLYLQ---INHSRIDSPEYSQYMSSYYKIFLRSKSPIL 357

Query: 324 GPRDIAVGSSIVSIKNQALGGSLLHSHVQGYPEGSNQQQVTCYGHKDS-NNNWLFDRIRP 382
            P +I  GS I      +LGG L     + YPEGS +Q V+    + + +N W+ + +  
Sbjct: 358 QPMEITNGSIITIRHLNSLGGYLTSPANESYPEGSAEQIVSLTDMESNVDNQWILEYVDD 417

Query: 383 LTPWSEEETEIEFVKPGSSYRLVHPNTGKNLHTHPIAAPITKSEW--EVSGYGTAEV-GD 439
                  +++          +L H  TGK L       P+++ E+  EVS  G  +  GD
Sbjct: 418 YNKGPLIDSQ--------RIKLRHRTTGKLLRASSAKPPVSEQEYNSEVSCTGDWDYHGD 469

Query: 440 PKDHWVVEVVAQHGSEDESRLHPLTSSFRIKNAELGCYLAQTGAHLPEWGFRQSEVACLK 499
             + W +++V       E  L P  +   + N    C L      LP+WG  + EV C++
Sbjct: 470 SDEFWKIDLV-------EGSLIPCWNIMELDNVGQMCTLISHDTRLPDWGEFEQEVFCIQ 522

Query: 500 NPFKRDKRTWWNVETHTNEKLPGRPADFKYPKI-NFIKNFIHLNLAMMATNN-------- 550
           +P    +R  + +E   N+++         P   N+ + + ++ LA              
Sbjct: 523 SP--DPQRAKFQIEFVDNDEIKNPITLAGLPGYGNYSRCYQYIKLAAELIQREFKYDYMV 580

Query: 551 ALVPDPDKLDNLASSAWQWPTLNVGIRLCGWGDDTVKYFLMGSPASTWLSTIAVVGFMGX 610
            L  D D+ D +  +  +WP           G+DT     + S     ++ + V    G 
Sbjct: 581 KLQNDNDENDKVHINKEKWPIYIT-------GNDTTDLIWLTSS----IAVVIVACRFGL 629

Query: 611 XXXXXXRWQRQYQDLSDAHDFNLFMMGGFYPLLGWGLHYMPFVIMSRV-TYVHHYLPALY 669
                  W+    D S   +  ++       LLGW +HY  F+  S     +  YLP+  
Sbjct: 630 QVMNWNPWKIDNGDSSSHLNMKIYHEFAIESLLGWFVHYYIFLKSSNDHLEIVLYLPSFV 689

Query: 670 FALLI 674
           FA L+
Sbjct: 690 FAHLL 694

>Kwal_33.14357
          Length = 657

 Score =  101 bits (251), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 107/425 (25%), Positives = 181/425 (42%), Gaps = 40/425 (9%)

Query: 87  SYYLRHEFYHDVHPPLGKMLVGLSGWMAGYNGSWDFPSGEEYPDYLDYVKMRIFNATFSA 146
           S Y++ EF+    PP    ++ L   + G                L    +R  N T +A
Sbjct: 69  SEYMKKEFFLMSSPPFMVQILALVSRIMGS---------------LSIEVLRKINLTTTA 113

Query: 147 LCIPLAYFTAKAIGFSLPTVWLFTILVIFENSYATLGRFILLDSMLLFFTVASMF---CF 203
             +   Y      G       +F +  +   S + L  F      L       +F   C 
Sbjct: 114 FVVSSFYLALSRSGV------VFVVSAVTAGSLSYLSLFAENSQHLSLINFQVLFLSCCL 167

Query: 204 VTFHN-QRSKPFSRKWWKWLLLTGVSLGCTISVKMVGLFIITLVGIYTVIELWTLLGDKK 262
           +++++ + S  F+R+W+  L    + L  ++S   +G    +   I  + ++W+++GD  
Sbjct: 168 LSWNSFKHSTSFTRRWYVALTSLSLFLSLSLSTTFLGAITWSWFLILMIKQMWSIVGDVD 227

Query: 263 VSKKAYAGHWLARILCLIIVPFLIFLACFKVHFDLLSHSGTGDANMPSLFQAGLAGSDVG 322
           VS      H   R+L +I VPF + L+ + V   LL+  G G  N  SL         + 
Sbjct: 228 VSMWKILKHTFWRVLMIICVPFGLMLSSYFVF--LLNSRGAG-MNHSSLVSPYFKTWFLP 284

Query: 323 DG---PRDIAVGSSIVSIKNQALGGSLLHSHVQGYPEGSNQQQVTCYG-HKDSNNNWLFD 378
            G   P  +  GS+++    ++LGG  LHSH   Y  GS +QQVT      D++N W+  
Sbjct: 285 QGLPQPDAVYYGSNLLIRHAESLGG-YLHSHNYTYESGSLEQQVTLVDFSNDADNEWI-- 341

Query: 379 RIRPLTPWSEEETEIEFVKPGSSYRLVHPNTGKNLHTHPIAAPITKSEW--EVSGYGTAE 436
            I       + +  ++ V+ G   +L H  +GK L      AP+++ ++  EVS  G  +
Sbjct: 342 -IEAQNENLKLDKTLQPVRNGDFVKLRHRTSGKLLRASSAKAPVSEQDYDHEVSCTGDHD 400

Query: 437 -VGDPKDHWVVEVVAQHGSEDESRLHPLTSSFRIKNAELGCYLAQTGAHLPEWGFRQSEV 495
             GD  + W +    +  + +E  L P T  F ++N    C L      LP+WGF Q EV
Sbjct: 401 YTGDSDETWRIR-FERGNTPNEGILCPFTMYFSLENKGHDCKLLSHDLRLPDWGFGQQEV 459

Query: 496 ACLKN 500
            C+ +
Sbjct: 460 LCVDS 464

>KLLA0C14828g complement(1292713..1294602) weakly similar to
           sp|Q06644 Saccharomyces cerevisiae YDR307w, start by
           similarity
          Length = 629

 Score = 95.5 bits (236), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 124/487 (25%), Positives = 192/487 (39%), Gaps = 56/487 (11%)

Query: 209 QRSKPFSRKWWKWLLLTGVSLGCTISVKMVGLFIITLVGIYTVIELWTLLGDKKVSKKAY 268
           Q SK FS  W+  + L  +SL   IS K +GL     + I ++  LW ++GD  V  +  
Sbjct: 175 QASKDFSVDWYMNITLVSMSLIFVISGKFIGLVSWIWLIIVSLKSLWIVVGDLDVKNRQL 234

Query: 269 AGHWLARILCLIIVPFLIFLACFKVHFDLLSHSGTGDANMPSLFQAGLAGSDVGDGPRDI 328
                 R+L  +++P +     +       + S    A M S FQ   + S   D P  I
Sbjct: 235 FAIMFCRLLFFVVIPLMSLWYSYSSLIGGFTTSSNSIAYMSSSFQ-HYSMSQHNDIPSSI 293

Query: 329 AVGSSIVSIKNQALGGSLLHSHVQGYPEGSNQQQVTCYGHKDSNNNWLFDRIRPLTPWSE 388
             GSSI      +LGG L    +  YP+ ++          D  N W+ +  +     +E
Sbjct: 294 IYGSSIRLRHVNSLGGYLSALEI-PYPKSNDTLVTVSDDPDDEANFWIIESNKGRN--TE 350

Query: 389 EETEIEFVKPGSSYRLVHPNTGKNLHTHPIAAPITKSEWE--VSGYGTAEV-GDPKDHWV 445
           +      VK     +L +  TG+ L       PI+  E++  +S  G ++  GD  + W 
Sbjct: 351 QTGSNALVKQTDKVKLRNKKTGQLLRASEEKPPISDKEYDKRISVTGDSDYQGDQDELWK 410

Query: 446 VEVVAQHGSEDESRLHPLTSSFRIKNAELGCYLAQTGAHLPEWGFRQSEVACLKNPFKRD 505
           +E+  Q  +     L P      +KN    C L      +P WG R+ EV C+ +P + +
Sbjct: 411 IEI--QGKASFREVLRPFKQFIVLKNPARRCSLLSHEIKIPHWGDRRQEVLCV-DPARVN 467

Query: 506 KRTWW-----NVETHTNEKLPGRPADFKYPKINF--IKNFIHLNLAMMATNNALVPDPDK 558
           +  ++     + E    EK    P ++ + K+ F  +     LN      N ++ P PD 
Sbjct: 468 RALFYIDFVSSPEAGVVEKYKWAP-EYPFYKLAFEYVVGQFRLNKRQNIDNTSMSP-PDC 525

Query: 559 LDNLASSAWQWPTL---NVGIRLCGWGDDTVK---YFLMGSPASTWLSTIAVVGFMGXXX 612
           L         WP L   N  I    W   TV    Y  M   A +WLS            
Sbjct: 526 L--------SWPILFDNNNQIGKILWITSTVSVGVYTFM--EAYSWLS------------ 563

Query: 613 XXXXRWQRQYQDLSDAHDFNLFMMG--GFYPLLGWGLHYMPFVI-MSRVTYVHHYLPALY 669
                W   ++D       N  M         LGW LH   F   + R   V+ Y+P+L 
Sbjct: 564 -----WN-IFEDTLLNTTANQLMKREVTLEAFLGWILHLYIFTYSLHRNLSVNQYMPSLL 617

Query: 670 FALLILS 676
           FA++ILS
Sbjct: 618 FAVIILS 624

>YDR307W (YDR307W) [1135] chr4 (1075857..1077845) Protein containing
           three MIR (protein mannosyltransferase, IP3R and RyR)
           domains, which may have a ligand transferase function,
           has weak similarity to mannosyltransferase (dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase, S.
           cerevisiae Pmt1p) [1989 bp, 662 aa]
          Length = 662

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 93/381 (24%), Positives = 163/381 (42%), Gaps = 34/381 (8%)

Query: 172 LVIFEN--SYATLGRFILLDSMLLFFTVASMFCFVTFHNQRSKPFSRKWWKWLLLTGVSL 229
           L+I  N  ++   G  I  DS+        ++ F++     +K  +  W+  ++   +SL
Sbjct: 137 LLILSNWETFRNEGTIISFDSLEWCLFSVVIYSFISI--SIAKLGTTNWFANVITLSISL 194

Query: 230 GCTISVKMVGLFIITLVGIYTVIELWTLLGDKKVSKKAYAGHWLARILCLIIVPFLIFLA 289
           G  IS K +G+     V +  V +   L+ D KV+        +  +L ++I+P  IF+ 
Sbjct: 195 GLAISSKFIGIVTWAFVILSFVRQFDRLISDVKVTTIQIIKFVILCLLFVLIIPGSIFII 254

Query: 290 CFKVHFDLLSHSGTGDAN----MPSLFQAGLAGSDVGDGPRDIAVGSSIVSIKNQALGGS 345
            +    +LLS+  T        M + F++ L G  V   P  +  GS+I      ++ G 
Sbjct: 255 SYS---NLLSNFKTDTPQFSKYMSTYFKSYLRGPQVQ--PSRLYYGSTITLRHLDSMVG- 308

Query: 346 LLHSHVQGYPEGSNQQQVT-CYGHKDSNNNWLFDRIRPLTPWSE--EETEIEFVKPGSSY 402
            L SH   YP   ++Q V   +    ++N WL +       +SE     ++  V+ G S 
Sbjct: 309 YLASHDISYPSDVDEQLVALSFEEFAADNEWLIEHPTLNLSFSEVYHADQLIPVEFGQSI 368

Query: 403 RLVHPNTGKNLHTHPIAAPITKSEWEVSGYGTAEV---GDPKDHWVVEVVA------QHG 453
           +L H +TGK L       PI++ +++     T +    G   + W V ++       +  
Sbjct: 369 KLRHKSTGKLLRASTAKPPISEQDYDFQISCTKDSNYEGGMDERWDVLLIKDEINNDKKD 428

Query: 454 SEDESRLHPLTSSFRIKNAELGCYLAQTGAHLPEWGFRQSEVACLKNPFKRDKRTWWNVE 513
           + D+  + PL S  R  N    C L      LPEWG  + EV C++ P     RT + ++
Sbjct: 429 NADDKYIKPLQSEIRFYNNGQRCGLLGHDLRLPEWGRFEQEVLCMEYPVI--PRTTFLID 486

Query: 514 THTNEKLPGRPADFKYPKINF 534
           +         P DF+ P I +
Sbjct: 487 S------VQLPVDFQVPMIEY 501

>Scas_710.0d
          Length = 271

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 68/147 (46%), Gaps = 5/147 (3%)

Query: 575 GIRLCGWGDDTVKYFLMGSPASTWLSTIAVVG-FMGXXXXXXXRWQRQYQDLSDAHDFNL 633
           GI   G  D  +  +L+G+ A  W S  A +G F+         WQ     L D    N 
Sbjct: 2   GISYWGEHDQHLGIYLLGN-AVVWWSVTAFIGIFVVLCLSELIAWQVGKPVLQDKDVIN- 59

Query: 634 FMMGGFYPLLGWGLHYMPFVIMSRVTYVHHYLPALYFALLILSYLFEAGLKGLNKTKGGQ 693
           F +   + LLG+ +H  P  +M R  ++HHYLPA YF +L   +  +     + + K   
Sbjct: 60  FHIQVIHYLLGFAVHIGPSFLMGRQMFLHHYLPAYYFGILAFGHALDITATYVLRRK-KN 118

Query: 694 LARTLIYVTYGAIVIYGFYYFSPISFG 720
            A TL+ V + A+  Y F   SPI +G
Sbjct: 119 FAYTLLAVFF-ALSYYFFKDHSPIIYG 144

>CAGL0J11044g complement(1073988..1076198) weakly similar to
           sp|Q06644 Saccharomyces cerevisiae YDR307w PMT7,
           hypothetical start
          Length = 736

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 86/204 (42%), Gaps = 33/204 (16%)

Query: 327 DIAVGSSIVSIKN-QALGGSLLHSHVQGYPEGSNQQQVTCYGHKDSN-NNWLFDRIRPLT 384
           +I    S V I++ ++LGG L       Y  GS +Q       +DS  NNW+ +      
Sbjct: 319 EIIFKKSTVRIRHVESLGGYLSTLPNVNYMSGSFEQIAFLSQFEDSELNNWIIE------ 372

Query: 385 PWSEEETEIEFVKPGSSYRLVHPNTGKNLHTHPIAAPITKSEW--EVSGYGTAEV-GDPK 441
           P +E +   E V+ GS  RL +  TGK L       P++  E+  EVS  G+A   GD  
Sbjct: 373 PSTEAQNNKE-VRSGSRIRLRNVVTGKLLRASSSRPPMSDQEYNSEVSLTGSANFSGDAD 431

Query: 442 DHWVVEVVAQHG------------SEDESRLHPLTSSFRIKNAELGCYLAQTGAHLP-EW 488
           + W+++     G            SE+ + L    S F ++N   GC L      LP +W
Sbjct: 432 ETWLIDQKYVIGKAIPFNKMGLPPSENINALINTNSVFTLRNDGHGCMLLSHDTDLPDDW 491

Query: 489 G--------FRQSEVACLKNPFKR 504
                    F + E+ C   P K+
Sbjct: 492 DSMSSFKPEFHRQELTCNTTPTKK 515

>Kwal_56.22934
          Length = 307

 Score = 37.4 bits (85), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 9/66 (13%)

Query: 351 VQGYPEGSNQQQVTCYGHKDSNNNWLFD-------RIRPLTPWSEEETEIEFVKPG--SS 401
           V   PE  + + + CY  K+ +N  L+D        IRP      E T++  ++    SS
Sbjct: 103 VTNLPETYSSKSLLCYSRKNISNVALYDDLAVKVFNIRPTNTSKTESTQLNIMELAQDSS 162

Query: 402 YRLVHP 407
            RLVHP
Sbjct: 163 VRLVHP 168

>YOR220W (YOR220W) [5012] chr15 (755328..756125) Protein of unknown
           function [798 bp, 265 aa]
          Length = 265

 Score = 32.7 bits (73), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 46/113 (40%), Gaps = 13/113 (11%)

Query: 121 DFPSGEEYPDYLDYVKMRIFNATFSALCIPLAYFTAKAIGFSLPTVWLFTILVIFENSYA 180
           D PSG+    +   ++  +F   F  L   L Y+T        P  +L  I++IF+N   
Sbjct: 15  DIPSGKFTSKWPTQLEKTLFKEQFPNLQSHLQYYT--------PLPFLNRIIIIFDNEDD 66

Query: 181 TLGRFILLDSMLLFFTVASMFCFVT---FHNQRSKPFSRKWWKWLLLTGVSLG 230
           TL  F  L  +L       M  FVT    +NQ   P SR     + L   +L 
Sbjct: 67  TLQVFKFLQELLAKENSGPMKLFVTESLLNNQH--PRSRSTDDAVSLQDNNLA 117

>CAGL0C01881g 196299..199298 similar to sp|P38041 Saccharomyces
           cerevisiae YBL085w BOB1 BEM1 protein-binding protein,
           hypothetical start
          Length = 999

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 38/86 (44%), Gaps = 13/86 (15%)

Query: 309 PSLFQAGLAGSDVGDGPRDIAVGSSIVSIKNQALGGSLLHSHVQGYPEGSNQQQVTCYGH 368
           PSL   GL+G     G RD+A+G S   I         L +H +    G  +  V    H
Sbjct: 492 PSLEMDGLSGRTSSSGTRDVALGDSDTPIN--------LPNHSRKS-SGLKRNSVVYKTH 542

Query: 369 KDSNNN----WLFDRIRPLTPWSEEE 390
           K S +      LF+RI  L+P  +E+
Sbjct: 543 KKSESGGSFVELFNRISMLSPGKDED 568

>ADR091W [1832] [Homologous to ScYDL194W (SNF3) - SH; ScYDL138W
           (RGT2) - SH] complement(872925..874919) [1995 bp, 664
           aa]
          Length = 664

 Score = 30.4 bits (67), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 37/80 (46%), Gaps = 10/80 (12%)

Query: 222 LLLTGVSLGCTISVKMVGLFIITLVGIYTVI----------ELWTLLGDKKVSKKAYAGH 271
           + + GVS    I+ K++ +FI   +  ++            E++ L    K +    A +
Sbjct: 431 IAIVGVSTDSVIAKKVMIVFICMFIAAFSATWGGVVWVMSAEMYPLGVRSKCAAICAASN 490

Query: 272 WLARILCLIIVPFLIFLACF 291
           WL   +C +I P+LI ++ +
Sbjct: 491 WLVNFVCAMITPYLIDISSY 510

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.139    0.450 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,005,888
Number of extensions: 1117204
Number of successful extensions: 2538
Number of sequences better than 10.0: 48
Number of HSP's gapped: 2396
Number of HSP's successfully gapped: 49
Length of query: 729
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 620
Effective length of database: 12,822,747
Effective search space: 7950103140
Effective search space used: 7950103140
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 65 (29.6 bits)