Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.71001781768371e-116
KLLA0A04103g7851812118e-20
Scas_643.24d7841561933e-17
YOR322C8181891519e-12
ACR291C684461297e-09
CAGL0F00737g795371217e-08
YDR081C (PDC2)92581632.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.7100
         (176 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.7100                                                          327   e-116
KLLA0A04103g 369258..371615 similar to sgd|S0005849 Saccharomyce...    86   8e-20
Scas_643.24d                                                           79   3e-17
YOR322C (YOR322C) [5104] chr15 complement(918601..921057) Protei...    63   9e-12
ACR291C [1338] [Homologous to ScYOR322C - SH] (888927..890981) [...    54   7e-09
CAGL0F00737g 82773..85160 similar to tr|Q12502 Saccharomyces cer...    51   7e-08
YDR081C (PDC2) [933] chr4 complement(607299..610076) Pyruvate de...    29   2.5  

>Kwal_26.7100
          Length = 178

 Score =  327 bits (837), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 161/176 (91%)

Query: 1   MGFPKLGHQHDKKYASNSSVDRIFSDTSNDGLVELLIDIESPPCVLYGTATESTGALLSG 60
           MGFPKLGHQHDKKYASNSSVDRIFSDTSNDGLVELLIDIESPPCVLYGTATESTGALLSG
Sbjct: 1   MGFPKLGHQHDKKYASNSSVDRIFSDTSNDGLVELLIDIESPPCVLYGTATESTGALLSG 60

Query: 61  LLKVRVKQPGDKISSSEPLSPVNSHGRKKKSSTGLNAISQTLSNLSLANANVSPVASPGI 120
           LLKVRVKQPGDKISSSEPLSPVNSHGRKKKSSTGLNAISQTLSNLSLANANVSPVASPGI
Sbjct: 61  LLKVRVKQPGDKISSSEPLSPVNSHGRKKKSSTGLNAISQTLSNLSLANANVSPVASPGI 120

Query: 121 SRTPSVIFTXXXXXXXXXXXXXXXRYAKPFDAQCNSIQSCLNCRSKDTERARWEKV 176
           SRTPSVIFT               RYAKPFDAQCNSIQSCLNCRSKDTERARWEKV
Sbjct: 121 SRTPSVIFTKALVKSVSLSLVQKVRYAKPFDAQCNSIQSCLNCRSKDTERARWEKV 176

>KLLA0A04103g 369258..371615 similar to sgd|S0005849 Saccharomyces
           cerevisiae YOR322c, hypothetical start
          Length = 785

 Score = 85.9 bits (211), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 65/181 (35%), Positives = 92/181 (50%), Gaps = 10/181 (5%)

Query: 1   MGFPKLGHQHDKKYASNSSVDRIFSDTSNDGLVELLIDIESPPCVLYGTATESTGALLSG 60
           MGFPK G    K  +S+SS+  +     +D  +EL I+IESPPCVLYG+ATES+GALL G
Sbjct: 1   MGFPKFGSS--KHNSSSSSLQALDYTNHDDHPIELSINIESPPCVLYGSATESSGALLGG 58

Query: 61  LLKVRVKQ--PGDKISSSEPLSPVNSHGRKKKSSTGLNAISQTLSNLSL------ANANV 112
           LL V +    P  +   S PL+PVNS  RK+ +++   ++S    + +       +  N+
Sbjct: 59  LLTVTINDDLPEIQPCKSTPLTPVNSGQRKQLTNSLTTSLSHLSLSHAHHAHHQKSGDNL 118

Query: 113 SPVASPGISRTPSVIFTXXXXXXXXXXXXXXXRYAKPFDAQCNSIQSCLNCRSKDTERAR 172
             +AS     TP    T                Y KPF      + +C NC++K TE  R
Sbjct: 119 KRLASMSNLITPPKAITSVSLNSVELSLIQKVHYEKPFRPSAAVLNTCTNCKTKITEFHR 178

Query: 173 W 173
           W
Sbjct: 179 W 179

>Scas_643.24d
          Length = 784

 Score = 79.0 bits (193), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 53/156 (33%), Positives = 83/156 (53%), Gaps = 17/156 (10%)

Query: 33  VELLIDIESPPCVLYGTATESTGALLSGLLKVRVKQPGDKIS--SSEPLSPVNSHGRK-- 88
           +EL I++ESPPCVLYG+A +STG+LLSG++ + VK P   +S  + + + P  S  +K  
Sbjct: 130 IELSINVESPPCVLYGSAADSTGSLLSGVVTLNVKDPYADVSIPTYDSIKPSKSAPQKSP 189

Query: 89  ----KKSSTGLNAISQTLSNLSLANAN-------VSPVASPGISRTPSVIFTXXXXXXXX 137
               +KS+ G + +S T S L++A +         +P  SP  ++  +  +T        
Sbjct: 190 RPGRRKSAIG-STLSTTFSQLAVAQSQATASSQKTTPSPSPSNTKIMNG-YTKISVTSVS 247

Query: 138 XXXXXXXRYAKPFDAQCNSIQSCLNCRSKDTERARW 173
                   + KPF    +SIQSC NCR+K T+   W
Sbjct: 248 LTFVQKIHFHKPFTPDTSSIQSCTNCRTKLTDMKSW 283

>YOR322C (YOR322C) [5104] chr15 complement(918601..921057) Protein
           of unknown function, has low similarity to
           uncharacterized C. albicans Orf6.578p [2457 bp, 818 aa]
          Length = 818

 Score = 62.8 bits (151), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 58/189 (30%), Positives = 90/189 (47%), Gaps = 22/189 (11%)

Query: 1   MGFPKLGHQHDKKYASNSSVDRIFSDTSNDGL---VELLIDIESPPCVLYGTATESTGAL 57
           M F +L   H   +         +S+++  G    + L ID+ESPPCVLYG+A ES+GA+
Sbjct: 1   MAFSRLTSTHQSNHNG-------YSNSNKKGQSLPLTLSIDVESPPCVLYGSAMESSGAV 53

Query: 58  LSGLLKVRVKQP----GDK-ISSSEPLSPVNSHGRKKKSSTG--LNAISQTLSNLSLANA 110
           LSGL  V V  P     DK + ++E      S   K+KS+ G  L++   +LS  +   +
Sbjct: 54  LSGLFTVTVVDPYSSAEDKSLKNTESNVSTTSKSLKRKSTFGSALSSRLSSLSASTSNIS 113

Query: 111 NVSPVASPGISRTPSVI-----FTXXXXXXXXXXXXXXXRYAKPFDAQCNSIQSCLNCRS 165
             +   S   S TP+ +     +T                + KPF    +S+Q+C+NC++
Sbjct: 114 PSTSSTSISHSPTPANLRIMAGYTKITITSVTLSLVQKIHFHKPFVPNISSMQTCMNCKT 173

Query: 166 KDTERARWE 174
           K T    WE
Sbjct: 174 KITNMKSWE 182

>ACR291C [1338] [Homologous to ScYOR322C - SH] (888927..890981)
          [2055 bp, 684 aa]
          Length = 684

 Score = 54.3 bits (129), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 28/46 (60%), Positives = 34/46 (73%)

Query: 25 SDTSNDGLVELLIDIESPPCVLYGTATESTGALLSGLLKVRVKQPG 70
          S   +D +VEL ++IESPPCVLYG  TES GALLSGL+ V V+  G
Sbjct: 14 SAGGSDHVVELGLEIESPPCVLYGPPTESAGALLSGLVTVHVQGAG 59

 Score = 28.5 bits (62), Expect = 3.6,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 2/31 (6%)

Query: 146 YAKPFDAQCNSIQSCLNCRSKDTERARWEKV 176
           Y +PF A    + SC  CR +  E ARWE V
Sbjct: 80  YGRPFVA--GPLGSCAACRERRRELARWEVV 108

>CAGL0F00737g 82773..85160 similar to tr|Q12502 Saccharomyces
          cerevisiae YOR322c, hypothetical start
          Length = 795

 Score = 51.2 bits (121), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 21/37 (56%), Positives = 30/37 (81%)

Query: 33 VELLIDIESPPCVLYGTATESTGALLSGLLKVRVKQP 69
          ++L +++ESPPCVLYG+AT+S GA+L G   +RVK P
Sbjct: 57 IDLELNLESPPCVLYGSATDSAGAVLCGQFVLRVKDP 93

>YDR081C (PDC2) [933] chr4 complement(607299..610076) Pyruvate
           decarboxylase regulatory protein [2778 bp, 925 aa]
          Length = 925

 Score = 28.9 bits (63), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 5/81 (6%)

Query: 49  TATESTGALLSGLLKVRVK-QPGDKISSSEPLSPVNSHGRKKKSSTGLNAISQ-TLSNLS 106
           TA  ++ ++ + LL+ R + QP D    +  LS  +  G    SS   NAISQ +L+N  
Sbjct: 692 TAMANSNSITTALLESRNQAQPFDVPHMNGLLSDTSKSGHSVNSS---NAISQNSLNNFQ 748

Query: 107 LANANVSPVASPGISRTPSVI 127
             +A+V+  +SP I+ +P  I
Sbjct: 749 HNSASVAEASSPSITPSPVAI 769

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.127    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,193,795
Number of extensions: 186619
Number of successful extensions: 599
Number of sequences better than 10.0: 25
Number of HSP's gapped: 589
Number of HSP's successfully gapped: 26
Length of query: 176
Length of database: 16,596,109
Length adjustment: 95
Effective length of query: 81
Effective length of database: 13,307,399
Effective search space: 1077899319
Effective search space used: 1077899319
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 58 (26.9 bits)