Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.709583882742830.0
Kwal_26.68059448142662e-23
ADR403C9705672421e-20
Sklu_2434.109835612206e-18
KLLA0A03443g9755482162e-17
Scas_663.129444842063e-16
KLLA0A03421g8805451912e-14
ADR404C8754261812e-13
Scas_556.610226001652e-11
CAGL0J07150g10225431553e-10
CAGL0M12298g994631535e-10
Sklu_2064.29225491482e-09
Sklu_2376.69225201472e-09
Scas_674.12*909541455e-09
YOR363C (PIP2)996401438e-09
YAL051W (OAF1)1062541374e-08
ACR241C795571365e-08
Kwal_34.157516281321331e-07
KLLA0A06039g657461312e-07
KLLA0D05038g673631302e-07
ADR405C807521302e-07
CAGL0C01199g922301267e-07
KLLA0F18084g860341268e-07
Kwal_23.3122788301259e-07
YMR019W (STB4)949621251e-06
YLR228C (ECM22)814301232e-06
Scas_679.26775391232e-06
YDR213W (UPC2)913301232e-06
KLLA0C14212g1040471232e-06
Kwal_33.13934797411232e-06
CAGL0F07865g844301232e-06
AGL091W866301223e-06
Sklu_1622.2778441213e-06
Kwal_55.20674252491164e-06
Kwal_56.23058775611204e-06
KLLA0C17050g955421196e-06
KLLA0A04169g775301186e-06
Kwal_55.20722827431187e-06
YJL089W (SIP4)829641188e-06
YCR106W (RDS1)832411178e-06
Scas_709.51759641151e-05
YLL054C769451152e-05
ABL099W800501142e-05
KLLA0C19228g591411142e-05
YLR014C (PPR1)904481142e-05
Sklu_2268.2875411142e-05
Sklu_2411.11687551133e-05
YDR034C (LYS14)790401133e-05
Sklu_2397.8848441133e-05
KLLA0F04213g768301124e-05
CAGL0K11902g831441114e-05
KLLA0F22990g1253461124e-05
AFR171W612361115e-05
CAGL0B03421g1355331115e-05
AFR096W852481115e-05
Scas_661.23741761105e-05
Scas_234.1337611086e-05
YLR256W (HAP1)1502401106e-05
Kwal_56.24566755411098e-05
Kwal_47.17233948511098e-05
CAGL0I07755g1053611098e-05
Scas_521.2890491099e-05
Scas_550.5*832361099e-05
AFR117C1152401099e-05
CAGL0F07909g1049441099e-05
CAGL0L03377g1209611091e-04
Scas_637.7998481081e-04
Kwal_26.6664579381081e-04
AGL233C872511081e-04
ACL058W817511081e-04
KLLA0F00572g597491081e-04
Kwal_23.6425735411081e-04
Scas_573.41478461081e-04
Scas_721.94869301071e-04
Scas_688.17769461071e-04
Scas_626.6839391071e-04
KLLA0A03399g8455491072e-04
KLLA0D10153g655401052e-04
KLLA0D00484g1004671062e-04
YKR064W863411052e-04
Scas_638.141043751052e-04
KLLA0F14322g717481043e-04
Scas_702.71113431053e-04
YHR056C (RSC30)883381043e-04
Kwal_27.9688841391034e-04
KLLA0F02387g727461034e-04
Kwal_23.6529598531034e-04
YDR303C (RSC3)885431034e-04
Kwal_47.17506924401035e-04
AGL099C747581026e-04
Scas_588.11835301026e-04
YNR063W607441016e-04
KLLA0D12672g865341018e-04
Sklu_2296.6919481018e-04
AAL057C809431008e-04
YOR337W (TEA1)759331000.001
AAL175W883381000.001
YLR266C (PDR8)70154990.001
CAGL0M05907g89136990.001
CAGL0L04400g98740990.001
Sklu_1973.177733990.001
KLLA0D01452g144571990.001
CAGL0H01507g79443990.001
KLLA0F10835g75630990.001
ACR028C60143990.001
AGL361C69662990.001
Kwal_14.26191167187990.001
KLLA0E14036g67840980.001
Kwal_47.1808974542980.001
Scas_680.2573855980.002
CAGL0K05841g137230980.002
CAGL0H06875g70228980.002
KLLA0F02750g114847980.002
Scas_518.591964980.002
KLLA0D10197g85637970.002
KLLA0F09559g65860970.002
YKL222C70532960.002
CAGL0A00451g110755960.003
KLLA0F04609g91643960.003
KLLA0E19701g68150950.003
KLLA0A10329g63948950.004
Scas_696.44116450950.004
Sklu_1373.260837940.004
CAGL0D03850g83438950.004
Scas_542.890253950.004
Kwal_27.10232120951950.004
Sklu_1993.282357940.004
YBL005W (PDR3)97656940.005
YML099C (ARG81)88048940.005
Kwal_26.7160388185930.005
Scas_720.5889031940.005
Sklu_2191.271831930.005
ABL121C128548930.006
Scas_596.470143920.007
Sklu_2335.694064930.007
CAGL0M03025g125453930.008
CAGL0E05434g81656920.008
Kwal_23.475481243920.008
Scas_699.793542920.008
YGL013C (PDR1)106840920.009
KLLA0A02585g37052910.009
YOL089C (HAL9)103062910.010
CAGL0L04576g86533910.011
Kwal_23.290588134910.011
Kwal_56.2260586553910.011
Kwal_14.81956830910.011
Sklu_2301.151734900.011
KLLA0F20680g78737910.012
KLLA0E02618g110972910.012
Scas_662.890638900.013
KLLA0A01804g94566900.014
Sklu_2023.365849900.014
KLLA0C10923g77534900.015
YMR280C (CAT8)143329890.018
KLLA0F22880g116436890.018
Sklu_2321.390634890.020
Scas_659.1075741890.021
YPR196W47038880.021
KLLA0C04620g126951890.022
AGL206C73562880.023
YIL130W96437880.024
YDR207C (UME6)83637880.024
CAGL0F05357g60141880.025
YPL248C (GAL4)88131880.028
Kwal_23.317861140870.030
KLLA0F19602g60338870.030
KLLA0C16489g72840870.030
CAGL0D02904g88730870.032
CAGL0G08844g84745870.033
YDR421W (ARO80)95070870.033
Scas_715.3111534870.034
Kwal_26.701465444860.036
KLLA0A09119g108239860.039
CAGL0I02552g100555860.039
KLLA0D11286g67858860.040
ADR199C94437860.040
AER370W80138860.040
Scas_657.385631860.041
KLLA0E18194g86540860.042
YLR278C134139860.042
YBR150C (TBS1)109452860.043
YKL038W (RGT1)117058860.043
Scas_669.863738860.043
CAGL0G09757g142339860.045
Scas_526.3110939860.046
Scas_625.5114159860.047
YOR162C (YRR1)81070860.048
Scas_590.2117238860.048
Kwal_23.653755250850.049
CAGL0F02519g83235850.050
AFL160C64831850.051
Scas_691.3290668850.052
ABR174W86455850.052
Scas_702.7d97841850.052
Sklu_2384.683145850.053
CAGL0F09229g83549850.056
ADR365W70150850.059
Kwal_56.2467064337840.066
YLR098C (CHA4)64844840.068
KLLA0F10373g34839820.085
Kwal_47.1756562852830.090
Scas_709.65*65157830.094
Kwal_55.2188488248830.10
CAGL0F07755g61131820.11
Scas_630.1470161820.11
YDR520C77266820.12
YBR240C (THI2)45053810.13
AGR369W105136820.13
Scas_449.163633810.14
KLLA0D10593g92571820.14
KLLA0C03201g65054810.14
AFR722C81058810.15
Kwal_47.1693966941810.15
Kwal_26.673267641810.15
Scas_597.254065810.16
Kwal_23.437069264810.17
Kwal_23.401662836800.19
YOR172W (YRM1)78641800.20
AER291C66334800.21
KLLA0D00396g36135790.21
YDL170W (UGA3)52830800.21
YHR178W (STB5)74340800.21
YBR297W (MAL33)46842790.22
Kwal_14.163144342790.23
KLLA0D09977g63441800.23
KLLA0F25630g100761800.25
KLLA0D12650g65135790.26
Kwal_26.744871421790.29
Kwal_33.1311877954790.29
AER183C87937790.30
YBL066C (SEF1)105736790.33
YKL015W (PUT3)97940780.40
YJL206C75843780.40
Sklu_2082.18241700.44
Kwal_47.1686274343770.46
AGR280C110639770.47
YGR288W (MAL13)47343770.47
KLLA0B04620g91943770.48
AGR061C61230760.60
KLLA0E20405g113836760.62
Kwal_14.163645638760.62
Scas_610.980948760.64
YLR451W (LEU3)88658760.65
AFL031W51738750.67
Scas_564.9*60946760.68
Scas_711.3193229760.68
YMR168C (CEP3)60833760.69
AFL033W38243740.88
CAGL0F03025g92867750.90
ACL096W83550740.98
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.7095
         (827 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.7095                                                         1654   0.0  
Kwal_26.6805                                                          107   2e-23
ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    98   1e-20
Sklu_2434.10 YAL051W, Contig c2434 22765-25716                         89   6e-18
KLLA0A03443g 311628..314555 weakly similar to sp|P39720 Saccharo...    88   2e-17
Scas_663.12                                                            84   3e-16
KLLA0A03421g 308414..311056 weakly similar to sp|P39720 Saccharo...    78   2e-14
ADR404C [2144] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    74   2e-13
Scas_556.6                                                             68   2e-11
CAGL0J07150g complement(686734..689802) similar to sp|P39720 Sac...    64   3e-10
CAGL0M12298g complement(1225753..1228737) similar to sp|P39720 S...    64   5e-10
Sklu_2064.2 , Contig c2064 873-3641                                    62   2e-09
Sklu_2376.6 , Contig c2376 12573-15341 reverse complement              61   2e-09
Scas_674.12*                                                           60   5e-09
YOR363C (PIP2) [5140] chr15 complement(1020218..1023208) Transcr...    60   8e-09
YAL051W (OAF1) [17] chr1 (48565..51753) Transcription factor req...    57   4e-08
ACR241C [1288] [Homologous to ScYKR064W - SH] (784358..786745) [...    57   5e-08
Kwal_34.15751                                                          56   1e-07
KLLA0A06039g 557368..559341 weakly similar to sp|P36023 Saccharo...    55   2e-07
KLLA0D05038g 433653..435674 weakly similar to sp|P40971 Saccharo...    55   2e-07
ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    55   2e-07
CAGL0C01199g complement(121944..124712) similar to tr|Q12151 Sac...    53   7e-07
KLLA0F18084g complement(1652031..1654613) no similarity, hypothe...    53   8e-07
Kwal_23.3122                                                           53   9e-07
YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding prote...    53   1e-06
YLR228C (ECM22) [3628] chr12 complement(600021..602465) Sterol r...    52   2e-06
Scas_679.26                                                            52   2e-06
YDR213W (UPC2) [1051] chr4 (889744..892485) Sterol regulatory el...    52   2e-06
KLLA0C14212g complement(1229219..1232341) some similarities with...    52   2e-06
Kwal_33.13934                                                          52   2e-06
CAGL0F07865g complement(768270..770804) similar to tr|Q12151 Sac...    52   2e-06
AGL091W [4220] [Homologous to ScYLR228C (ECM22) - SH; ScYDR213W ...    52   3e-06
Sklu_1622.2 YDR034C, Contig c1622 1522-3858                            51   3e-06
Kwal_55.20674                                                          49   4e-06
Kwal_56.23058                                                          51   4e-06
KLLA0C17050g 1490472..1493339 some similarities with ca|CA3454|I...    50   6e-06
KLLA0A04169g complement(376273..378600) similar to sgd|S0004218 ...    50   6e-06
Kwal_55.20722                                                          50   7e-06
YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional act...    50   8e-06
YCR106W (RDS1) [627] chr3 (310954..313452) Protein with similari...    50   8e-06
Scas_709.51                                                            49   1e-05
YLL054C (YLL054C) [3369] chr12 complement(32894..35203) Protein ...    49   2e-05
ABL099W [493] [Homologous to ScYDR034C (LYS14) - SH] complement(...    49   2e-05
KLLA0C19228g 1713787..1715562 similar to sp|P53749 Saccharomyces...    49   2e-05
YLR014C (PPR1) [3432] chr12 complement(172267..174981) Transcrip...    49   2e-05
Sklu_2268.2 YKR064W, Contig c2268 4260-6887 reverse complement         49   2e-05
Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement      48   3e-05
YDR034C (LYS14) [885] chr4 complement(509732..512104) Transcript...    48   3e-05
Sklu_2397.8 YML099C, Contig c2397 9784-12330                           48   3e-05
KLLA0F04213g 400673..402979 similar to sp|P40971 Saccharomyces c...    48   4e-05
CAGL0K11902g complement(1148381..1150876) similar to sp|P40971 S...    47   4e-05
KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces...    48   4e-05
AFR171W [3363] [Homologous to NOHBY] complement(752592..754430) ...    47   5e-05
CAGL0B03421g complement(336071..340138) similar to sp|P12351 Sac...    47   5e-05
AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH] complement(...    47   5e-05
Scas_661.23                                                            47   5e-05
Scas_234.1                                                             46   6e-05
YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription facto...    47   6e-05
Kwal_56.24566                                                          47   8e-05
Kwal_47.17233                                                          47   8e-05
CAGL0I07755g complement(745315..748476) similar to tr|Q12180 Sac...    47   8e-05
Scas_521.2                                                             47   9e-05
Scas_550.5*                                                            47   9e-05
AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH] (646832..65...    47   9e-05
CAGL0F07909g 776659..779808 some similarities with tr|Q12180 Sac...    47   9e-05
CAGL0L03377g complement(382932..386561) some similarities with s...    47   1e-04
Scas_637.7                                                             46   1e-04
Kwal_26.6664                                                           46   1e-04
AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH] ...    46   1e-04
ACL058W [991] [Homologous to NOHBY] complement(261723..264176) [...    46   1e-04
KLLA0F00572g complement(42710..44503) some similarities with ca|...    46   1e-04
Kwal_23.6425                                                           46   1e-04
Scas_573.4                                                             46   1e-04
Scas_721.94                                                            46   1e-04
Scas_688.17                                                            46   1e-04
Scas_626.6                                                             46   1e-04
KLLA0A03399g 305616..308153 weakly similar to sp|P39720 Saccharo...    46   2e-04
KLLA0D10153g 858016..859983 weakly similar to sp|P35995 Saccharo...    45   2e-04
KLLA0D00484g 44879..47893 no similarity, hypothetical start            45   2e-04
YKR064W (YKR064W) [3315] chr11 (562189..564780) Protein with sim...    45   2e-04
Scas_638.14                                                            45   2e-04
KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1 Kluyver...    45   3e-04
Scas_702.7                                                             45   3e-04
YHR056C (RSC30) [2344] chr8 complement(215184..217835) Component...    45   3e-04
Kwal_27.9688                                                           44   4e-04
KLLA0F02387g complement(213669..215852) similar to sp|P47988 Sac...    44   4e-04
Kwal_23.6529                                                           44   4e-04
YDR303C (RSC3) [1131] chr4 complement(1068721..1071378) Componen...    44   4e-04
Kwal_47.17506                                                          44   5e-04
AGL099C [4213] [Homologous to ScYDR207C (UME6) - SH] (516587..51...    44   6e-04
Scas_588.11                                                            44   6e-04
YNR063W (YNR063W) [4646] chr14 (746940..748763) Protein with sim...    44   6e-04
KLLA0D12672g complement(1076011..1078608) gi|125903|sp|P08657|LA...    44   8e-04
Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement       44   8e-04
AAL057C [130] [Homologous to ScYDR303C (RSC3) - SH; ScYHR056C (R...    43   8e-04
YOR337W (TEA1) [5116] chr15 (954339..956618) Ty1 enhancer activa...    43   0.001
AAL175W [12] [Homologous to ScYML099C (ARG81) - NSH] complement(...    43   0.001
YLR266C (PDR8) [3660] chr12 complement(675621..677726) Zn[2]-Cys...    43   0.001
CAGL0M05907g 622029..624704 similar to sp|P36023 Saccharomyces c...    43   0.001
CAGL0L04400g complement(511762..514725) similar to tr|Q12340 Sac...    43   0.001
Sklu_1973.1 YDR303C, Contig c1973 815-3148 reverse complement          43   0.001
KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyc...    43   0.001
CAGL0H01507g complement(147689..150073) similar to sp|Q06639 Sac...    43   0.001
KLLA0F10835g 997512..999782 no similarity, hypothetical start          43   0.001
ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp, ...    43   0.001
AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 69...    43   0.001
Kwal_14.2619                                                           43   0.001
KLLA0E14036g complement(1239566..1241602) some similarities with...    42   0.001
Kwal_47.18089                                                          42   0.001
Scas_680.25                                                            42   0.002
CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces c...    42   0.002
CAGL0H06875g complement(682518..684626) some similarities with s...    42   0.002
KLLA0F02750g complement(250368..253814) some similarities with s...    42   0.002
Scas_518.5                                                             42   0.002
KLLA0D10197g complement(861726..864296) similar to sp|P05085 Sac...    42   0.002
KLLA0F09559g complement(876719..878695) some similarities with s...    42   0.002
YKL222C (YKL222C) [3053] chr11 complement(3504..5621) Protein wi...    42   0.002
CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces cer...    42   0.003
KLLA0F04609g complement(451579..454329) similar to sp|P40467 Sac...    42   0.003
KLLA0E19701g complement(1739869..1741914) some similarities with...    41   0.003
KLLA0A10329g 903873..905792 some similarities with ca|CA6113|IPF...    41   0.004
Scas_696.44                                                            41   0.004
Sklu_1373.2 YDR207C, Contig c1373 1069-2895                            41   0.004
CAGL0D03850g 384689..387193 weakly similar to sp|Q06639 Saccharo...    41   0.004
Scas_542.8                                                             41   0.004
Kwal_27.10232                                                          41   0.004
Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement         41   0.004
YBL005W (PDR3) [189] chr2 (217435..220365) Zinc-finger transcrip...    41   0.005
YML099C (ARG81) [3872] chr13 complement(74398..77040) Component ...    41   0.005
Kwal_26.7160                                                           40   0.005
Scas_720.58                                                            41   0.005
Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement         40   0.005
ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH] (170784..174...    40   0.006
Scas_596.4                                                             40   0.007
Sklu_2335.6 YBL005W, Contig c2335 10191-13013                          40   0.007
CAGL0M03025g complement(341849..345613) similar to sp|P39113 Sac...    40   0.008
CAGL0E05434g 532577..535027 similar to sp|P47988 Saccharomyces c...    40   0.008
Kwal_23.4754                                                           40   0.008
Scas_699.7                                                             40   0.008
YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finge...    40   0.009
KLLA0A02585g complement(226562..227674) some similarities with c...    40   0.009
YOL089C (HAL9) [4731] chr15 complement(150397..153489) Protein i...    40   0.010
CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces c...    40   0.011
Kwal_23.2905                                                           40   0.011
Kwal_56.22605                                                          40   0.011
Kwal_14.819                                                            40   0.011
Sklu_2301.1 , Contig c2301 1246-2795 reverse complement                39   0.011
KLLA0F20680g 1924148..1926511 weakly similar to sp|P39001 Saccha...    40   0.012
KLLA0E02618g 244696..248025 no similarity, hypothetical start          40   0.012
Scas_662.8                                                             39   0.013
KLLA0A01804g complement(159689..162526) similar to sgd|S0002829 ...    39   0.014
Sklu_2023.3 YHR178W, Contig c2023 2677-4653 reverse complement         39   0.014
KLLA0C10923g complement(939148..941475) similar to sp|P07272 Sac...    39   0.015
YMR280C (CAT8) [4234] chr13 complement(827027..831328) Transcrip...    39   0.018
KLLA0F22880g 2123577..2127071 some similarities with ca|CA3639|I...    39   0.018
Sklu_2321.3 YLR014C, Contig c2321 8747-11467                           39   0.020
Scas_659.10                                                            39   0.021
YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive regulat...    39   0.021
KLLA0C04620g complement(422705..426514) weakly similar to sp|Q05...    39   0.022
AGL206C [4106] [Homologous to NOHBY] (311846..314053) [2208 bp, ...    39   0.023
YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that cont...    39   0.024
YDR207C (UME6) [1046] chr4 complement(865005..867515) Global tra...    39   0.024
CAGL0F05357g 541830..543635 some similarities with sp|P39001 Sac...    39   0.025
YPL248C (GAL4) [5202] chr16 complement(79711..82356) Transcripti...    39   0.028
Kwal_23.3178                                                           38   0.030
KLLA0F19602g complement(1814949..1816760) similar to sp|P43634 S...    38   0.030
KLLA0C16489g 1444456..1446642 some similarities with ca|CA2184|I...    38   0.030
CAGL0D02904g complement(302952..305615) similar to sp|P07272 Sac...    38   0.032
CAGL0G08844g complement(846590..849133) similar to sp|P40467 Sac...    38   0.033
YDR421W (ARO80) [1245] chr4 (1312028..1314880) Positive transcri...    38   0.033
Scas_715.3                                                             38   0.034
Kwal_26.7014                                                           38   0.036
KLLA0A09119g complement(797533..800781) weakly similar to sp|P12...    38   0.039
CAGL0I02552g 227257..230274 weakly similar to sp|P38699 Saccharo...    38   0.039
KLLA0D11286g complement(964642..966678) no similarity, hypotheti...    38   0.040
ADR199C [1940] [Homologous to ScYDR421W (ARO80) - SH] (1048530.....    38   0.040
AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH] complement(...    38   0.040
Scas_657.3                                                             38   0.041
KLLA0E18194g 1613115..1615712 similar to sp|P25502 Saccharomyces...    38   0.042
YLR278C (YLR278C) [3671] chr12 complement(700001..704026) Protei...    38   0.042
YBR150C (TBS1) [335] chr2 complement(541165..544449) Protein wit...    38   0.043
YKL038W (RGT1) [3220] chr11 (365248..368760) Protein involved in...    38   0.043
Scas_669.8                                                             38   0.043
CAGL0G09757g 930351..934622 some similarities with sp|Q05854 Sac...    38   0.045
Scas_526.3                                                             38   0.046
Scas_625.5                                                             38   0.047
YOR162C (YRR1) [4961] chr15 complement(639560..641992) Transcrip...    38   0.048
Scas_590.2                                                             38   0.048
Kwal_23.6537                                                           37   0.049
CAGL0F02519g 245120..247618 weakly similar to sp|P39529 Saccharo...    37   0.050
AFL160C [3035] [Homologous to ScYPL248C (GAL4) - SH] (130842..13...    37   0.051
Scas_691.32                                                            37   0.052
ABR174W [767] [Homologous to ScYLR451W (LEU3) - SH] complement(7...    37   0.052
Scas_702.7d                                                            37   0.052
Sklu_2384.6 YKL015W, Contig c2384 10929-13424                          37   0.053
CAGL0F09229g complement(908186..910693) weakly similar to sp|P39...    37   0.056
ADR365W [2106] [Homologous to ScYOR337W (TEA1) - SH] complement(...    37   0.059
Kwal_56.24670                                                          37   0.066
YLR098C (CHA4) [3513] chr12 complement(337528..339474) Zinc-fing...    37   0.068
KLLA0F10373g 957948..958994 some similarities with sp|P38141 Sac...    36   0.085
Kwal_47.17565                                                          37   0.090
Scas_709.65*                                                           37   0.094
Kwal_55.21884                                                          37   0.10 
CAGL0F07755g complement(755947..757782) similar to sp|P40969 Sac...    36   0.11 
Scas_630.14                                                            36   0.11 
YDR520C (YDR520C) [1333] chr4 complement(1481073..1483391) Prote...    36   0.12 
YBR240C (THI2) [419] chr2 complement(700447..701799) Zinc-finger...    36   0.13 
AGR369W [4680] [Homologous to ScYBL066C (SEF1) - SH] complement(...    36   0.13 
Scas_449.1                                                             36   0.14 
KLLA0D10593g complement(900326..903103) similar to sp|P08638 Sac...    36   0.14 
KLLA0C03201g complement(286973..288925) similar to sp|P39529 Sac...    36   0.14 
AFR722C [3915] [Homologous to ScYDR520C - SH] (1765420..1767852)...    36   0.15 
Kwal_47.16939                                                          36   0.15 
Kwal_26.6732                                                           36   0.15 
Scas_597.2                                                             36   0.16 
Kwal_23.4370                                                           36   0.17 
Kwal_23.4016                                                           35   0.19 
YOR172W (YRM1) [4969] chr15 (654210..656570) Protein with simila...    35   0.20 
AER291C [2793] [Homologous to ScYHR178W (STB5) - SH] (1172383..1...    35   0.21 
KLLA0D00396g complement(36277..37362) some similarities with ca|...    35   0.21 
YDL170W (UGA3) [701] chr4 (156319..157905) Transcriptional activ...    35   0.21 
YHR178W (STB5) [2464] chr8 (459297..461528) Probable transcripti...    35   0.21 
YBR297W (MAL33) [474] chr2 (800479..801885) Maltose fermentation...    35   0.22 
Kwal_14.1631                                                           35   0.23 
KLLA0D09977g complement(841852..843756) weakly similar to sp|P40...    35   0.23 
KLLA0F25630g 2378464..2381487 some similarities with sp|P32862 S...    35   0.25 
KLLA0D12650g complement(1073580..1075535) weakly similar to ca|C...    35   0.26 
Kwal_26.7448                                                           35   0.29 
Kwal_33.13118                                                          35   0.29 
AER183C [2685] [Homologous to ScYOL089C (HAL9) - NSH] (975879..9...    35   0.30 
YBL066C (SEF1) [131] chr2 complement(96906..100079) Protein with...    35   0.33 
YKL015W (PUT3) [3241] chr11 (408187..411126) Transcription facto...    35   0.40 
YJL206C (YJL206C) [2722] chr10 complement(47659..49935) Protein ...    35   0.40 
Sklu_2082.1 YER184C, Contig c2082 2025-2273                            32   0.44 
Kwal_47.16862                                                          34   0.46 
AGR280C [4591] [Homologous to ScYLR278C - SH] (1266918..1270238)...    34   0.47 
YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway r...    34   0.47 
KLLA0B04620g complement(413129..415888) some similarities with s...    34   0.48 
AGR061C [4371] [Homologous to ScYLR098C (CHA4) - SH] (831058..83...    34   0.60 
KLLA0E20405g <1805948..1809364 gi|3024604|sp|P87164|SEF1_KLULA K...    34   0.62 
Kwal_14.1636                                                           34   0.62 
Scas_610.9                                                             34   0.64 
YLR451W (LEU3) [3825] chr12 (1036089..1038749) Transcription fac...    34   0.65 
AFL031W [3162] [Homologous to ScYBR239C - SH] complement(376161....    33   0.67 
Scas_564.9*                                                            34   0.68 
Scas_711.31                                                            34   0.68 
YMR168C (CEP3) [4123] chr13 complement(597331..599157) Component...    34   0.69 
AFL033W [3160] [Homologous to ScYBR240C (THI2) - SH] complement(...    33   0.88 
CAGL0F03025g 295783..298569 similar to sp|Q04052 Saccharomyces c...    33   0.90 
ACL096W [953] [Homologous to ScYKL015W (PUT3) - SH] complement(1...    33   0.98 
CAGL0L01903g 218703..222566 similar to sp|P32862 Saccharomyces c...    33   1.0  
CAGL0A00583g 65286..67226 weakly similar to sp|Q06149 Saccharomy...    33   1.1  
CAGL0H00396g complement(37005..39827) similar to sp|P08638 Sacch...    33   1.3  
Scas_685.22                                                            33   1.4  
AER044W [2549] [Homologous to ScYLR383W (RHC18) - SH] complement...    33   1.4  
Kwal_26.8109                                                           33   1.6  
Kwal_8.580                                                             32   1.7  
Scas_710.10                                                            32   1.8  
AER153W [2656] [Homologous to ScYML076C (WAR1) - SH] complement(...    32   1.8  
CAGL0L09691g complement(1039799..1042273) some similarities with...    32   1.8  
Scas_717.33                                                            32   2.0  
Scas_597.4                                                             32   2.1  
Kwal_27.10852                                                          32   2.2  
KLLA0C01023g 76863..78773 similar to sgd|S0002928 Saccharomyces ...    32   2.4  
CAGL0K06985g 681115..682905 similar to sp|P38140 Saccharomyces c...    32   2.9  
Scas_684.8                                                             31   3.0  
YJL103C (YJL103C) [2812] chr10 complement(228942..230798) Protei...    32   3.1  
Kwal_47.17681                                                          32   3.7  
Kwal_14.915                                                            32   3.8  
Scas_672.27                                                            31   3.9  
YDL143W (CCT4) [725] chr4 (199997..201583) Component of Chaperon...    31   4.4  
CAGL0M02651g complement(304583..305971) similar to sp|P19541 Sac...    31   4.7  
KLLA0A09251g 808253..810319 some similarities with sp|P38699 Sac...    31   4.8  
AGL083W [4228] [Homologous to ScYKL038W (RGT1) - SH; ScYBR033W (...    30   6.6  
YER184C (YER184C) [1612] chr5 complement(556291..558675) Protein...    30   7.5  
AGL147C [4165] [Homologous to ScYDR170C (SEC7) - SH] (420751..42...    30   8.0  
Kwal_27.10365                                                          30   9.4  

>Kwal_26.7095
          Length = 838

 Score = 1654 bits (4283), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 799/827 (96%), Positives = 799/827 (96%)

Query: 1   MLNYSPSNTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD 60
           MLNYSPSNTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD
Sbjct: 1   MLNYSPSNTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD 60

Query: 61  FQENKDGRRGLPGPGTXXXXXXXXXXXXXXXRYTINACKRHDLSDAADHKTAVKINYFYG 120
           FQENKDGRRGLPGPGT               RYTINACKRHDLSDAADHKTAVKINYFYG
Sbjct: 61  FQENKDGRRGLPGPGTLQEQMEELEDKLEELRYTINACKRHDLSDAADHKTAVKINYFYG 120

Query: 121 LQPSSLDSVYRCAYQPFSDMGMIQKHVRLKPFLNFVTQSFKPLNYAVKKILLSVGDSLDP 180
           LQPSSLDSVYRCAYQPFSDMGMIQKHVRLKPFLNFVTQSFKPLNYAVKKILLSVGDSLDP
Sbjct: 121 LQPSSLDSVYRCAYQPFSDMGMIQKHVRLKPFLNFVTQSFKPLNYAVKKILLSVGDSLDP 180

Query: 181 HTDELESVAEILFLTPQVREILKKHRMNPQGITQETSDAIRRCLLEKGTRNYDTCLFEPM 240
           HTDELESVAEILFLTPQVREILKKHRMNPQGITQETSDAIRRCLLEKGTRNYDTCLFEPM
Sbjct: 181 HTDELESVAEILFLTPQVREILKKHRMNPQGITQETSDAIRRCLLEKGTRNYDTCLFEPM 240

Query: 241 DLEFYASTTAQAKLIELILNVLPHRDQIETLLNYYMTVMYPLVPYLNKTSFLQLVGDTLI 300
           DLEFYASTTAQAKLIELILNVLPHRDQIETLLNYYMTVMYPLVPYLNKTSFLQLVGDTLI
Sbjct: 241 DLEFYASTTAQAKLIELILNVLPHRDQIETLLNYYMTVMYPLVPYLNKTSFLQLVGDTLI 300

Query: 301 YSPVGVVNGLKFGSHEDFTRKIGCIATLLILLRIAHTAMTLVDDTAYDRAISNRLVLISQ 360
           YSPVGVVNGLKFGSHEDFTRKIGCIATLLILLRIAHTAMTLVDDTAYDRAISNRLVLISQ
Sbjct: 301 YSPVGVVNGLKFGSHEDFTRKIGCIATLLILLRIAHTAMTLVDDTAYDRAISNRLVLISQ 360

Query: 361 KCLAHLLKLSHKTNEDILSCLLLMRWSLIYSPXXXXXXXXXXXXXLPSLTINHAIKIGLY 420
           KCLAHLLKLSHKTNEDILSCLLLMRWSLIYSP             LPSLTINHAIKIGLY
Sbjct: 361 KCLAHLLKLSHKTNEDILSCLLLMRWSLIYSPADGDVVAGAVTDVLPSLTINHAIKIGLY 420

Query: 421 RDCVEVDANFVTDPKQRYFIHYRAKLWMGCLILMRSDFYLRGTYPIVSSEYFSMEPKQDS 480
           RDCVEVDANFVTDPKQRYFIHYRAKLWMGCLILMRSDFYLRGTYPIVSSEYFSMEPKQDS
Sbjct: 421 RDCVEVDANFVTDPKQRYFIHYRAKLWMGCLILMRSDFYLRGTYPIVSSEYFSMEPKQDS 480

Query: 481 VHNYEDELESQIHNVLHKQLRMYAKIRILDKLSLQVHEKTDVEEIYAKIRQLEYDLQSIA 540
           VHNYEDELESQIHNVLHKQLRMYAKIRILDKLSLQVHEKTDVEEIYAKIRQLEYDLQSIA
Sbjct: 481 VHNYEDELESQIHNVLHKQLRMYAKIRILDKLSLQVHEKTDVEEIYAKIRQLEYDLQSIA 540

Query: 541 PLSHTQSLAGVSGQEAVRRSMNNAVYLKMSMVVKIYFLAIRASTVAILERQLKERLGDIK 600
           PLSHTQSLAGVSGQEAVRRSMNNAVYLKMSMVVKIYFLAIRASTVAILERQLKERLGDIK
Sbjct: 541 PLSHTQSLAGVSGQEAVRRSMNNAVYLKMSMVVKIYFLAIRASTVAILERQLKERLGDIK 600

Query: 601 SIARCYREVGAEAFESGLDLCEILRDYLSTAGDLENARVMPDHRYILNQCVQVGIFRVSY 660
           SIARCYREVGAEAFESGLDLCEILRDYLSTAGDLENARVMPDHRYILNQCVQVGIFRVSY
Sbjct: 601 SIARCYREVGAEAFESGLDLCEILRDYLSTAGDLENARVMPDHRYILNQCVQVGIFRVSY 660

Query: 661 YLISVTLTLLQVKNGLESYRWQNRNKHSLADELERNISILGECTKAVFQNVQKLIHQGSH 720
           YLISVTLTLLQVKNGLESYRWQNRNKHSLADELERNISILGECTKAVFQNVQKLIHQGSH
Sbjct: 661 YLISVTLTLLQVKNGLESYRWQNRNKHSLADELERNISILGECTKAVFQNVQKLIHQGSH 720

Query: 721 SLSDRYFTSFKQFLFLDYAMQVIQNEMDPTTPSRLTEVLGDIGLPAAINYSTTDWEQVFS 780
           SLSDRYFTSFKQFLFLDYAMQVIQNEMDPTTPSRLTEVLGDIGLPAAINYSTTDWEQVFS
Sbjct: 721 SLSDRYFTSFKQFLFLDYAMQVIQNEMDPTTPSRLTEVLGDIGLPAAINYSTTDWEQVFS 780

Query: 781 YVQKAFDIKGPTTPFSSSENILAIEPQLTQQPPAEDPLNSMLVLDKM 827
           YVQKAFDIKGPTTPFSSSENILAIEPQLTQQPPAEDPLNSMLVLDKM
Sbjct: 781 YVQKAFDIKGPTTPFSSSENILAIEPQLTQQPPAEDPLNSMLVLDKM 827

>Kwal_26.6805
          Length = 944

 Score =  107 bits (266), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 185/814 (22%), Positives = 318/814 (39%), Gaps = 128/814 (15%)

Query: 23  RMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRRGLPGPGTXXXXXX 82
           R R SFVC++C+K K KCD+A+PSC RC K  + CVYD        R  P P T      
Sbjct: 22  RNRLSFVCQSCRKGKTKCDRAKPSCSRCLKHGIRCVYDVD------RQTP-PKTPNKDAT 74

Query: 83  XXXXXXXXXRYTINACKRHDLSDAADHKTAVKINYFYGLQPSSLDSV--------YRCAY 134
                     +   A     ++     K  V+ +   G   S+ DSV         R   
Sbjct: 75  IARLKREVEYWQARALAIDTVTQPGQAKPNVQGDV-EGSSTSATDSVTDFKSVVEVRIRK 133

Query: 135 QP---------------FSDMGMIQKHVRLKPFL---------NFVTQSFKPLN------ 164
           QP                SDMG+I++   L  F          N +  S  P N      
Sbjct: 134 QPPKLAIAQGASRDIKTSSDMGLIRQDTYLSLFFASLFAAASDNSLINSISPNNADHYGK 193

Query: 165 -YAVKKILLSVGDSLDPHTDELESVAEILFLTPQVREILKKHRMNPQGITQETSDAIRRC 223
            + ++  L+ +   L  +       A +     ++ E L    +   GI   +  A+   
Sbjct: 194 LHKIESDLVGLQRRLMENCTNETQKARVCKFCKRLVEELNGMGVMRTGIVLSSISAVP-- 251

Query: 224 LLEKGTRNYDTCLFEPMDLEFYASTTAQAKLIELILNVLPHRDQIETLLNYYMTVMYPLV 283
                    +T L E +     + +     LI  + + L     +E    Y++  +YPL 
Sbjct: 252 ---------NTNLIENISASETSYSITLKDLIAEVESCLLPLHALEAYKTYFLECIYPLF 302

Query: 284 PYLNKTSFLQLVGDTLIYSPVGVVN-GLKFGSHEDFTRKIGCIATLLILLRIAHTAM--- 339
            +L+++ F + +   +I  P   +   L  G+ ++   KI  IA  L+++RI++ AM   
Sbjct: 303 SFLDRSMFEEALQGLIIPDPFDPLRVKLSLGT-QNLRSKIEIIAIFLVIIRISYNAMKHE 361

Query: 340 -------------TLVDDTAYDR-AISNRLVLISQKCLAHLLKLSHKTNEDILSCLLLMR 385
                        TL D+   ++  +++  V ++Q+C++ L  L + T E+I+ C+L + 
Sbjct: 362 TGVSERLKPANFQTLADEALVEQYPVTDEFVRMAQRCISALDFL-NLTTENIVCCILYL- 419

Query: 386 WSL-IYSPXXXXXXXXXXXXXLPSLTINHAIKIGLYRDCVEVDANFVTDPKQRYFIHYRA 444
           W+L   SP             +  L    A  IGL+RD ++ +         +  I+YR 
Sbjct: 420 WTLSALSPEEGDFYFGQPTEYIMGLVSTMATNIGLHRDPLQYEQYQDHTMIDQRTINYRR 479

Query: 445 KLWMGCLILMRSDFYLRG--------TYPIVSSEYF-SMEPKQDSVHN---YEDELESQI 492
           +LW   +  + ++   +G        + P  S+  F S +   D  H     +D L+ +I
Sbjct: 480 RLWAAIVSFVNTESASKGRCRKAFENSSPFHSAHVFPSAQTYMDHAHKDAVTKDNLQMKI 539

Query: 493 HNVLHKQLRMYAKIRILDKLSLQVHEK----------TDVEEIYAK---IRQLEYDLQSI 539
           +    +   +YA +   + +  +  E            +V+ I  K   IR++E   Q +
Sbjct: 540 YASAMEVHELYALLARFECIWSEAEEDVSLTVLTDLMNEVDVILDKKYNIREIERGSQIL 599

Query: 540 APLS-HTQ-------SLAGVSGQEAVRRSMNNAVYLKMSMVVKIYFLAIRASTVAILERQ 591
           A +S H Q       +LA + GQ      M N V L+ S  + I F + R +  +  E  
Sbjct: 600 AKVSSHAQLGRSGYFALAAMKGQFFHVYLMANLVLLRTSFTIFIQFESRRENEDS--ENF 657

Query: 592 LKERLGDIKSIARCYREVGAEAFESGLDLCEILRDYLSTAGDLENARVMPDHRYILNQCV 651
           +       +   +  R   A     G D  E      STA  +E  R +        Q +
Sbjct: 658 IYFNRFFFEMTEKFLRLTNAYCRYYGGDFSECFSP--STAIAIE--RTL--------QLI 705

Query: 652 QVGIFRVSYYLI-SVTLTLLQVKNGLESYRWQNRNKHSLADELERNISILGECTKAVFQN 710
              +F V+  LI   T  +  +   ++S R  N  +    DE ER  S L          
Sbjct: 706 MTTVFCVTIALILRFTHAVRVLDEEIKSNRKANEGRGIQGDESERKRSTLAAINHGFELI 765

Query: 711 VQKLIHQGSHSLSDRYFTSFKQFLFLDYAMQVIQ 744
           +++L    S +L   +F +FK  LF D+ +QV++
Sbjct: 766 LERLCRLSSSNLRLTFFPAFKMLLFFDHVLQVVK 799

>ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
           (PIP2) - SH] (1429118..1432030) [2913 bp, 970 aa]
          Length = 970

 Score = 97.8 bits (242), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 130/567 (22%), Positives = 246/567 (43%), Gaps = 88/567 (15%)

Query: 252 AKLIELILNV---LPHRDQIETLLNYYMTVMYPLVPYLNKTSFLQLVGDTLIYSPV-GVV 307
             L ELI+ V   LP  + I T + ++   +YP++P+L    F   + + L+  P+    
Sbjct: 282 GTLQELIIEVEAFLPPLEIIHTYMLHFYKYVYPIIPFLEMGIFESALANLLVEDPLHDGR 341

Query: 308 NGLKFGSHEDFTRKIGCIATLLILLRIAHTAMTL-----------VDDTAYD----RAIS 352
             L  G  E+   K+  IA LL++L++++ +M+            + +T  +      IS
Sbjct: 342 TKLNIG-RENIRNKVENIAILLMVLKLSYVSMSFPNTSPGLEDANITETELECLNSYPIS 400

Query: 353 NRLVLISQKCLAHLLKLSHKTNEDILSCLLLMRWSLIYSPXXXXXXXXXXXXXLPSLTIN 412
           ++ V +SQK +A  + L + TNE+ ++CLL      +++P             + SL   
Sbjct: 401 DKAVALSQKAIA-TVNLFNWTNENCIACLLYFWAFFVFAPQDGDFCLGQPTEVILSLVNA 459

Query: 413 HAIKIGLYRDCV---EVDANFVTDPKQRYFIHYRAKLWMGCLILMRSDFYLRGTYPIVSS 469
            A  IGL+RD     +++   VTDP+ R   +YR KLW+   I+ R +  L+G YP    
Sbjct: 460 MASNIGLHRDPSKYEQLNDPSVTDPRIR---NYRRKLWICIFIVCRYEAALKGKYPQSMK 516

Query: 470 EYFSMEPKQDSVHNY----------EDELESQIHNVLHKQLRMYAKIRILDKLSLQVHEK 519
           +Y +     +S  NY           D     IH++ +K+ ++   I  LD++S++ H  
Sbjct: 517 DYTNSFLSAESPKNYMQLVLGDMQDPDPYTEMIHSLTYKRYQLLMMISELDEISIRTHVS 576

Query: 520 ---TDVEEIYAKIR-----QLEYDLQSIAPLSHTQSLAGVSGQEAVRRSMNNAVYLKMSM 571
              + +E +   I+     +L  DL +I   S    L   SG    R+ M +AV +K   
Sbjct: 577 LPLSRIETLLDNIQNLLDTELHADLINIDQESEFLDLNLWSG----RKDMVDAVKIK--- 629

Query: 572 VVKIYFLAIRASTVAILERQLKERLGDIKSIARCYREVGAEAFESGLDLCEILRDYL--- 628
             K+ F     +T          RL  I+++           +ES  +  +  + Y    
Sbjct: 630 --KLIFFQAYMTT----------RLTTIRTVINLMLYFERLTYESNKEYMQYFQKYFIRM 677

Query: 629 ---------STAGDLE---NARVMPDHRYILNQCVQVGIFRVSYYLISVTLTLLQVKNGL 676
                    +    LE   N   +   +Y +++ +Q+ +  V   ++S+ L ++  +  L
Sbjct: 678 VKETVSFVDTVLSQLEYRANDSYLYFMKYTVDKVIQISVPTVLLSILSIILRMVHSEYLL 737

Query: 677 ESYRWQN-----RNKHSLADELERNISILGECTKAVFQNVQKLIHQGSHSLSDRYFTSFK 731
           +            + H+   +LE  IS + + T  + +N+   +   +  L  +YF+ F+
Sbjct: 738 QKMLQSGEMIGIEDVHTTKQKLEL-ISSIKDNTIEILENLCTAV---TRKLGFKYFSVFQ 793

Query: 732 QFLFLDYAMQVIQNEMDPTTPSRLTEV 758
             +F DY  Q+++        SR+T++
Sbjct: 794 MQVFFDYCSQIMKKGEVLNIFSRITQL 820

 Score = 63.2 bits (152), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 2/70 (2%)

Query: 1  MLNYSPSNTGSASSEPPEFK--KSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECV 58
          M+     ++G  S E P+ K    R R SFVC+ C+K K KCD+ +P C RC+K  ++CV
Sbjct: 1  MVKLEDMSSGQLSEESPDRKYVSKRNRISFVCQACRKSKTKCDREKPRCSRCAKNNVKCV 60

Query: 59 YDFQENKDGR 68
          YD ++ +  R
Sbjct: 61 YDIEKQRAPR 70

>Sklu_2434.10 YAL051W, Contig c2434 22765-25716
          Length = 983

 Score = 89.4 bits (220), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 108/561 (19%), Positives = 231/561 (41%), Gaps = 73/561 (13%)

Query: 254 LIELILNVLPHRDQIETLLNYYMTVMYPLVPYLNKTSFLQLVGDTLIYSPVGVVN-GLKF 312
           LI  I  +LP  + IE    Y+   +YP++P+L+   F + + + +  +P       L+ 
Sbjct: 285 LINQIEGLLPSVEAIEIYKIYFYKYVYPIIPFLDIELFEECLTEVISKNPANSKKVKLRM 344

Query: 313 GSHEDFTRKIGCIATLLILLRIAHTAMTLV------------------DDTAYDRAISNR 354
           G       KI  +A LL +L++++ +M                          +  I++ 
Sbjct: 345 GKRR-LRSKIENLAILLAVLKLSYISMDFALAAEESSNLPQLSTSNINSKLMKENVITDE 403

Query: 355 LVLISQKCLAHLLKLSHKTNEDILSCLLLMRWSLIYSPXXXXXXXXXXXXXLPSLTINHA 414
            + +SQ+C++    L + T+E+ L CL+ +    +++P             +  +  + A
Sbjct: 404 AISLSQRCVSSD-NLFNWTSENSLCCLMYLWAYFVFAPEEGDYYLDQPTDIIMGMVTSLA 462

Query: 415 IKIGLYRDCVEVDANFVTDPKQRYFIHYRAKLWMGCLILMRSDFYLRGTYPIVSSEYFS- 473
           + IGL+RD  E +            ++YR KLW+  +I+ R +  L+G  P    ++   
Sbjct: 463 VNIGLHRDPSEYEQFKDFSVVDHRLLNYRRKLWLCIVIVCRYESSLKGKCPQSMKDHMVS 522

Query: 474 -MEPKQDSVHNY----------EDELESQIHNVLHKQLRMYAKIRILDKLSLQVHEKTD- 521
            +        NY          +D L  ++H +  K  +++  +  LD +++ +H     
Sbjct: 523 FLNVDNKGPDNYMNLVVGDMTTKDPLNLRVHKMCFKNYQLFLLLSELDAVTISLHHNVSL 582

Query: 522 --VEEIYAKIRQL------------EYDLQSIAPLSHTQSLAGVSGQEAVRRSMNNAVYL 567
             +E++  +I               E+  + I P+ H        G+      +N+A   
Sbjct: 583 AHIEDLLERIHDFIDKNYPISDIPDEFSAEKI-PIQHISK----PGETIDMLIINSASCF 637

Query: 568 KMSMVVKIYFLAIRASTVAILERQLKERLGDIKSIARCYREVGAEAFE----SGLDLCEI 623
           +   + ++  L + ++  +  E       G+ K+ A  Y     + F       L+L +I
Sbjct: 638 QTHTISRLVLLRVTSALFSYFE-------GECKNAASKYLPYYEKYFTKLVTETLELAKI 690

Query: 624 LRDYLSTAGDLENARVMPDHRYILNQCVQVGIFRVSYYLISVTLTLLQVKNGL------E 677
                    D   A + P  +Y+++   Q+ +  V + L+ ++L +   ++ L      E
Sbjct: 691 FEKCFEGEFD---AALFPFMKYLVDSTAQLCLSTVLHSLLGISLRMTHAESLLIHKLKQE 747

Query: 678 SYRWQNRNKHSLADELERNISILGECTKAVFQNVQKLIHQGSHSLSDRYFTSFKQFLFLD 737
           SY + N          E+ + I+    K     +++L +  S S+   +F++F+  LF D
Sbjct: 748 SYLYNNLASSLEISMNEKRLEIITTMKKDFEAALERLCNLASKSIRLSFFSTFQILLFFD 807

Query: 738 YAMQVIQNEMDPTTPSRLTEV 758
           Y +Q+I+     T  +R++++
Sbjct: 808 YVLQIIKKGELITMLTRISKL 828

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%)

Query: 23 RMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGR 68
          R R SFVC+ C+K K KCD+ +PSC RC K  +ECVYD ++    R
Sbjct: 21 RNRISFVCKACRKSKTKCDREKPSCTRCIKNGIECVYDIEQQTQPR 66

>KLLA0A03443g 311628..314555 weakly similar to sp|P39720
           Saccharomyces cerevisiae YAL051w OAF1 peroxisome
           proliferating transcription factor, start by similarity
          Length = 975

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 116/548 (21%), Positives = 248/548 (45%), Gaps = 70/548 (12%)

Query: 252 AKLIELILNVLPHRDQIETLLNYYMTVMYPLVPYLNKTSFLQLVGDTLIYSPVGVVNGLK 311
            +L + +   LP R+ I+    ++   +YP++P+L+   F + + + L  +P    +G K
Sbjct: 299 TRLKDSLEKALPSREDIDLYKMHFYQYIYPIIPFLDIELFEEGLDELL--NPSDGTDGRK 356

Query: 312 ----FGSHEDFTRKIGCIATLLILLRIAHTAM---------TLVDDTAYD----RAISNR 354
               FG+  +   KI  ++ L+ +LRI++  M          + DD+         I+  
Sbjct: 357 VTICFGTR-NIRSKICLLSALINILRISYLCMLFTLNSSKEDVFDDSTLKVLTTSPITPS 415

Query: 355 LVLISQKCLAHLLKLSHKTNEDILSCLLLMRWSL-IYSPXXXXXXXXXXXXXLPSLTINH 413
           LV++SQ+C++ +  LS  T   +L+  L+  W++ +++P             L SL  N 
Sbjct: 416 LVMLSQECISSVNILSWTTENGLLA--LMYHWAVFVFTPEEGDCYLGQTTDALISLVSNL 473

Query: 414 AIKIGLYRDCVE---VDANFVTDPKQRYFIHYRAKLWMGCLILMRSDFYLRGTY----PI 466
           A+ IGL+RD  E   +    + DP+     + R +LW+   I+ R +  L+  Y     +
Sbjct: 474 AVNIGLHRDPNEYKVLQDPTICDPR---VFNLRKRLWLCIYIMCRHETTLKARYHQNTHM 530

Query: 467 VSSEYFS--MEPKQDSVHNYEDELESQIHNV-----LHKQLRMYAKIRILDKLSLQVHEK 519
            S  Y S   E K    +++ D      +NV     + K+ +++  +   D +++ +   
Sbjct: 531 SSFAYASPECETKNFWCYDFGDPNRLGPYNVNMIDKIKKRHQIFLLLSETDAVTMNLDTH 590

Query: 520 ---TDVEEIYAKIRQL---EYDLQSIAPLSHTQSLAGVSGQEAVRRSMN-----NAVYLK 568
              +D++  + K++     E+ L  +    +T     +  +   R S+N     NA+  +
Sbjct: 591 MTLSDLDAWFKKVKSFLDEEFPLDGLINGVNTPQFYDLVLKNGKRVSVNFTYFGNALCFQ 650

Query: 569 MSMVVKIYFLAIRASTVAILERQLKERLGDIKSIARCYREVGAEAFESGLDLCEILRDYL 628
             ++ ++  L I A  +   E +L +   D    ++ + +   E+F+S L++ +I + YL
Sbjct: 651 THLIARMSMLRISACLMVHFENRLSDMTHD---YSQYFTKYFIESFKSLLEIAKIYQSYL 707

Query: 629 STAGDLENARVMPDHRYILNQCVQVGIFRVSYYLISVTLTLLQVKNGLESYRWQNRNKHS 688
           +  GD  NA + P   +  ++  +V +  +    + + + +   ++ L       +  + 
Sbjct: 708 T--GDY-NASLSPCMLFATDKICEVCLPSILLTFLGMLIRITHTESFLIKQTVDRKGLYG 764

Query: 689 LA----DELERN------ISILGECTKAVFQNVQKLIHQGSHSLSDRYFTSFKQFLFLDY 738
           L+    +EL+ N      ++ + +  + V QN   LI   +  L   +F++FK  +F DY
Sbjct: 765 LSSYIPEELKENENKLVAVTAIRKGLEVVMQNWLTLI---TKRLRFAFFSTFKVSIFFDY 821

Query: 739 AMQVIQNE 746
            +Q+I+ +
Sbjct: 822 VLQIIKKQ 829

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 32/46 (69%)

Query: 23 RMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGR 68
          R R SFVC+ C+K K KCD+ +P CGRC K  L+CVYD ++ K  R
Sbjct: 28 RQRISFVCQACRKNKTKCDREKPRCGRCVKYHLKCVYDVEQQKPPR 73

>Scas_663.12
          Length = 944

 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 111/484 (22%), Positives = 200/484 (41%), Gaps = 66/484 (13%)

Query: 20  KKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRRGLPGPGTXXX 79
           KK R R SFVC+ C++ K+KCD+ +P C RCSK +LECVYD  +    R           
Sbjct: 30  KKKRYRLSFVCQGCRRSKVKCDQEKPVCSRCSKHDLECVYDVTKQHAPRNPNKAATMARL 89

Query: 80  XXXXXXXXXXXXRYTINACKRHDLSDAADHKTAVKINYFYGLQPSSLDSVYRCAYQPFSD 139
                         T       + ++  D    +K+N +       + SV +    P S+
Sbjct: 90  RREVEYWKKKVASLTEENAPISNGNNENDKFWDLKVNLYKTYPRLIISSVLKREVTPLSE 149

Query: 140 MGMIQKHVRLKPFLNFVTQSF---KPLNYAVKKILLSVG-DSLDPHTDELESVAEILFLT 195
             +I  H R   FL  +  S     P N  V  ++  V  +   PH  +         +T
Sbjct: 150 NYLI-IHDR---FLCTLASSIFINAPKNSLVSALVTDVNVNKSHPHLRD---------VT 196

Query: 196 PQVREILKKHRMNPQGITQETSDAIRRCLLEKGTRNYDTCLFEPMDLEFYASTTAQA--- 252
            +++E LK    +P G  +E  D     +++   R +         ++ +A++T+     
Sbjct: 197 LKMKETLKNR--HPDGYERERIDKFFDRIVQ--LRGFSEQAQYQHIMQMFANSTSTEYLE 252

Query: 253 --------------KLIELILNVLPHRDQIETLLNYYMTVMYPLVPYLNKTSFLQLVGDT 298
                         ++I+   ++LP    I     ++   +YP +P+++K  F + +   
Sbjct: 253 DNCPGNNEYSNTLREIIDHFQSILPPYAVIMCHKQHFYENVYPFLPFIDKEMFEESLNVI 312

Query: 299 LI---YSPVGVVNGLKFGSHEDFTRKIGCIATLLILLRIAHTAMTLVD------DTAY-- 347
           L      P  +   LK G+      K+  IA L ++L++++ ++  V         +Y  
Sbjct: 313 LFPDQTDPSKI--KLKLGNTR-LRSKVESIAILSVILKLSYISLNSVTFGNMEVKNSYVT 369

Query: 348 -----DRAISNRLVLISQKCLAHLLKLSHKTNEDILSCLLLMRWSL-IYSPXXXXXXXXX 401
                D  IS+  VL++QKCL     +    NE+ +SCLL + WS  +++P         
Sbjct: 370 KAMLQDYPISDETVLVAQKCLVAENWIVC-VNENTISCLLYI-WSFHVFAPENGDFFLEC 427

Query: 402 XXXXLPSLTINHAIKIGLYRD---CVEVDANFVTDPKQRYFIHYRAKLWMGCLILMRSDF 458
               L +L I  A  IGL +D      ++   ++DP+    ++ R   W+G + +   + 
Sbjct: 428 PSDILSNLIIILATSIGLNKDPSVLPLLNNPDMSDPR---LLNLRRMQWLGVVAMASMES 484

Query: 459 YLRG 462
            L+G
Sbjct: 485 NLKG 488

>KLLA0A03421g 308414..311056 weakly similar to sp|P39720
           Saccharomyces cerevisiae YAL051w OAF1 peroxisome
           proliferating transcription factor, start by similarity
          Length = 880

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 121/545 (22%), Positives = 213/545 (39%), Gaps = 73/545 (13%)

Query: 21  KSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRRGLPGPGTXXXX 80
           K R + SFVC+ C+K K KCD+ +PSC RC +L   C+YD +      + LP        
Sbjct: 12  KKRYKLSFVCQLCRKSKTKCDRKKPSCARCQRLNKPCIYDLE-----YQPLPRKPNKDAA 66

Query: 81  XXXXXXXXXXXRYTINA----CKRHD------LSD-AADHKTAVKINYFYGLQPSSLDSV 129
                      +Y  NA     K+ D      LS+ ++D+    KIN     +P  +   
Sbjct: 67  LARLQKELEYWKYFANARLSEMKKMDSTGSEALSETSSDYLPKHKIN-LSAFKPQLVYQE 125

Query: 130 YR-CAYQPFSDMGMIQKHVRLKPFLN--FVTQSFKPLNYAVKKILLSVGDSLDPHTDELE 186
           +R    + F++M  I+    L  FL   F + S + L + V   L     S   + D  +
Sbjct: 126 FRFMELKVFTNMSQIKHDCFLSTFLGTFFASASKEELLHNVSPYL-----SYHANNDNSK 180

Query: 187 SVAEILFLTPQVREILKKHRMNPQGITQETSDAIRRCLLEKGTR-NYDTCLFEPMDLE-F 244
            +  +L L   +       R   +  +    D   R L  +    NY T  F  M    F
Sbjct: 181 YIDRVLHLRQNLL-----MRFTTEAQSNRIQDFTDRLLTGREVLVNYRTAFFVTMLRNVF 235

Query: 245 YASTTAQAK--------LIELILN----VLPHRDQIETLLNYYMTVMYPLVPYLNKTSFL 292
           +      +K        L+E +++    +LP +D +    +Y+   +Y + PY +   F 
Sbjct: 236 FQGKFEDSKKQEDPCPPLLERLVSEANILLPKKDALLLYKSYFYRRLYHIYPYFDIGMFE 295

Query: 293 QLVGDTLI---YSPVGVVNGLKFGSHEDFTRKIGCIATLLILLRIAHTAMTLVDDTAYDR 349
           + +   L+     P  ++  +     E+F  K+  IA L+++L+I++ A+  V DT Y+ 
Sbjct: 296 ETLDKILVDDSERPDRMIFDIGI---ENFRYKLTNIALLMLVLKISYGALQAVIDTDYNA 352

Query: 350 AIS-----------NRLVLISQKCLAHLLKLSHKTNEDILSCLLLMRWSLIYSPXXXXXX 398
            I            ++ ++ ++ CLA +   S  TNE  +SC+L +              
Sbjct: 353 EICDSDFIKQNPVVDQCIVFAEICLAKMCIFS-GTNEVQISCMLFIWNFFCVGNGDDDSV 411

Query: 399 XXXXXXXLPSLTINHAIKIGLYRDCVEVDANFVTDPKQRYFIHYRAKLWMGCLILMRSDF 458
                  +  +    A+  GL RD  +     +    Q    + R KL +  +       
Sbjct: 412 FGRATDIVTEMVFTLAMNNGLGRDATQYQQYQMHPSVQIELQNLRRKLSLNVISTSVFSG 471

Query: 459 YLRGTYPI----VSSEYFSMEPKQDSVHNYE-------DELESQIHNVLHKQLRMYAKIR 507
            L G +P      +  + ++   +D             D  E +IHNVL K  ++   + 
Sbjct: 472 ILTGNFPTNIWSNAKNFLNLNGGRDEFMGLVKRSMKEIDPFELKIHNVLFKTYKILVLLM 531

Query: 508 ILDKL 512
            L+ L
Sbjct: 532 DLEDL 536

>ADR404C [2144] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
           (PIP2) - SH] (1432323..1434950) [2628 bp, 875 aa]
          Length = 875

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 114/426 (26%), Positives = 183/426 (42%), Gaps = 54/426 (12%)

Query: 196 PQVREILKKHRMNPQGITQETSDAIRRCLLEKGTRN-YDTCLFEPMDLEFYASTTAQAKL 254
           P +R  ++  R N     QE  +  R  LL     N  D+   E ++L+   ST  Q ++
Sbjct: 212 PSIRHFIECLRKN-----QEKQEVTRTGLLYAIALNSMDSVCIEDINLQQRYSTNLQ-EI 265

Query: 255 IELILNVLPHRDQIETL-LNYYMTVMYPLVPYLNKTSFLQLVGDTLIYSPVGVVNGLKFG 313
           +E    VLP  + IE   +N+Y  V YPLVP L      + + + L   P G V  L FG
Sbjct: 266 LEQCEKVLPSYEAIEFYKVNFYKHV-YPLVPVLEIPILEECLAEILEEGPNGRVR-LMFG 323

Query: 314 SHEDFTRKIGCIATLLILLRIA--HTAMTLVDDTAY----DRAISNRLVLISQKCLAHLL 367
            +     K+  +A LL++L I+  + A    + T+     +  +S  LV +SQ C+AH L
Sbjct: 324 KYR-LRHKLINLAILLVMLIISQQNVAGASAETTSMLQRPENQLSKELVFLSQMCVAH-L 381

Query: 368 KLSHKTNEDILSCLLLMRWSLIYSPXXXXXXXXXXXX-XLPSLTINHAIKIGLYRDCVEV 426
            ++H+  E  ++CLLL+ +  +  P              L SL +N  +++GL RD  E 
Sbjct: 382 DVTHQPEEQHMTCLLLLWYVSVLDPEFRSETLLQEEADALLSLILNMGMELGLGRDPEEY 441

Query: 427 DANFVTDPKQRYFIHYRAKLWMGC--LILMRSDFYLRGTYPIVSSEYFS--MEPKQDSVH 482
              F      +  I+YR KL +    L+L  S+F       I+    F   +E   D+V 
Sbjct: 442 -YQFRDMLVHKSLINYRRKLGICIMPLVLYHSEFTSLSPTNILDFAVFENIVETSADAVS 500

Query: 483 NYEDEL----------ESQIHNVL---HKQLRMYAKIRILDKLSLQVHEKTDVEEIYAKI 529
            Y D +          E ++H V    H   +   K+  L+K S    +  +VE+  AK+
Sbjct: 501 AYLDRVAADMVQQSAFELEVHRVTCLRHIVSKWIEKLNKLNKCSSSSMKLCEVEQCTAKV 560

Query: 530 RQLEYDLQSIAPLSHTQSLAGVSGQEAVRRSMNNAVYLK--------MSMVVKIYFLAIR 581
                    +A ++    L  VS   +    M +  Y K        MS+   +Y +A R
Sbjct: 561 ---------LAFINSNFPLNNVSAGPSPAACMLDLGYRKVDIDWPAHMSIAALVYHIACR 611

Query: 582 ASTVAI 587
           A  V +
Sbjct: 612 AILVQL 617

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 2/53 (3%)

Query: 11 SASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQE 63
          S S   P   K ++  S+VC  C+K K KCDK +P+C RC++L L C YD ++
Sbjct: 7  SGSVLKPNTHKRKL--SYVCIPCRKCKTKCDKLKPTCSRCAELGLYCGYDIEK 57

>Scas_556.6
          Length = 1022

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 119/600 (19%), Positives = 247/600 (41%), Gaps = 68/600 (11%)

Query: 197 QVREILKKHRMNP--QGITQETSDAIRRCLLEKGTRNYDTCLFEPM--------DLEFYA 246
           +++EIL K   NP  +    E +D I +      TRN    +   M         LE + 
Sbjct: 241 KLKEILVKQCQNPSQEAKVNEFTDRILQN--TNSTRNLKVGMILSMLYNTVGHQHLEDHC 298

Query: 247 STTAQ-AKLIELILN----VLPHRDQIETLLNYYMTVMYPLVPYLNKTSFLQLVGDTLIY 301
               + ++L++  +N    +LP  + I     ++   +YP +P++ +  F + +  T+  
Sbjct: 299 PADGEYSELLKTFINEFEQILPPYEIIMKYKAFFAEYVYPNLPFMEQEMFEESIATTIFP 358

Query: 302 S---PVGVVNGLKFGSHEDFTRKIGCIATLLILLRIAHTAMTLVDDTAYDR--------- 349
           +   P  +   +K G+      K+  +  LL++L++A+ +++LV++   D          
Sbjct: 359 NEEDPTKI--KIKLGNTR-LRSKVENMCMLLVILKLAYISISLVEEIPQDDNLQFTKDII 415

Query: 350 ---AISNRLVLISQKCLAHLLKLSHKTNEDILSCLLLMRWSLIYSPXXXXXXXXXXXXXL 406
               I N  +L++Q+CLA         NE+I++CLL +    ++SP             +
Sbjct: 416 VKYPIPNDAILLAQRCLASE-DWCACANENIITCLLYIWSFFVFSPEEGDFFLEHPTDVI 474

Query: 407 PSLTINHAIKIGLYRDCVEVDANFVTDPK--QRYFIHYRAKLWMGCLILMRSDFYLRGTY 464
            SL +  A  IGL+RD    D   + DP    R  +++R  LW+G + +   +  L+G +
Sbjct: 475 GSLIMMLATSIGLHRD--PSDFPQLQDPNLSDRRILNHRRLLWIGIVTVCSFESSLKGRH 532

Query: 465 PIVS---------------SEYFSMEPKQDSVHNYEDELESQIHNVLHKQLRMYAKIRIL 509
            + S               +E +    K D+    ++ L S IH    K++R+   +  L
Sbjct: 533 SVSSMALMDLFIDVKDPAAAEKYIARVKADAKPTMDERLIS-IHEYSFKRVRLALLLSDL 591

Query: 510 DKLSLQVHEKTDVEEIYAKIRQLEYDLQSIAPLSHTQSLAGVSGQEAVRRSMNNAVYL-- 567
           D L++  +    +  I          +++  P+ + + +  +S ++      ++ ++L  
Sbjct: 592 DNLTMSYNNDFPLSAIDNLAETTRTFIETNFPIINLKEI-NISKEQTPESLKSHLLFLAT 650

Query: 568 --KMSMVVKIYFLAIRASTVAILERQLKERLGDIK--SIARCYREVGAEAFESGLDLCEI 623
               S+  +I F  +   T A L    +  +   K  S+   Y +   +     L L   
Sbjct: 651 INSTSIHSRIMFRLMMLRTAAALFLYFESEMAKNKSSSLLPYYYKYFTKTCTYALALITD 710

Query: 624 LRDYLSTAGDLENARVMPDHRYILNQCVQVGIFRVSYYLISVTLTLLQVKNGL--ESYRW 681
              +    G+ ++  + P   Y + + +Q+ +    + L+ + L +    N L  E   +
Sbjct: 711 FNKFFK--GEYDDC-LSPLTTYNITKFIQLALPSTIFSLLGIILRISLGGNMLFSEYQEY 767

Query: 682 QNRNKHSLADELERNISILGECTKAVFQNVQKLIHQGSHSLSDRYFTSFKQFLFLDYAMQ 741
            N+  ++  DE+ + I  L    K +   ++ +    S  L   +F+ FK     D  +Q
Sbjct: 768 PNKEDYAALDEINKRIESLNALHKDLESALENIHILASQHLRFTFFSVFKMLALCDVIIQ 827

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 36/58 (62%), Gaps = 5/58 (8%)

Query: 8  NTGSASSEPPEFK-----KSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD 60
          ++G+++S P         K R R SFVC+ C+K K KCDK +P+C RC K  L CVYD
Sbjct: 19 SSGNSTSSPAAGGSNRQIKKRNRISFVCQECRKAKTKCDKEKPACTRCVKQNLACVYD 76

>CAGL0J07150g complement(686734..689802) similar to sp|P39720
           Saccharomyces cerevisiae YAL051w OAF1 peroxisome
           proliferating transcription factor or sp|P52960
           Saccharomyces cerevisiae YOR363c PIP2, hypothetical
           start
          Length = 1022

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 124/543 (22%), Positives = 227/543 (41%), Gaps = 70/543 (12%)

Query: 254 LIELILNVLPHRDQIETLLNYYMTVMYPLVPYLNKTSFLQ-----LVGDTLIYSPVGVVN 308
           LI+ I ++LP  D I     +Y   +Y + P+++K+ F       LV D      V VV 
Sbjct: 265 LIDSIESLLPPYDIIIAYKKWYYDNVYYIAPFVHKSIFEDDLAQILVRDDKDPQKVKVVF 324

Query: 309 GLKFGSHEDFTRKIGCIATLLILLRIAHTAMTLVDDTAYDRA------------ISNRLV 356
           G     +     K+  ++ LL+++++A+T++ L DD     +            IS+ + 
Sbjct: 325 G-----NSKLRSKLETMSMLLLVMKLAYTSIILTDDDIRKYSSVLTMDIVRKYPISSEVA 379

Query: 357 LISQKCLAHLLKLSHKTNEDILSCLLLMRWSLIYSPXXXXXXXXXXXXXLPSLTINHAIK 416
            + Q CL+         NE+I+SCLLL+    ++SP             L S+ +   + 
Sbjct: 380 HVVQNCLSAE-NWCATPNENIISCLLLLWAFFVFSPDEGDFFYEQPTGVLASIAMMLGVS 438

Query: 417 IGLYRDCVEVDANFVTDP-KQRYFIHYRAKLWMGCLILMRSDFYLRGTYPIVSSEYFSM- 474
           IGL++D  +    F  D    +   + R  LW+  + ++  +   +G+      + F + 
Sbjct: 439 IGLHKDPSDYPV-FSNDTLGDKRVCNQRRLLWIAMICVLTFETNTKGSTVDKHDDLFDIF 497

Query: 475 ----EP----------KQDSVHNYEDELE--SQIHNVLHKQLRMYAKIRILDKLSLQVHE 518
               +P          K+D  HN E  +E  + I N+  +    YA +  L+ L L    
Sbjct: 498 IDLRDPSSVYELMDRVKKDCDHNDEGSIEVMNVIENLFRRTQTSYA-LYDLNALLLSPDG 556

Query: 519 K---TDVEEIYAKIRQL--EY-DLQSIAPLSHTQSLAGVSGQEAVRR--SMNNAVYLKMS 570
           +   ++ E + +K+  +  EY DL S     H     G SG +A      M N   +   
Sbjct: 557 RFTLSEYEILSSKVHIMSKEYIDLVSSYSPKH-----GPSGDKAKLPLFYMLNCCDVLSG 611

Query: 571 MVVKIYFLAIRASTVAILERQLKERLGDIKSIARCYREVGAEAFESGLDLCEILRDYLST 630
           ++ ++  + +R S    L    +ERL   +++   Y     +     + L   +  +   
Sbjct: 612 IIFQL--MNLRISIALFL--HFEERLVTEENVKNHYIYFFTKLCLDLIALGNTMEKFFDG 667

Query: 631 AGDLENARVMPDHRYILNQCVQVGIFRVSYYLISVT----LTLLQVKNGLESYRWQNRNK 686
             D   A +     +I+ + +QV I  V + L++V     L    + N L+S + Q   K
Sbjct: 668 TFD---AVIAKASDFIIKKAIQVAINTVLFGLLAVIMRFDLAASILFNELQSLQTQGVYK 724

Query: 687 HSLADELERNISILGECTKAVFQN-VQKLIHQGSHSLSDRYFTSFKQFLFLDYAMQVIQ- 744
             +  E+   I +L +  K +F+  ++ + H  S SL   YFT FK     D  +  I+ 
Sbjct: 725 EQIYSEMNSKIQLLND-MKVIFETQLKNIYHVCSTSLRFEYFTIFKMLTLFDALLDRIEK 783

Query: 745 NEM 747
           NE+
Sbjct: 784 NEL 786

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 30/48 (62%)

Query: 18 EFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENK 65
          +  K R R SFVC+ C+K K KCDK +P+C RC K  + CVYD    K
Sbjct: 11 DISKKRNRLSFVCQGCRKAKTKCDKEKPACSRCLKHGIRCVYDLTSQK 58

>CAGL0M12298g complement(1225753..1228737) similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor or sp|P52960
          Saccharomyces cerevisiae YOR363c PIP2, hypothetical
          start
          Length = 994

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 39/63 (61%), Gaps = 6/63 (9%)

Query: 10 GSASSEPPEFKKSRMRQ----SFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENK 65
          GS SS  PE   +R R+    SFVC+ C++ K +CDK +P C RC KL+LECVYD  +  
Sbjct: 5  GSGSS--PEGNAARTRKRNRISFVCQACRRSKTRCDKEKPICTRCKKLKLECVYDMAKQS 62

Query: 66 DGR 68
            R
Sbjct: 63 APR 65

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 86/184 (46%), Gaps = 19/184 (10%)

Query: 254 LIELILNVLPHRDQIETLLNYYMTVMYPLVPYLNKTSFLQLVGDTLI---YSPVGVVNGL 310
            I  I  +LP  + IE    ++   +YP +P+L K  F + + D L     +P  +   L
Sbjct: 293 FITEIEEMLPPYEIIEVYKQHFFQYIYPALPFLEKEMFEETLSDVLFRDENNPAKI--KL 350

Query: 311 KFGSHEDFTRKIGCIATLLILLRIAHTAMTLVDDTAYDRA------------ISNRLVLI 358
           + G++     K+  ++ L+++L++++ ++   +D     A            ISN  VL+
Sbjct: 351 RLGNNH-LRMKMENLSILMVILKLSYISLNFAEDNVQHSALDVDTNIIAQYPISNNFVLL 409

Query: 359 SQKCLAHLLKLSHKTNEDILSCLLLMRWSLIYSPXXXXXXXXXXXXXLPSLTINHAIKIG 418
           +QKCLA         NE+I++C+L +    ++SP             + SL +  A  IG
Sbjct: 410 AQKCLAS-ENWCACANENIIACVLYVWAFFVFSPEEGDLFLEHPTDVISSLVMMLATSIG 468

Query: 419 LYRD 422
           L+RD
Sbjct: 469 LHRD 472

>Sklu_2064.2 , Contig c2064 873-3641
          Length = 922

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 115/549 (20%), Positives = 221/549 (40%), Gaps = 90/549 (16%)

Query: 254 LIELILNVLPHRDQIETLLNYYMTVMYPLVPYLNKTSFLQLVGDTLIYSPVGVVNGLKFG 313
           LI  I   LP    ++  L ++   +Y   P+++  SF + +   LI         L+F 
Sbjct: 265 LIHEIELALPSVQAVKFYLKHFYRSIYAFYPFMDIPSFEKTIWSILIEDQQSARYKLEF- 323

Query: 314 SHEDFTRKIGCIATLLILLRIAHTAMTL-----VDDTAY------DRAISNRLVLISQKC 362
            ++D  RK+  +A LL++L+++  ++ L     + DTA       +  +   ++++ QKC
Sbjct: 324 KNDDIRRKLENLAILLVVLKMSSMSLNLKTDPYLADTATVLRIFDENEMRAEVLVLVQKC 383

Query: 363 LAHLLKLSHKTNEDILSCLLLMRWSLIYSPXXXXXXXXXXXXXLPSLTINHAIKIGLYRD 422
           L  +L +    NE+ L CLL +R     +P             +       A+ +GLY+D
Sbjct: 384 LC-VLNVLKFANENCLCCLLYLRACEYLAPDDENVLLPQQSLLMLGSISQLALILGLYKD 442

Query: 423 CVEVDANFVTDPKQ--RYFIHYRAKLWMGCLILMRSDFYLRGTYPIVSSEYFSMEPKQDS 480
                   + DP +  +  ++YR KLW+  +    ++    G      S   +   K+ S
Sbjct: 443 PSTYSQ--LVDPSKFGKSLLNYRRKLWLSMISANVNELLPNGCDESTMSNLMNNFLKR-S 499

Query: 481 VHNY------------EDELESQIHNVLHKQLRMYAKIRILDKLSLQVHEKTDVEEIYAK 528
            HN             E+  +   H +L K+ ++ A +  L+ +    +    + +I   
Sbjct: 500 DHNLDYLTTVIKDMDEENHFDISTHELLLKEYQVAAVLTELNTICSPANGAISLSKIETL 559

Query: 529 IRQLEYDLQSIAPLSHTQSLAGVS----------------GQEAVRRSMNNA-----VYL 567
           + + E  L+   PLS  Q  A  +                G+    ++  N      V L
Sbjct: 560 LSKGEEVLKVDFPLSRLQKEANSNNLVTLPCFERETKIDFGEVYNAKNFTNNILGRLVLL 619

Query: 568 KMSMVVKIYFLAIRAST----VAILERQLKERLGDIKSIARCYREVGAEAFESGLDLCEI 623
            ++  + IYF  + +      +A  ++ L      +KS   C+  V              
Sbjct: 620 NVTSALSIYFENLNSYNPFKYLAFYQKFL------LKSCKYCFELVKLLK---------- 663

Query: 624 LRDYLSTAGDLENARVMPDH-RYILNQCVQVGIFRVSYYLISVTLTLLQVKNGL------ 676
                  +G+L+ +  +P H RY +N+ VQ+ + RV   L S+ L  L  ++ L      
Sbjct: 664 ----KLLSGELDQS--VPLHLRYSVNKTVQLALTRVMVSLTSIILRSLYSESKLLQEIDS 717

Query: 677 ESYRWQNRNKHSLADELERNISI-LGECTKAVFQNVQKLIHQGSHSLSDRYFTSFKQFLF 735
           +S+ + + +  S++ +LE  I + +  C       +Q L++  S  LS  YF  +K    
Sbjct: 718 KSFLYNDTSHSSISRKLESIIQLRINLCDV-----LQMLVNLSSKKLSHEYFGCYKVTCL 772

Query: 736 LDYAMQVIQ 744
             Y +  I+
Sbjct: 773 FKYLLHFIE 781

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 32/50 (64%)

Query: 21 KSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRRG 70
          + R R SFVC  C++RKIKCDK RP C +C++  L CVYD +     R+ 
Sbjct: 16 QKRNRLSFVCLECRRRKIKCDKQRPCCIQCAEQGLTCVYDIERQPAPRKS 65

>Sklu_2376.6 , Contig c2376 12573-15341 reverse complement
          Length = 922

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 108/520 (20%), Positives = 212/520 (40%), Gaps = 56/520 (10%)

Query: 251 QAKLIELILNVLPHRDQIETLLNYYMTVMYPLVPYLNKTSFLQLVGDTLIYS-PVGVVNG 309
           Q  L + IL+ +P +  ++     +   +YPL+P L ++ F   +   L +    G +  
Sbjct: 265 QEFLGQKILDKMPTKYVVDRYFEIFWQNIYPLIPILERSEFENDLKRILQWDKATGELIE 324

Query: 310 LKFGSHEDFTRKIGCIATLLILLRIAH-TAMTLVDDTAYDRAISNR------LVLISQKC 362
           ++     D+      +AT LI++R ++ T +  +     D+ I N+       + ++  C
Sbjct: 325 VRATKTYDY----AVLATFLIIIRFSYVTIVAKLQPFEEDKMILNKYPISVDFISLTYSC 380

Query: 363 LAHLLKLSHKTNEDILSCLLLMRWSLIYSPXXXXXXXXXXXXXLPSLTINHAIKIGLYRD 422
           L++  +   +T   +L  L+ +R  L+++P             L S+ +  A  I L RD
Sbjct: 381 LSN-YRFLRRTKFKVLQALVFLRHYLLFAPEDGDGVDMAQSQILYSMIVQSAYTIALNRD 439

Query: 423 CVEVDANFVTDPKQRYFIHYRAKLWMGCLILMRSDFYLRGTYPIV-SSEYF----SMEPK 477
                 NF    +    +    K+W   + L R    + G   I+ +SE      + +P 
Sbjct: 440 ----PTNFPELAQDNRKVQLYRKMWYAIVTLDRKISTITGIPCIIQNSENLCNTKAPDPN 495

Query: 478 Q-DSVHNYEDELE---SQIHNVLHKQLRMYAKIRILDKLSLQVHEKTDVEEIYAKIRQLE 533
             D V N   EL    SQI  +  K + +            QV+    V +I   + Q++
Sbjct: 496 DLDPVENRISELTRPISQIDELCGKVINLIN----------QVNSPPRVNDILQLLNQID 545

Query: 534 YDLQSIAPLSHTQSLAGVSGQEAVRRSMNNAVYLKMSMVVKIYFLAIRASTVAILERQLK 593
           Y +Q      H  S+   + + AV+ ++ N   L+ ++V+K   L IR S     E +  
Sbjct: 546 YTVQLNRLDMH--SMKPFAMETAVQDNLTNFRILEKNLVIKTMKLMIRHSLTIHYENE-- 601

Query: 594 ERLGDIKSIARCYREVGAEAFESGLDLCEILRDYLSTAGDLENARVMPDHRYILNQCVQV 653
           E L DI   +  +     +  +  +D+  I   +LS   D   + +   +++ +N+  + 
Sbjct: 602 EHL-DIWKASNFF----FQTLKGAVDIANICYKFLSGQYD---SHLHSGYQFHVNRACEA 653

Query: 654 GIFRVSYYLISVTLTLLQVKNGLESYRWQNRNKHSLADELERNISILGECTKAVFQNVQK 713
            + +    L S+ L  L  K       +Q +      ++L+    I  E  + + +N  +
Sbjct: 654 AVEKCCLILCSLALRCLHAKK-----MFQTKEDFQQDEQLQ---FITAEIHELLMKNYNE 705

Query: 714 LIHQGSHSLSDRYFTSFKQFLFLDYAMQVIQNEMDPTTPS 753
           L     + L  +Y+ SFK    L +  +++ N  D    S
Sbjct: 706 LASILFNKLGAKYYQSFKALAILRFFFRILNNPEDSVIGS 745

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/32 (65%), Positives = 24/32 (75%)

Query: 20 KKSRMRQSFVCRNCKKRKIKCDKARPSCGRCS 51
          KK R R + VC NCKKRKIKCD+ RP+C  CS
Sbjct: 18 KKKRQRTTVVCTNCKKRKIKCDRKRPACSNCS 49

>Scas_674.12*
          Length = 909

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%)

Query: 23 RMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRRGLPGPGT 76
          + R SFVC  C+ +K+KCDKARPSCGRC K    CVY+   ++   +   G  T
Sbjct: 8  KARPSFVCLVCRSKKVKCDKARPSCGRCRKTNKLCVYEIDTDQLAGQFDEGSAT 61

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 109/542 (20%), Positives = 214/542 (39%), Gaps = 62/542 (11%)

Query: 252 AKLIELILNVLPHRDQIETLLNYYMTVMYPLVPYLNKTSFLQLVGDTLIYSPVGVVNGLK 311
           A+ IE+IL     +D I+ LL  + + +YP  P ++  +F + + + L+ S     NG +
Sbjct: 281 AREIEVIL---LDKDVIDILLKKFYSEVYPFYPLIDIPTFEKKLKNVLLNS-----NGRR 332

Query: 312 F-----GSHEDFTRKIGCIATLLILLRIAHTAMTLVDDTAY---DRAI--SNRLVLISQK 361
           +     GS      K+  +A  LI++ I   + T  ++  +     A+  + +L++ +QK
Sbjct: 333 YELNLYGSTTGIRLKLESLALFLIIISITLRSPTYSEEECHILKSNALETARQLLIFAQK 392

Query: 362 CLAHLLKLSHKTNEDILSCLLLMRWSLIYSPXXXXXXXXXXXXXLPSLTINHAIKIGLYR 421
            L+ LL     TNE++L  LL +  +   +P                     A +IGLY 
Sbjct: 393 LLS-LLNGFKFTNENVLCSLLYLFLAEYLNPENRDVDITNDKIMTLKCLNTLATQIGLYN 451

Query: 422 DCVEVDANFVTDP-KQRYFIHYRAKLWMGCLILMRSDFYLRGTYPIVSSEYFSMEPKQDS 480
           D       +  DP     F  +R KLW+G   +    F   G+    +S+Y  +    D+
Sbjct: 452 DPSSY-PRYDNDPFTGEAFQQFRRKLWIGIQSINFQIFTSNGSSTTQNSDYLKI--FLDT 508

Query: 481 VHNYEDELESQIHNVLHKQLRMYAKIR-------ILDKLSLQVHEKTDVEEIYAKIRQLE 533
             N    L S+   V   + + +   R       I+ +L       T  ++++  +  ++
Sbjct: 509 ATNVTSLLSSKNFEVSEMKRKSFPYKRTNMNFIIIVARLMNSCTSLTTDQDLFEILENIK 568

Query: 534 YDLQ------SIAPLSHTQSLAGVSGQEAVRRSMNNAVYLKMSMVVKIYFLAIRA--STV 585
             L        I+ L+  +  + +  +   R +  N   ++ + ++ +  L +    +  
Sbjct: 569 STLAFMHQRFPISKLTDFEITSDIQTEPQWRNAEINLTGVEATEILNMNILGLSTIMNVY 628

Query: 586 AILERQLKERLGDIKSIARCY-REVGAEAFESGLDLCEILRDYLSTAGDLENARVMPDHR 644
            +L    ++  G   S    Y  +   E   + L L  ++ DYL     L   R   D+ 
Sbjct: 629 NVLSFHFEKTTGTNTSNNEPYFHKFILEGINAYLKLTTLIVDYLKGNYSLHIKR---DNE 685

Query: 645 YILNQCVQVGIFRVSYYLISVTLTLLQVKNGLE-SYRWQNRNKHSLADEL---------- 693
           Y LN+   + +         V L L Q+   L  SY+ + R +  + +            
Sbjct: 686 YCLNKYAVLTL---------VKLWLSQMAYSLRFSYKKEIRKQQKVINSTTFLTNYPEDD 736

Query: 694 ERNISILGECTKAVFQNVQKLIHQGSHSLSDRYFTSFKQFLFLDYAMQVIQNEMDPTTPS 753
           ++  ++L      + + +Q L+   +  L D YF  ++  L   Y + V+ N   P   +
Sbjct: 737 DKLDTLLNLGISHIQRQMQVLVDLAAERLQDTYFGCYQATLMAKYLLYVMDNAALPNFIN 796

Query: 754 RL 755
           R 
Sbjct: 797 RF 798

>YOR363C (PIP2) [5140] chr15 complement(1020218..1023208)
          Transcription factor required for induction of
          peroxisomal proteins in response to oleic acid [2991
          bp, 996 aa]
          Length = 996

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 29/40 (72%)

Query: 21 KSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD 60
          K R R SFVC+ C+K K KCD+ +P CGRC+K  L C+YD
Sbjct: 16 KKRNRLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFCIYD 55

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 100/220 (45%), Gaps = 15/220 (6%)

Query: 255 IELILNVLPHRDQIETLLNYYMTVMYPLVPYLNKTSFLQLVGDTLIYSPVGVVNGLKFGS 314
           I  I   LP +  IE  L+++   ++ L+P+ +K    + +  T+ Y+ +G V  L  G+
Sbjct: 266 INEIEKTLPPKAIIEQYLSHFFEHIFHLIPFASKEMLEESIHTTVQYNELGEVR-LSMGT 324

Query: 315 HEDFTRKIGCIATLLILLRIAHTAMTLVDDTAYDRA------------ISNRLVLISQKC 362
                 K+  +  LL++LRIA+ ++T ++D   D +            I + ++ ++Q+ 
Sbjct: 325 TL-IRNKMENLCILLLILRIAYISLTFIEDKIEDYSPYITKEMLEQYPIQSEVIFLAQQI 383

Query: 363 LAHLLKLSHKTNEDILSCLLLMRWSLIYSPXXXXXXXXXXXXXLPSLTINHAIKIGLYRD 422
           LA         NE+ +SCLL +  + ++SP             + +L I     IGL+RD
Sbjct: 384 LASE-NWCACANENTISCLLYIWCAFVFSPTEGDFLLEQPSDVIINLVILIGTSIGLHRD 442

Query: 423 CVEVDANFVTDPKQRYFIHYRAKLWMGCLILMRSDFYLRG 462
             +  A    +   +  ++ R   W+  + +   +  L+G
Sbjct: 443 PSDFPALNHPEASDKRLLNLRRIQWLSIISMATLESSLKG 482

>YAL051W (OAF1) [17] chr1 (48565..51753) Transcription factor
          required for induction of SPS19 and POX1 on
          oleate-containing medium, plays a role in peroxisome
          proliferation [3189 bp, 1062 aa]
          Length = 1062

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 31/54 (57%)

Query: 7  SNTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD 60
          S+T  A        + R R  FVC+ C K K KCD+ +P CGRC K  L+CVYD
Sbjct: 43 SSTSPAPENSETHNRKRNRILFVCQACWKSKTKCDREKPECGRCVKHGLKCVYD 96

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 79/364 (21%), Positives = 151/364 (41%), Gaps = 50/364 (13%)

Query: 261 VLPHRDQIETLLNYYMTVMYPLVPYLNKTSFLQLVGDTLIYSPVGVVN-GLKFGSHEDFT 319
           +LP  + IE   N++   +YP +P++    F + +  T+   P       ++ GS     
Sbjct: 336 ILPSYEIIERYKNHFYEYVYPSLPFIELEIFEESLSQTIFPDPNNPSKVQIRMGSTH-LR 394

Query: 320 RKIGCIATLLILLRIAHTAMTLVDDTAYDRA------------ISNRLVLISQKCLAHLL 367
            K+  ++ LL++L++++ ++  +D +  D +            I N  +L+S +CLA   
Sbjct: 395 AKVENLSLLLVILKLSYMSIRFLDHSTADSSFYLSKEIIDKYPIPNDFILLSPRCLASE- 453

Query: 368 KLSHKTNEDILSCLLLMRWSLI-YSPXXXXXXXXXXXXXLPSLTINHAIKIGLYRDCVEV 426
                 NE+I+SCLL + WS   +SP             + SL +  +  IGL+RD  + 
Sbjct: 454 NWCACANENIISCLLYI-WSFFAFSPEEGDFFLEHPTDVISSLIMMLSTSIGLHRDPSDF 512

Query: 427 DANFVTDPKQRYFIHYRAKLWMGCLILMRSDFYLRGTY---PIVSSEYFSMEPKQDSVHN 483
                     +  +++R  LW+  + +   +  L+G +   PI     F      DS+  
Sbjct: 513 PQLISPSTSDKRTLNHRRILWLSIVTVCSFEASLKGRHSVSPISLMALFLNIKDPDSLTV 572

Query: 484 YEDELES-----------QIHNVLHKQLRMYAKIRILDKLSLQ------------VHEKT 520
           Y + +             +IH    K+ ++   +  LD L++             + EK 
Sbjct: 573 YMNRVRGDLSDINNHTLLRIHKFTFKRAQLALLLSDLDNLTMTYYGSFHLHSIEFIREKI 632

Query: 521 D--VEEIYA-----KIRQLEYDLQSIAPLSHTQSLAGVSGQEAVRRSMNNAVYLKMSMVV 573
           +  VEE +       + Q + DL  +  +S    L+  +      R MN  + L+ SM V
Sbjct: 633 EIFVEENFPIVPLKSVAQDKSDLDDMNVISEMNILSSENSSSFHNRIMNKLLMLRTSMAV 692

Query: 574 KIYF 577
            ++F
Sbjct: 693 FLHF 696

>ACR241C [1288] [Homologous to ScYKR064W - SH] (784358..786745)
          [2388 bp, 795 aa]
          Length = 795

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 21 KSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKL--ELECVYDFQENKDGRRGLPGPG 75
          K R RQ+ VC NCK+RK +CD+ +P+CG C +L     C Y    ++ G  G   PG
Sbjct: 5  KKRQRQTLVCSNCKRRKSRCDRGKPACGNCIRLGNRETCHYFISPSEKGGDGGDSPG 61

>Kwal_34.15751
          Length = 628

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 61/132 (46%), Gaps = 12/132 (9%)

Query: 15  EPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRRGLPGP 74
           + P+ KK+R+  S VC  C+ RK+KC+K +PSC RC K +L+CVY        R G P  
Sbjct: 2   QTPKSKKNRI--SHVCDACRIRKLKCNKQKPSCSRCVKHDLQCVY----TPYRREGDPSA 55

Query: 75  GTXXXXXXXXXXXXXXXRYTINACKRHDLSDAADHKTAVK-INYFYGLQPSSLDSVYRCA 133
                             ++ N+     LS  A  +   + I +   + P  +D V+R  
Sbjct: 56  IESLQKELLHLKQQLASAHSSNS-----LSPRAPIREETELIEWNKLVVPVCVDGVWRSH 110

Query: 134 YQPFSDMGMIQK 145
           Y P SD+ +  +
Sbjct: 111 YMPSSDLALFAR 122

>KLLA0A06039g 557368..559341 weakly similar to sp|P36023
          Saccharomyces cerevisiae YKR064w singleton, start by
          similarity
          Length = 657

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 29/46 (63%), Gaps = 2/46 (4%)

Query: 21 KSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVY--DFQEN 64
          K R R + VC NC++RK KCD+ +PSC  C KL   CVY  D  EN
Sbjct: 12 KKRHRPTLVCLNCRRRKTKCDRGKPSCSNCLKLGETCVYSEDTDEN 57

>KLLA0D05038g 433653..435674 weakly similar to sp|P40971
          Saccharomyces cerevisiae YDR034c LYS14 transcriptional
          activator of lysine pathway genes singleton, start by
          similarity
          Length = 673

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 36/63 (57%), Gaps = 2/63 (3%)

Query: 1  MLNYSPSNTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD 60
          M + +P    S  +EP   KK R      C  CK++K+KCD+ +P C +C+ L LECVY 
Sbjct: 1  MADTTPDTAVSNVTEPA--KKKRKYSKNGCLECKRKKVKCDETKPMCWQCTHLSLECVYK 58

Query: 61 FQE 63
           +E
Sbjct: 59 TKE 61

>ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1435705..1438128) [2424 bp, 807 aa]
          Length = 807

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (61%)

Query: 11 SASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQ 62
            S +  + K  R + SFVC++C++ K KCDK +PSC RC K    CVYD +
Sbjct: 20 GVSGKVTKTKGRRNKLSFVCQSCRRSKTKCDKVKPSCTRCVKNGSVCVYDVE 71

>CAGL0C01199g complement(121944..124712) similar to tr|Q12151
          Saccharomyces cerevisiae YDR213w UPC2, hypothetical
          start
          Length = 922

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 23/30 (76%)

Query: 30 CRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          C NCK+R++KCD+ +P C +CS L L CVY
Sbjct: 48 CDNCKRRRVKCDEGKPGCKKCSNLNLVCVY 77

>KLLA0F18084g complement(1652031..1654613) no similarity,
          hypothetical start
          Length = 860

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 27/34 (79%)

Query: 27 SFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD 60
          SF C+NC+K + KCD+ +P+C RC K +++CVY+
Sbjct: 2  SFSCQNCRKTRRKCDRGKPTCARCIKYKIDCVYE 35

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 31/47 (65%)

Query: 248 TTAQAKLIELILNVLPHRDQIETLLNYYMTVMYPLVPYLNKTSFLQL 294
           + +  KLI+ +L++LP +D++ T+L+++ T ++   P L+   F QL
Sbjct: 331 SDSPTKLIDDMLSLLPPQDKMRTILSHFYTNVHGPYPILDVNEFEQL 377

>Kwal_23.3122
          Length = 788

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 25/30 (83%)

Query: 30 CRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          C NCK+R++KCD+ +PSC +C  ++LECVY
Sbjct: 50 CDNCKRRRVKCDEDKPSCQKCLNMKLECVY 79

>YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding protein,
           contains a Zn[2]-Cys[6] fungal-type binuclear cluster
           domain in the N-terminal region [2850 bp, 949 aa]
          Length = 949

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 36/62 (58%), Gaps = 3/62 (4%)

Query: 8   NTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDG 67
           +T +A+S+  E  K R+R    C  CKKRK+KCD   P C  CSK + EC YDF+     
Sbjct: 67  DTSTAASK--ENGKGRLRVQKACELCKKRKVKCDGNNP-CLNCSKHQKECRYDFKATNRK 123

Query: 68  RR 69
           RR
Sbjct: 124 RR 125

>YLR228C (ECM22) [3628] chr12 complement(600021..602465) Sterol
          regulatory element binding protein involved in the
          regulation of sterol biosynthetic gene expression and
          may be involved in regulating sterol uptake [2445 bp,
          814 aa]
          Length = 814

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 25/30 (83%)

Query: 30 CRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          C NCK+R++KCD+ +P C +C+ ++L+CVY
Sbjct: 44 CDNCKRRRVKCDEGKPFCKKCTNMKLDCVY 73

>Scas_679.26
          Length = 775

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 27/39 (69%)

Query: 30 CRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGR 68
          C NCK+R++KCD+ +P+C +C  + LECVY   + +  +
Sbjct: 58 CDNCKRRRVKCDELKPTCQKCINMNLECVYSMPKPRKAK 96

>YDR213W (UPC2) [1051] chr4 (889744..892485) Sterol regulatory
          element binding protein involved in the regulation of
          sterol biosynthetic gene expression and the uptake and
          intracellular esterification of sterols [2742 bp, 913
          aa]
          Length = 913

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 25/30 (83%)

Query: 30 CRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          C NCK+R++KCD+ +P+C +C+ ++LEC Y
Sbjct: 51 CDNCKRRRVKCDEGKPACRKCTNMKLECQY 80

>KLLA0C14212g complement(1229219..1232341) some similarities with
           sp|P25611 Saccharomyces cerevisiae YCR106w, hypothetical
           start
          Length = 1040

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 28/47 (59%), Gaps = 1/47 (2%)

Query: 23  RMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRR 69
           R R S+VC  C++RK +CD+  P C +C  L  ECVY   E  +G +
Sbjct: 68  RNRVSYVCYACRRRKTRCDRGNP-CSKCVALSTECVYSISEMNNGNK 113

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 99/463 (21%), Positives = 188/463 (40%), Gaps = 51/463 (11%)

Query: 251 QAKLIELILNVLPHRDQIETLLNYYMTVMYPLVPYLNKTSFLQLVGDTLIYS-PVGVVNG 309
           Q  L +++  + P    I   L  ++  +YP  PYL+   FL+ +   + Y    G   G
Sbjct: 399 QTLLSDILETLPPTGAGITFYLFQFLKSIYPFYPYLDVEPFLESIYRMISYEDATGAPTG 458

Query: 310 LKFG--SHEDFTRKIGCIATLLILLRIAHTAMTL-------VD---------DTAYDRAI 351
                 S ++    +  +A  +++L+I+H  +T+       +D         D  YD+ +
Sbjct: 459 KARWNLSKDNLRNDLENLAIFMVILQISHDFLTVSLNEDVKMDCIALGLHKLDFTYDKWL 518

Query: 352 SNRLVLISQKCLAHLLKLSHKTNEDILSCLLLMRWSLIYSPXXXXXXXXXXXXXLPSLTI 411
           S     +SQ+ L  LL +    +EDI  C+L  R    +SP                  +
Sbjct: 519 S-----LSQRILT-LLNVDRFYSEDIFCCMLYQRICCSFSPRESNLLLDQHLLLHSGQLL 572

Query: 412 NHAIKIGLYRDCVEVDANFVTDPKQRYFIHYRAKLWMG-CLILMRSDFYLRGTYPIVS-S 469
             A+ +GL++D  +    F      +  I+YR KLW+G C  + +    L  T  I    
Sbjct: 573 QTALVLGLHKDPTDYKLMFNPSLIPQRVINYRRKLWLGLCNSIFQETLPLGFTAKIEQYH 632

Query: 470 EYF--------SMEPKQDSVHNYEDELESQIHNVLHKQLRMYAKIRILDKLSLQVHEKTD 521
           +YF         ME  ++S+ +   + + Q+ N+  K+ ++   +  ++K          
Sbjct: 633 DYFFKNLDYTSFMESVRNSMTS-SGKFDYQLINLAIKKYQLGLLMAKINKACTDFVPAA- 690

Query: 522 VEEIYAKIRQLEYDLQSIAPLSHTQSLAGVSGQ-EAVRRSMNNAVYLKMSMVVKIYFLAI 580
           V EI   I +LE      A +   +SL    G  +A  +  +    + ++ V++   + +
Sbjct: 691 VSEILFMISKLE------AEVLKFESLKDYPGDTQATIKLPSTTCTMDIAEVLRCEIVIM 744

Query: 581 RASTVAILERQLKERLGDI------KSIARCYREVGAEAFESGLDLCEILRDYLSTAGDL 634
           + +T +++   L      +      +  A  YR + +  FE  +  C     +LS     
Sbjct: 745 KLATSSLIHNVLWSLYLKVEVKLKSEENATFYR-LHSTLFEMMVFNCFKFYSFLSDLMFN 803

Query: 635 ENARVMPDHRYILNQCVQVGIFRVSYYLISVTLTLLQVKNGLE 677
           +  +     RY+L + +Q    RVS   +S+ L L  V+  LE
Sbjct: 804 KYEKDTAQFRYVLAKHIQQSYLRVSLCFLSILLKLALVEKDLE 846

>Kwal_33.13934
          Length = 797

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 28/41 (68%), Gaps = 2/41 (4%)

Query: 21 KSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKL--ELECVY 59
          K R R + VC NCK+RK KCD+ +P CG CS+L  +  CVY
Sbjct: 14 KKRRRPTVVCTNCKRRKSKCDRLKPICGNCSRLGDQATCVY 54

>CAGL0F07865g complement(768270..770804) similar to tr|Q12151
          Saccharomyces cerevisiae YDR213w UPC2, start by
          similarity
          Length = 844

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 25/30 (83%)

Query: 30 CRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          C +CK+R++KCD+ +P C +C K++LECVY
Sbjct: 54 CDHCKRRRVKCDEGKPMCDKCVKMKLECVY 83

>AGL091W [4220] [Homologous to ScYLR228C (ECM22) - SH; ScYDR213W
           (UPC2) - SH] complement(535317..537917) [2601 bp, 866
           aa]
          Length = 866

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 23/30 (76%)

Query: 30  CRNCKKRKIKCDKARPSCGRCSKLELECVY 59
           C NCK+R++KCD+ +P C +C K+ L CVY
Sbjct: 89  CDNCKRRRVKCDEGKPGCQKCLKMRLSCVY 118

>Sklu_1622.2 YDR034C, Contig c1622 1522-3858
          Length = 778

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 27/44 (61%)

Query: 30  CRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRRGLPG 73
           C  CKKR++KCD+ +PSC +C++L  ECVY        R+   G
Sbjct: 164 CTECKKRRMKCDEGKPSCWQCTRLNRECVYILNPKNKKRKPRVG 207

>Kwal_55.20674
          Length = 252

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 30/49 (61%)

Query: 13 SSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDF 61
          +S   +  K R    F C++C++RK KC + +P C RC++L + CVY+ 
Sbjct: 4  NSRATKMGKDRSGAMFTCKSCRQRKRKCSREKPQCQRCARLSIPCVYEL 52

>Kwal_56.23058
          Length = 775

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 35/61 (57%), Gaps = 2/61 (3%)

Query: 9   TGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGR 68
           T S+ ++    K+   R    C  CK+R++KCD+ +P+C +C++L  ECVY  +     R
Sbjct: 130 TSSSGADGKTVKRKYSRNG--CTECKRRRMKCDEGKPTCWQCARLNRECVYVIRTKNRKR 187

Query: 69  R 69
           R
Sbjct: 188 R 188

>KLLA0C17050g 1490472..1493339 some similarities with
          ca|CA3454|IPF10533.exon1 Candida albicans unknown
          function, exon 1, hypothetical start
          Length = 955

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 25/42 (59%)

Query: 18 EFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          + +  R RQ   C  C KRKIKCD+A+P C  C K   EC+Y
Sbjct: 34 KIQHKRQRQILSCVACHKRKIKCDRAKPVCESCGKNGWECLY 75

>KLLA0A04169g complement(376273..378600) similar to sgd|S0004218
          Saccharomyces cerevisiae YLR228c ECM22, start by
          similarity
          Length = 775

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 23/30 (76%)

Query: 30 CRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          C +CK+R++KCD+ RP C  C K+ L+CVY
Sbjct: 57 CDHCKRRRVKCDETRPHCLNCKKMSLDCVY 86

>Kwal_55.20722
          Length = 827

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 24/43 (55%)

Query: 25 RQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDG 67
          R   VC  C+ RK+KCDKARP C RC +  L C Y    N  G
Sbjct: 10 RPRLVCLECRNRKLKCDKARPKCTRCKQNLLTCSYANDGNSPG 52

>YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional
          activator of gluconeogenic genes through CSRE elements,
          activated by Snf1p kinase, contains a Zn[2]-Cys[6]
          fungal-type binuclear cluster domain [2490 bp, 829 aa]
          Length = 829

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 35/64 (54%), Gaps = 5/64 (7%)

Query: 9  TGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGR 68
          TG +SS         +R++  C  C+ +KIKCD  +P+C  C+K++  C      +K  R
Sbjct: 27 TGQSSSNA--ITDFSVRKAHACDRCRLKKIKCDGLKPNCSNCAKIDFPCK---TSDKLSR 81

Query: 69 RGLP 72
          RGLP
Sbjct: 82 RGLP 85

>YCR106W (RDS1) [627] chr3 (310954..313452) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region, involved in resistance to cycloheximide [2499
          bp, 832 aa]
          Length = 832

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 27/41 (65%), Gaps = 2/41 (4%)

Query: 20 KKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD 60
          KK R+R   VC  CKK K KCDK RP+C RC +  L+C Y+
Sbjct: 7  KKPRLR--LVCLQCKKIKRKCDKLRPACSRCQQNSLQCEYE 45

>Scas_709.51
          Length = 759

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 1/64 (1%)

Query: 1  MLNYSPSNTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD 60
          M++   ++  +  +  PE KK R+R    C  CK+RK+KCD  +P C  C K E++C Y+
Sbjct: 5  MIHSHETHRNAMDNTSPERKKQRIRVQRACNICKRRKVKCDGNKP-CLNCIKKEIDCEYN 63

Query: 61 FQEN 64
             N
Sbjct: 64 NSSN 67

>YLL054C (YLL054C) [3369] chr12 complement(32894..35203) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [2310 bp, 769 aa]
          Length = 769

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%)

Query: 21 KSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENK 65
          + +++ SFVC  CK+RKIKCDK  P+C +C      C Y+ +  +
Sbjct: 6  QKKVKPSFVCLRCKQRKIKCDKLWPTCSKCKASSSICSYEVEPGR 50

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 63/266 (23%), Positives = 108/266 (40%), Gaps = 22/266 (8%)

Query: 254 LIELILNVLPHRDQIETLLNYYMTVMYPLVPYLNKTSFLQLVGDTLIYSPVGVVNGLKFG 313
           L+E +     ++++++ L+  +   +YP+ P L  + F   + + L  +     N +  G
Sbjct: 222 LLEELSKYFLNKNEVDGLIVDFYKTIYPVYPLLEISLFEDNIRELLQLNEFNGYNIVFAG 281

Query: 314 SHEDFTRKIGCIATLLILLRIAHTAMTLVDDTAYDRAI---SNRLVLISQKCLAHLLKLS 370
             +D  RK+  I  L I+L  ++  ++L    ++  +    SN L L++ K LA L+ + 
Sbjct: 282 --KDSRRKLETITLLTIILAFSYRRLSLSTSHSFKESFGVKSNNLTLLAHKLLA-LMNVF 338

Query: 371 HKTNEDILSCLLLMRWSLIYSPXXXXXXXXXXXXXLPSLTINHAIKIGLYRDCVEVDANF 430
              NE  L CLL        +P                   N AIK+GL  +  +    +
Sbjct: 339 QYVNEHTLCCLLYFFILRYLNPDQADMYPTHSDILNLKFLENVAIKLGLNEEPFQY-TRY 397

Query: 431 VT--DPKQRYFIHYRAKLWMGCLILMRSDFYLRGTYPIVSSEYFSMEPKQD--------- 479
           V+  D   R F + R KLW+G   L        G   I+S EY     K D         
Sbjct: 398 VSESDDYPRLF-NLRRKLWLGVQFLKFGILIPEGDSDILSLEYLRSFMKTDESLPELFER 456

Query: 480 ---SVHNYEDELESQIHNVLHKQLRM 502
              S +N +  L +   N+ H  L +
Sbjct: 457 NYASTNNLDLSLMATAENIYHLHLSL 482

>ABL099W [493] [Homologous to ScYDR034C (LYS14) - SH]
           complement(212832..215234) [2403 bp, 800 aa]
          Length = 800

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 10  GSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
            SA  +P   K+   R    C  CK+R++KCD+ +P C +CS+L  EC Y
Sbjct: 179 ASAVGDPKRTKRKYSRNG--CTECKRRRMKCDEGKPICWQCSRLNRECKY 226

>KLLA0C19228g 1713787..1715562 similar to sp|P53749 Saccharomyces
          cerevisiae YNR063w singleton, hypothetical start
          Length = 591

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 29 VCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRR 69
           C  CKKRK KCD  +P C RC+KL ++C+Y     KD R+
Sbjct: 2  ACLECKKRKQKCDGQKP-CRRCTKLNVKCIYGTDRRKDKRK 41

>YLR014C (PPR1) [3432] chr12 complement(172267..174981)
          Transcription factor regulating pyrimidine pathway,
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region [2715 bp, 904 aa]
          Length = 904

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 30/48 (62%), Gaps = 2/48 (4%)

Query: 11 SASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECV 58
          S   + P    S+ R +  C+ C+ +KIKCD+  PSC RC+KLE+ CV
Sbjct: 17 SKRGDSPNIGISKSRTA--CKRCRLKKIKCDQEFPSCKRCAKLEVPCV 62

>Sklu_2268.2 YKR064W, Contig c2268 4260-6887 reverse complement
          Length = 875

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 26/41 (63%), Gaps = 2/41 (4%)

Query: 21 KSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKL--ELECVY 59
          + R R + VC NCK+RK KCDK +P+C  C +L  E  C Y
Sbjct: 4  RRRNRPTVVCSNCKRRKSKCDKQKPACSNCVRLGDEATCTY 44

>Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement
          Length = 687

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 21 KSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRRGLPGPG 75
          K R+R    C  CKKRKIKCD  +P C  C+K  ++CVY F +        P PG
Sbjct: 19 KQRLRVRKACEICKKRKIKCDGHQP-CTSCTKNSVQCVYKFTDTASPISK-PKPG 71

>YDR034C (LYS14) [885] chr4 complement(509732..512104)
           Transcriptional activator of lysine pathway genes with
           2-aminoadipate semialdehyde as coinducer [2373 bp, 790
           aa]
          Length = 790

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 26/40 (65%)

Query: 30  CRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRR 69
           C  CK+R++KCD+ +P+C +C++L  +CVY        RR
Sbjct: 159 CSECKRRRMKCDETKPTCWQCARLNRQCVYVLNPKNKKRR 198

>Sklu_2397.8 YML099C, Contig c2397 9784-12330
          Length = 848

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 15 EPPEFKKSRMRQSFV-CRNCKKRKIKCDKARPSCGRCSKLELEC 57
          E  + +K R  ++F  C  C+ RK+KCD  RPSC RC +   EC
Sbjct: 4  EKSDIRKPRRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFEC 47

>KLLA0F04213g 400673..402979 similar to sp|P40971 Saccharomyces
           cerevisiae YDR034c LYS14 transcriptional activator of
           lysine pathway genes singleton, start by similarity
          Length = 768

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 24/30 (80%)

Query: 30  CRNCKKRKIKCDKARPSCGRCSKLELECVY 59
           C  CKKR++KCD+ +P+C +C++L  +CVY
Sbjct: 155 CLECKKRRMKCDEGKPTCWQCARLNRKCVY 184

>CAGL0K11902g complement(1148381..1150876) similar to sp|P40971
           Saccharomyces cerevisiae YDR034c LYS14 transcriptional
           activator of lysine pathway genes, hypothetical start
          Length = 831

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 27/44 (61%)

Query: 30  CRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRRGLPG 73
           C  CK+R++KCD+++P C +C++L  +CVY        R+   G
Sbjct: 204 CAECKRRRMKCDESKPKCWQCTRLNRDCVYILNPKNKKRKTSKG 247

>KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces
          cerevisiae YLR256w HAP1 transcription factor singleton,
          hypothetical start
          Length = 1253

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 27/46 (58%)

Query: 7  SNTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSK 52
          S+  S  +  P+ K+ R R    C  C+KRK+KCDK RP C +C K
Sbjct: 2  SSITSPGTGTPQQKRKRNRVPLSCTICRKRKVKCDKGRPQCQQCVK 47

>AFR171W [3363] [Homologous to NOHBY] complement(752592..754430)
          [1839 bp, 612 aa]
          Length = 612

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 24/36 (66%)

Query: 30 CRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENK 65
          C  CK+RK+KCD+ +P+C +CS L   CVY    +K
Sbjct: 22 CSECKRRKVKCDETKPACWQCSHLGKRCVYMVNNSK 57

>CAGL0B03421g complement(336071..340138) similar to sp|P12351
          Saccharomyces cerevisiae YLR256w HAP1 transcription
          factor, hypothetical start
          Length = 1355

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%)

Query: 20 KKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSK 52
          KK R R    C  C+KRK+KCDK RP C +C+K
Sbjct: 13 KKKRNRIPLSCTICRKRKVKCDKTRPHCNQCTK 45

>AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH]
          complement(606993..609551) [2559 bp, 852 aa]
          Length = 852

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query: 25 RQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRRGLP 72
          R S  C  C+ +KIKCD  RPSC  C K+  +C      +K  RRG P
Sbjct: 24 RSSQACDRCRLKKIKCDGLRPSCTSCKKIGYQCK---TSDKLTRRGFP 68

>Scas_661.23
          Length = 741

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 38/76 (50%), Gaps = 8/76 (10%)

Query: 3   NYSPSNTGSASSEPPEFKKSRMRQSFV--------CRNCKKRKIKCDKARPSCGRCSKLE 54
           N   S T S S+  P+   +  + + V        C  CK+R++KCD+ +P C +C++L 
Sbjct: 97  NSPNSETKSNSTNLPDSDTNAKKTNIVKRKYSRNGCAECKRRRMKCDETKPICWQCARLS 156

Query: 55  LECVYDFQENKDGRRG 70
            ECVY  +     R+ 
Sbjct: 157 RECVYIVKSGNKKRKS 172

>Scas_234.1
          Length = 337

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 33/61 (54%), Gaps = 9/61 (14%)

Query: 1  MLNYSPSNTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKL--ELECV 58
          M N  P+   S +S      K R R + VC NCKKRK KCD+ RP C  C++L     C+
Sbjct: 10 MSNVYPTEYNSQNS------KKRNRPTVVCTNCKKRKSKCDRGRP-CSTCARLGDGDRCI 62

Query: 59 Y 59
          Y
Sbjct: 63 Y 63

>YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription factor
          with heme-dependent DNA-binding activity, responsible
          for heme-dependent activation of many genes [4509 bp,
          1502 aa]
          Length = 1502

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 26/40 (65%)

Query: 13 SSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSK 52
          SS+  + K+ R R    C  C+KRK+KCDK RP C +C+K
Sbjct: 47 SSDSSKIKRKRNRIPLSCTICRKRKVKCDKLRPHCQQCTK 86

>Kwal_56.24566
          Length = 755

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 25/41 (60%)

Query: 19 FKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
           +  R R    C  C+ R+ KCD+ARP CG CSK  L+C++
Sbjct: 21 LRPKRNRSRAGCFTCRLRRKKCDEARPKCGTCSKHMLKCIW 61

>Kwal_47.17233
          Length = 948

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 23 RMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRRGLPG 73
          R R+   C  C KRKIKC +  PSC +C K   EC Y F  ++  R G  G
Sbjct: 28 RQRKILSCVPCHKRKIKCTRETPSCSKCLKKNWECSY-FLNDRISRGGHSG 77

>CAGL0I07755g complement(745315..748476) similar to tr|Q12180
           Saccharomyces cerevisiae YOL089c HAL9, hypothetical
           start
          Length = 1053

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 3/61 (4%)

Query: 13  SSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARP---SCGRCSKLELECVYDFQENKDGRR 69
           S  P +  K + R +  C  C+KRK KCD+  P    C  CSK  ++C++  +  K  R+
Sbjct: 161 SQMPGQLHKEKRRAAKACEYCRKRKTKCDEVSPYTNKCSNCSKAGVDCIFITEPTKKKRK 220

Query: 70  G 70
            
Sbjct: 221 S 221

>Scas_521.2
          Length = 890

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 31/49 (63%), Gaps = 4/49 (8%)

Query: 10 GSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECV 58
          GS SS    F  S+ + +  C+ C+ +KIKCD+  PSC RC+ L++ CV
Sbjct: 25 GSPSSS--TFNTSKSKSA--CKRCRSKKIKCDQKFPSCDRCAHLKVPCV 69

>Scas_550.5*
          Length = 832

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 25/36 (69%)

Query: 25 RQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD 60
          R + VC  C+ +K++C++ RPSC RC ++   CVY+
Sbjct: 10 RPTHVCAACRTQKLRCNRERPSCSRCQRIGRTCVYE 45

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 85/417 (20%), Positives = 171/417 (41%), Gaps = 28/417 (6%)

Query: 350 AISNRLVLISQKCLAHLLKLSHKTNEDILSCLLLMRWSLIYSPXXXXXXXXXXXXXLPSL 409
            IS +L++ISQK L+ LL     T E++LSCLL +  +   +P                 
Sbjct: 309 VISKKLLIISQKLLS-LLNGYKFTTENVLSCLLYIFVAEFLNPENTEMHITHNQILTLKC 367

Query: 410 TINHAIKIGLYRDCVEVDANF-VTDPKQRYFIHYRAKLWMGCLILMRSDFYLRGTYPIVS 468
               +  +GLY++  +        +P   YF  +R KLW+G   L        G    V+
Sbjct: 368 LTELSYTLGLYKEPSQFTRYLNRPEPSDVYFT-FRRKLWIGLQSLRLEILTADGGCNDVT 426

Query: 469 SEYFSMEPKQDS--VHNYEDELESQI---HNVLHKQLRMYAKIRILDKLSLQV---HEKT 520
             Y +   K++   V ++ +   S +    ++   Q   Y    +L ++ L       + 
Sbjct: 427 QGYLNEFLKENKAMVPSFMEHFNSVLTCDRHLFKIQDNKYQFHMLLARVMLDCCSSSNEQ 486

Query: 521 DVEEIYAKIRQLEYDLQSIAPLSHTQSLAG--VSGQEAVRRSMNNAVYLKMSMVVKI--Y 576
           D++ I   I +L      + PLS  +      V  + A R    N   ++ + +++I   
Sbjct: 487 DLKRITDSIAKLSEFTLRVFPLSKLKETMKDRVIEENAWRGGRFNLDMIERTEILRINMI 546

Query: 577 FLAIRASTVAILERQLKERLG-DIKSIARCYREVGAEAFESGLDLCEILRDYLSTAGDLE 635
           F +   +   +L    +++   + +     Y     ++ ++ L++  +L+ YL       
Sbjct: 547 FFSSLMNIFNVLAIYFEKKCSQNWEKYEDLYHNFFFKSLDNYLEMMTLLKHYLKGGF--- 603

Query: 636 NARVMPDHRYILNQCVQVGIFRVSYYLISVTLT-LLQVKNGLESYRWQNRNKHSLADELE 694
           ++ ++P H Y LN+ V      +S  ++SV L+ LL++   L+     N     +A  L 
Sbjct: 604 SSSILPQHEYCLNRSVSF----ISIKVLSVQLSYLLRLSYKLDMVSRNNEVMKYMAQRLP 659

Query: 695 RNISILGECTKAVFQNVQK----LIHQGSHSLSDRYFTSFKQFLFLDYAMQVIQNEM 747
            +  +L +  K V  +++     +IH       D YF  ++  L   Y   ++++ +
Sbjct: 660 NDDILLIDIVKLVLGHIKNHVYCIIHNTLKRYGDSYFGGYQVMLMGKYVFYLVEHNI 716

>AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH]
          (646832..650290) [3459 bp, 1152 aa]
          Length = 1152

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 24/40 (60%)

Query: 13 SSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSK 52
          SS     K+ R R    C  C+KRK+KCDK RP C +C+K
Sbjct: 2  SSPTASSKRKRNRVPLSCTICRKRKVKCDKTRPHCNQCTK 41

>CAGL0F07909g 776659..779808 some similarities with tr|Q12180
          Saccharomyces cerevisiae YOL089c HAL9 or sp|P38114
          Saccharomyces cerevisiae YBR150c TBS1, hypothetical
          start
          Length = 1049

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 3/44 (6%)

Query: 23 RMRQSFVCRNCKKRKIKCDKARP---SCGRCSKLELECVYDFQE 63
          + R +  C +C+KRKI+CD+  P    C  C K ++EC + F E
Sbjct: 34 KRRSTKACDHCRKRKIRCDEVNPVTNKCSNCVKFKVECTFKFHE 77

>CAGL0L03377g complement(382932..386561) some similarities with
          sp|P46954 Saccharomyces cerevisiae YJL089w SIP4
          interacts with SNF1 protein kinase, hypothetical start
          Length = 1209

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 33/61 (54%), Gaps = 7/61 (11%)

Query: 15 EPPE---FKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRRGL 71
          +PP      +++ R S  C  C+ +KIKCD  +P C  C+K+   CV     +K  RRGL
Sbjct: 11 QPPGELVLTRTKKRHSQACDRCRSKKIKCDGLQP-CSNCAKIGYNCV---TSDKLSRRGL 66

Query: 72 P 72
          P
Sbjct: 67 P 67

>Scas_637.7
          Length = 998

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 15  EPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCS---KLELECVY 59
           +P +    + R S  C +C+KRKIKCDK  PS G+CS   K    C +
Sbjct: 91  KPTKITSGKKRVSKACDHCRKRKIKCDKVDPSTGKCSNCLKYNANCTF 138

>Kwal_26.6664
          Length = 579

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (65%)

Query: 22 SRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          +R R    C  C   K KC+KA+P CGRC++L L+C+Y
Sbjct: 7  TRNRPVKACIKCYNGKRKCNKAKPVCGRCARLHLQCLY 44

>AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH]
          (260414..263032) [2619 bp, 872 aa]
          Length = 872

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 31/51 (60%), Gaps = 3/51 (5%)

Query: 21 KSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLEL-ECVY--DFQENKDGR 68
          K+R + S  C  C+KR++KC+KARP C  C    L ECVY  +F  + + R
Sbjct: 10 KTRRKVSKSCVFCRKRRVKCNKARPKCSTCIGKGLPECVYLSEFTHDVNSR 60

>ACL058W [991] [Homologous to NOHBY] complement(261723..264176)
          [2454 bp, 817 aa]
          Length = 817

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 20 KKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRRG 70
          +  R R+   C  C KRK+KC++ARP C  C K    C Y F  ++  R G
Sbjct: 28 QHKRQRRVLNCMPCHKRKVKCNRARPVCDHCEKNRYACAY-FVNDRVSRGG 77

>KLLA0F00572g complement(42710..44503) some similarities with
          ca|CA2184|IPF6874.3 Candida albicans unknown function,
          3-prime end, hypothetical start
          Length = 597

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 1/49 (2%)

Query: 23 RMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQEN-KDGRRG 70
          + R S  C  C++RK KCD+ +P+C  C +  LEC++    N KDG+ G
Sbjct: 4  KKRSSTGCLICRRRKKKCDEVKPTCTACKRNFLECIWPNSSNTKDGKVG 52

>Kwal_23.6425
          Length = 735

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 27/41 (65%), Gaps = 3/41 (7%)

Query: 22 SRMRQSFV--CRNCKKRKIKCDKARPSCGRCSKLEL-ECVY 59
          SR R+  +  C  C+KRK+KCDK RP CG C+   L ECVY
Sbjct: 26 SRKRRKSIKQCLFCRKRKLKCDKNRPVCGTCASRGLTECVY 66

>Scas_573.4
          Length = 1478

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 28/46 (60%)

Query: 7  SNTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSK 52
          S+  +A+    + K+ R R    C  C+KRK+KCDK RP C +C+K
Sbjct: 20 SSHANANGTSTKVKRKRNRVPLSCTICRKRKVKCDKIRPHCQQCTK 65

>Scas_721.94
          Length = 869

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 22/30 (73%)

Query: 30 CRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          C +CK+R++KCD+ +P+C RC    + CVY
Sbjct: 55 CTHCKRRRVKCDELKPACRRCLNWNVPCVY 84

>Scas_688.17
          Length = 769

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 15 EPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLE-LECVY 59
          +P      + +++  C  C+KRKI CD+  P CG C KL+  +C+Y
Sbjct: 2  DPNNIPTRKPKKNPACIQCRKRKIGCDRGHPKCGNCIKLKRAQCIY 47

>Scas_626.6
          Length = 839

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 20 KKSRMRQSFV-CRNCKKRKIKCDKARPSCGRCSKLELEC 57
          K+ R  ++F  C  C+ RK+KCD  RP C RC K  LEC
Sbjct: 10 KRPRRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48

>KLLA0A03399g 305616..308153 weakly similar to sp|P39720
           Saccharomyces cerevisiae YAL051w OAF1 peroxisome
           proliferating transcription factor, hypothetical start
          Length = 845

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 115/549 (20%), Positives = 219/549 (39%), Gaps = 89/549 (16%)

Query: 258 ILNVLPHRDQIETLLNYYMTVMYPLVPYLNKTSFLQLVGDTL---IYSPVGVVNGLKFGS 314
           I N LP    I  LL+ +   +YP+ P ++   F + + + +    ++P  ++  +  G+
Sbjct: 205 IQNDLPSLPNIRLLLDNFYHHIYPIWPCIDIDLFEENLNEVIHMDSHNPERII--VNPGT 262

Query: 315 HEDFTRKIGCIATLLILLR--IAHTAMTLVDDTAY----------DRAISNRLVLISQKC 362
             +   K+  I+ L ++L+  I+H  + L D  A           DRA       + +K 
Sbjct: 263 -TNIKMKLVNISILYLILQLSISHWKLRLFDQRAMEQDVQHKYDGDRAWIEGFAELEKKL 321

Query: 363 ------LAHLLKLSHKTNEDILSCLLLMRWSLIYSPXXXXXXXXXXXXXLPSLTINHAIK 416
                 L  +L +     E+++S  +L+   L + P             +  +       
Sbjct: 322 TSSAAELVSILNIYQSRTEEVISWHMLLWNILAHQPDLCSIFYDSTSEGVIGMMGPLVSD 381

Query: 417 IGLYRD---CVEVDANFVTDPKQRYFIHYRAKLWMGCLILMRSDFYLRGTYPIVSS---- 469
           +GL RD    +E   N   DP+ +   +YR +LW+   ++ R +  ++G  P  S+    
Sbjct: 382 LGLDRDPSQFLEPTGNMRIDPRYK---NYRRRLWLCYCLISRFEITVKGRTPQKSTANVQ 438

Query: 470 ------------EYFSMEPKQDSVHNYEDELESQIHNVLHKQLRMYAKIRILDKL---SL 514
                       E +S   K+D +   E ELE  +  + ++ L+        DKL   +L
Sbjct: 439 AIPGIMDQKNGWEEYSCLYKKDMLKQNEAELE--LLGLFYRHLQFMTLFLPYDKLLKDNL 496

Query: 515 QVHEKTDVEEIYAKI-RQLEYDLQSIAPLSHTQSLAGVSGQEAVRRSMN-NAVYLKMSMV 572
                T+VE++Y  + R LE D+      +H+Q  A  S    +  S N N V    +M 
Sbjct: 497 NSLTLTEVEQVYEGLERYLEKDVN--GTFTHSQKWARHS---TIDYSYNLNDVDNVFNMA 551

Query: 573 VKIYFLAIRASTVAIL-----ERQLKERLGDIKSIARCYREVGAEAFESGLDLCEILRDY 627
            ++   ++R +   +L      R++       +S+  C + +         D CE +   
Sbjct: 552 KQLIARSVRLTICDLLIRFFNSRKVHNSFDMEQSLLYCQKALA--------DNCEGIGYL 603

Query: 628 LSTAGDLENARVMPDHRYILNQCVQVGIFRVSYYLISVTLTLLQVKN--GLESYRWQNRN 685
           +     + N  +    ++  N+  Q+ + R +   +  TLT+L+V +  GL   R    N
Sbjct: 604 IKYFALVYNENIRTTGKFFTNRISQILLSRCT---LHTTLTILRVDHMLGLSKRR---SN 657

Query: 686 KHSLADELERNISILG-------ECTK---AVFQNVQKLIHQGSHSLSDRYFTSFKQFLF 735
           + S   E +   S L        +C +    +F  ++ L    S  L   Y + F+  L 
Sbjct: 658 QESFLYEDQSAFSRLSGINEQRQQCVRIRMQLFSLLENLCSASSEELRYNYISGFRYALL 717

Query: 736 LDYAMQVIQ 744
            D AM  ++
Sbjct: 718 TDCAMHFLK 726

>KLLA0D10153g 858016..859983 weakly similar to sp|P35995
          Saccharomyces cerevisiae YKL222c, hypothetical start
          Length = 655

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 25/40 (62%)

Query: 21 KSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD 60
          KSR + +  C  C++RK KCD+  PSC  C K   EC+Y+
Sbjct: 3  KSRNKPTRSCLMCQRRKKKCDRKAPSCSACLKKGYECIYN 42

>KLLA0D00484g 44879..47893 no similarity, hypothetical start
          Length = 1004

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 36/67 (53%), Gaps = 10/67 (14%)

Query: 7   SNTGSASSEPPEFKKSRMRQSFV----CRNCKKRKIKCDKARPSCGRCSKLELECVYD-- 60
           + TG +SSE  E   ++ R+S      C  CKK   KCD+ +P C RC K  ++C Y   
Sbjct: 46  TTTGDSSSE--EKLSTKKRKSTYSRKGCLQCKKAHTKCDERKPKCSRCEKRSIDCTYRNQ 103

Query: 61  --FQENK 65
             FQ+N+
Sbjct: 104 FVFQKNE 110

>YKR064W (YKR064W) [3315] chr11 (562189..564780) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [2592 bp, 863 aa]
          Length = 863

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 26/41 (63%), Gaps = 3/41 (7%)

Query: 21 KSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLE--LECVY 59
          K R R + VC NCKKRK KCD+ +P CG C +L     CVY
Sbjct: 10 KKRHRITVVCTNCKKRKSKCDRTKP-CGTCVRLGDVDSCVY 49

>Scas_638.14
          Length = 1043

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 35/75 (46%), Gaps = 11/75 (14%)

Query: 6  PSNTGSASSEPPEF-----KKSRMRQ-----SFVCRNCKKRKIKCDKARPSCGRCSKLEL 55
          P   GS   E P+      K  R+R+     S  C NC+KRKIKC   +P C  C   + 
Sbjct: 14 PVYPGSQLCETPDLHNTNSKDKRVRKPTNKVSKACDNCRKRKIKCTGKQP-CATCEAYQC 72

Query: 56 ECVYDFQENKDGRRG 70
           C+Y  Q+ K  +R 
Sbjct: 73 PCIYSTQKRKTSKRN 87

>KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1
           Kluyveromyces lactis Sip4 protein, start by similarity
          Length = 717

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 25/48 (52%), Gaps = 3/48 (6%)

Query: 25  RQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRRGLP 72
           R S  C  C+ +KIKCD  +PSC  C K+   C      +K  RRG P
Sbjct: 58  RFSQACDRCRLKKIKCDGIKPSCSNCKKIGYHCS---TSDKLTRRGFP 102

>Scas_702.7
          Length = 1113

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 18 EFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD 60
          + K+ R + S  C NC++RKIKC    P C  C+  + EC++D
Sbjct: 25 KIKRPRKKVSKACANCRRRKIKCTGTYP-CSNCAAYQCECIFD 66

>YHR056C (RSC30) [2344] chr8 complement(215184..217835) Component
          of the abundant RSC chromatin remodeling complex [2652
          bp, 883 aa]
          Length = 883

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 23 RMRQSFVCRNCKKRKIKCDKARPSCGRCSKL-ELECVY 59
          ++R+   C  C+KRKI CD+A+P CG C K  + +C Y
Sbjct: 8  KVRKPPACTQCRKRKIGCDRAKPICGNCVKYNKPDCFY 45

>Kwal_27.9688
          Length = 841

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 1/39 (2%)

Query: 20 KKSRMRQSFV-CRNCKKRKIKCDKARPSCGRCSKLELEC 57
          K+ R  ++F  C  C+ RK+KCD  +P+C RC K  LEC
Sbjct: 12 KEVRRVKTFTGCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50

>KLLA0F02387g complement(213669..215852) similar to sp|P47988
          Saccharomyces cerevisiae YOR337w TEA1 TY1 enhancer
          activator, start by similarity
          Length = 727

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 26/46 (56%), Gaps = 8/46 (17%)

Query: 12 ASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELEC 57
          ASSEPP        +   C NC++R+ KCD   P CGRC +L L C
Sbjct: 30 ASSEPPA-------KRLACANCRRRRKKCDLEYP-CGRCQELGLGC 67

>Kwal_23.6529
          Length = 598

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 30/53 (56%), Gaps = 10/53 (18%)

Query: 30 CRNCKKRKIKCDKARPSCGRCSKLEL-ECVYD---------FQENKDGRRGLP 72
          C NCKK KIKCD+ +P CG+C+K    +C Y          ++  K G++ LP
Sbjct: 14 CINCKKSKIKCDEKKPMCGQCAKKGRDDCAYALVLQWGGRPYKNAKKGKKVLP 66

>YDR303C (RSC3) [1131] chr4 complement(1068721..1071378) Component
          of the abundant RSC chromatin remodeling complex [2658
          bp, 885 aa]
          Length = 885

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 18 EFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKL-ELECVY 59
          + +  +M++   C  C+KRKI CD+ +P CG C K  +++C Y
Sbjct: 2  DIRGRKMKKPPACVQCRKRKIGCDRVKPICGNCMKHNKMDCFY 44

>Kwal_47.17506
          Length = 924

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 20 KKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          KK R + S  C NC++RKIKC  A+P C  C     EC Y
Sbjct: 9  KKKRSKVSRACNNCRRRKIKCTGAQP-CLNCQTYRCECTY 47

>AGL099C [4213] [Homologous to ScYDR207C (UME6) - SH]
           (516587..518830) [2244 bp, 747 aa]
          Length = 747

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 6   PSNTGSASSEPPEFKKSR--MRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDF 61
           P+N      + P  KK+    R    C  C+ RK KC + RP C  C +L LECVYD 
Sbjct: 654 PNNISPKYDDAPNKKKAGAGTRSRTGCWICRLRKKKCSEERPQCSNCLRLNLECVYDI 711

>Scas_588.11
          Length = 835

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%)

Query: 23 RMRQSFVCRNCKKRKIKCDKARPSCGRCSK 52
          +MR+   C  C+KRKI CD+ +P CG C K
Sbjct: 7  KMRKPPACVQCRKRKIGCDRVKPICGNCRK 36

>YNR063W (YNR063W) [4646] chr14 (746940..748763) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [1824 bp, 607 aa]
          Length = 607

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 28/44 (63%), Gaps = 4/44 (9%)

Query: 20 KKSRMRQ-SFVCRNCKKRKIKCDKARPSCGRCSKLEL--ECVYD 60
          K +R R  S  C  C+KRK+KCD  +P CGRC +L    EC+Y+
Sbjct: 5  KDARKRSISLACTVCRKRKLKCDGNKP-CGRCIRLNTPKECIYN 47

>KLLA0D12672g complement(1076011..1078608)
           gi|125903|sp|P08657|LAC9_KLULA Kluyveromyces lactis
           Lactose regulatory protein LAC9, start by similarity
          Length = 865

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 20/34 (58%)

Query: 29  VCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQ 62
            C  C+K+K KC K  P+C  C K  L+CVY  Q
Sbjct: 94  ACDACRKKKWKCSKTVPTCTNCLKYNLDCVYSPQ 127

>Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement
          Length = 919

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 3/48 (6%)

Query: 25 RQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRRGLP 72
          R S  C  C+ +KIKCD  +P+C  C K+   C      +K  RRG P
Sbjct: 24 RSSQACDRCRLKKIKCDGLKPNCTSCKKVGFHCQ---TSDKLTRRGFP 68

>AAL057C [130] [Homologous to ScYDR303C (RSC3) - SH; ScYHR056C
          (RSC30) - SH] (246899..249328) [2430 bp, 809 aa]
          Length = 809

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 18 EFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSK-LELECVY 59
          + +  +M++   C  C+KRKI CD+A+P CG C +  + +C Y
Sbjct: 4  DIRGRKMKKPPACVQCRKRKIGCDRAKPLCGNCVRNGKSDCFY 46

>YOR337W (TEA1) [5116] chr15 (954339..956618) Ty1 enhancer
          activator of the Gal4p-type family of DNA-binding
          proteins [2280 bp, 759 aa]
          Length = 759

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 25 RQSFVCRNCKKRKIKCDKARPSCGRCSKLELEC 57
          R+   C NC+ R+ KCD   P CG CS+LEL C
Sbjct: 65 RKRLACTNCRNRRKKCDLGFP-CGNCSRLELVC 96

>AAL175W [12] [Homologous to ScYML099C (ARG81) - NSH]
          complement(32874..35525) [2652 bp, 883 aa]
          Length = 883

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 20 KKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELEC 57
          ++ R +    C  C+ RK+KCD  +PSC RC K  L+C
Sbjct: 34 RRPRAKTFTGCWTCRLRKVKCDLGKPSCQRCEKSGLDC 71

>YLR266C (PDR8) [3660] chr12 complement(675621..677726)
          Zn[2]-Cys[6] zinc finger transcription factor, likely
          involved in pleiotropic drug response [2106 bp, 701 aa]
          Length = 701

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 33/54 (61%), Gaps = 3/54 (5%)

Query: 7  SNTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLEL-ECVY 59
          S TG   S   + K+ ++ +S  C  C+KRK+KC +ARP C +C   +L +CVY
Sbjct: 10 STTGEPVSSGKKGKRRKVIKS--CAFCRKRKLKCSQARPMCQQCVIRKLPQCVY 61

>CAGL0M05907g 622029..624704 similar to sp|P36023 Saccharomyces
          cerevisiae YKR064w, hypothetical start
          Length = 891

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 15 EPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRC 50
          EP +  KSR R   VC NC+KRK KCD+  P C +C
Sbjct: 3  EPKKVTKSRRRPMLVCVNCRKRKSKCDRQLP-CSKC 37

>CAGL0L04400g complement(511762..514725) similar to tr|Q12340
          Saccharomyces cerevisiae YOR172w, hypothetical start
          Length = 987

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 21 KSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELE-CVY 59
          K R +    C  C+KRK+KCDK +P C  C++  L  CVY
Sbjct: 28 KKRFKPLKSCAFCRKRKLKCDKQKPRCSSCARRNLPVCVY 67

>Sklu_1973.1 YDR303C, Contig c1973 815-3148 reverse complement
          Length = 777

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 18 EFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRC 50
          + +  +M++   C  C+KRKI CD+A+P CG C
Sbjct: 4  DIRGRKMKKPPACVQCRKRKIGCDRAKPICGNC 36

>KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyces
           lactis Cat8p, start by similarity
          Length = 1445

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 32/71 (45%), Gaps = 10/71 (14%)

Query: 9   TGSASSEPPEFKKSRM-------RQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDF 61
           TGSAS  P     S         R +  C  C+ +KI+CD  RP C +C+ +  EC    
Sbjct: 155 TGSASHPPSNTGSSTNGTTTPSYRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKI-- 212

Query: 62  QENKDGRRGLP 72
             +K  RR  P
Sbjct: 213 -SDKLSRRAFP 222

>CAGL0H01507g complement(147689..150073) similar to sp|Q06639
          Saccharomyces cerevisiae YDR303c RSC3, start by
          similarity
          Length = 794

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 18 EFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKL-ELECVY 59
          + +  +M++   C  C++RK+ CD+ RP CG C++  + +C Y
Sbjct: 2  DIRGRKMKKPPACAQCRRRKVGCDRVRPVCGNCARAGKGDCFY 44

>KLLA0F10835g 997512..999782 no similarity, hypothetical start
          Length = 756

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 30 CRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          C  CK+  +KCD+ +P CG+C K  + C Y
Sbjct: 24 CLQCKRSHLKCDEGQPKCGKCVKRNISCTY 53

>ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp,
          601 aa]
          Length = 601

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 4/43 (9%)

Query: 30 CRNCKKRKIKCDKARPSCGRCSKLELECVYD----FQENKDGR 68
          C  CKK   KCD+ +P+C +C K  +EC Y     FQ+ + G+
Sbjct: 21 CLQCKKSHTKCDETKPACLKCVKRNVECTYKVSFVFQKVETGK 63

>AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 696
           aa]
          Length = 696

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 8/62 (12%)

Query: 14  SEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD----FQENKDGRR 69
           S+ P+ + SR      C  CKK  IKCDK +P C  C+K  + C Y+    F++    R+
Sbjct: 49  SKKPKVQYSRKG----CSQCKKSHIKCDKVQPLCTTCAKKNILCTYELSFVFEDGSSKRK 104

Query: 70  GL 71
            L
Sbjct: 105 IL 106

>Kwal_14.2619
          Length = 1167

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 79/187 (42%), Gaps = 25/187 (13%)

Query: 249 TAQAKLIELILNVLPHRDQIET-LLNYYMTVMYPLVPYLNKTSFLQLVGDTLIYS----- 302
           + + K+   I  ++P R  I   L NY+ + ++ L P LN+  F   + + L  S     
Sbjct: 348 SPEMKVFSKIQKMIPTRKVIWLHLRNYFHSPLHALFPVLNEDWFNDDMREILRGSEESDS 407

Query: 303 -PVGVVNGLKFGSHEDFTRKIGCIATLLILLRIAHTAMTLVDDT--------AYDRAISN 353
            P  V++G KF    DF R    + +LLI+LR++    +    T           ++I  
Sbjct: 408 QPEIVISG-KF----DFAR----LGSLLIVLRLSFLMYSDTKGTRDTEELQEVLSQSIGP 458

Query: 354 RLVLISQKCLAHLLKLSHKTNEDILSCLLLMRWSLIYSPXXXXXXXXXXXXXLPSLTINH 413
             V  +Q+C+ HL KL  K    +L C +L+R    Y+P                L    
Sbjct: 459 EFVDTAQQCM-HLFKLLRKALLPVLHCTILLRIYRRYAPEEGDIVDGGDSEAFSGLITKM 517

Query: 414 AIKIGLY 420
           A  IGL+
Sbjct: 518 ATSIGLH 524

 Score = 37.4 bits (85), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (65%), Gaps = 2/35 (5%)

Query: 30 CRNCKKRKIKCDKARPSCGRCSKLE--LECVYDFQ 62
          C  C++RK+KCD+++P C  C K +   EC Y+ +
Sbjct: 12 CLTCRRRKVKCDRSKPVCLACIKYKSISECSYEVK 46

>KLLA0E14036g complement(1239566..1241602) some similarities with
          ca|CA4758|CaPPR1 Candida albicans transcription factor
          regulating pyrimidine pathway (by homology),
          hypothetical start
          Length = 678

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%)

Query: 20 KKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          KK R  Q   C  CK+R+ +CD   P CG C    ++C +
Sbjct: 57 KKRRKNQGVACCFCKRRRKRCDGGFPQCGACVNAGIQCTF 96

>Kwal_47.18089
          Length = 745

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (59%), Gaps = 5/42 (11%)

Query: 30 CRNCKKRKIKCDKARPSCGRCSKLEL-ECVY----DFQENKD 66
          C  C+ RK+KCD  RP CG C+  +L EC+Y    +FQ   D
Sbjct: 29 CTFCRHRKLKCDHKRPMCGSCAARKLPECIYVDSFNFQLTSD 70

>Scas_680.25
          Length = 738

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 18 EFKKSRMR-QSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRRGL 71
          E  + RM+ +S+ C  C++ K KC +  PSC  C K    C+Y  +  +  +R L
Sbjct: 3  EMPQQRMKPESYSCSRCRRLKKKCPRQTPSCANCEKAHATCIYVGRAPRRTKREL 57

>CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces
          cerevisiae YLR256w HAP1 transcription factor,
          hypothetical start
          Length = 1372

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 21/30 (70%)

Query: 23 RMRQSFVCRNCKKRKIKCDKARPSCGRCSK 52
          R R    C  C++RK+KCDK+RP+C +C K
Sbjct: 64 RNRVPLSCTICRRRKVKCDKSRPNCTQCVK 93

>CAGL0H06875g complement(682518..684626) some similarities with
          sp|05085 Saccharomyces cerevisiae YML099c ARG81,
          hypothetical start
          Length = 702

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 30 CRNCKKRKIKCDKARPSCGRCSKLELEC 57
          C  C+ RK+KCD  RPSC RC + +++C
Sbjct: 15 CWTCRARKVKCDLVRPSCLRCRRSKVQC 42

>KLLA0F02750g complement(250368..253814) some similarities with
          sgd|S0005449 Saccharomyces cerevisiae YOL089c HAL9
          transcriptional activator of ENA1, hypothetical start
          Length = 1148

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 20 KKSRMRQSFVCRNCKKRKIKCDKARPSCGRCS---KLELECVYDFQE 63
          K ++ R S  C  C++RKIKCD   P  G+CS   K ++ C + + E
Sbjct: 24 KPAKKRVSKACDRCRRRKIKCDDLDPVSGKCSNCIKYKVPCTFHYHE 70

>Scas_518.5
          Length = 919

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 3/64 (4%)

Query: 2   LNYSPSNTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDK---ARPSCGRCSKLELECV 58
           L  +P N  + + +  E K+S+ R    C  C+KRK+KC         C  C+K ++EC 
Sbjct: 91  LERTPHNETNVTDQYGEGKESKKRVLKACDYCRKRKVKCGDIIAQTGKCANCTKNDVECT 150

Query: 59  YDFQ 62
           + F 
Sbjct: 151 FKFH 154

>KLLA0D10197g complement(861726..864296) similar to sp|P05085
          Saccharomyces cerevisiae YML099c ARG81 transcription
          factor involved in arginine metabolism singleton, start
          by similarity
          Length = 856

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 21/37 (56%)

Query: 21 KSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELEC 57
          K R++    C  C+ RK+KCD  RP C RC K  L C
Sbjct: 5  KPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGLIC 41

>KLLA0F09559g complement(876719..878695) some similarities with
           sgd|S0005698 Saccharomyces cerevisiae YOR172w,
           hypothetical start
          Length = 658

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 9/60 (15%)

Query: 3   NYSPSNTGSASSEPPEFKKSRMRQSFV--CRNCKKRKIKCDKARPSCGRCSKLEL-ECVY 59
           +YS  N  +++       K R R+  +  C  C+KRK+KCD+ RP C  C    L ECVY
Sbjct: 67  HYSDKNASTSNG------KVRKRRKVIKSCTFCRKRKLKCDRKRPMCTGCKMRGLSECVY 120

>YKL222C (YKL222C) [3053] chr11 complement(3504..5621) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [2118 bp, 705 aa]
          Length = 705

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 22/32 (68%)

Query: 20 KKSRMRQSFVCRNCKKRKIKCDKARPSCGRCS 51
          ++SR + +  C  C+ RK+KCD+ RP CG CS
Sbjct: 14 RQSRRKPAKSCHFCRVRKLKCDRVRPFCGSCS 45

>CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces
          cerevisiae YGL013c PDR1 transcription factor,
          hypothetical start
          Length = 1107

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 33/55 (60%), Gaps = 3/55 (5%)

Query: 5  SPSNTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          S SN G   ++ P  +++++ ++  C +C++RKIKC+  +P C  C+    EC Y
Sbjct: 8  SKSNPGEVKAQKPSTRRTKVGKA--CDSCRRRKIKCNGLKP-CPSCTIYGCECTY 59

>KLLA0F04609g complement(451579..454329) similar to sp|P40467
          Saccharomyces cerevisiae YIL130w, start by similarity
          Length = 916

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 18 EFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD 60
          E +  R R +  C  C+K+K+KCD  +P C  C+    EC Y+
Sbjct: 2  ELQNKRRRVTRACDECRKKKVKCDGKQP-CIHCTVYNYECTYN 43

>KLLA0E19701g complement(1739869..1741914) some similarities with
          sp|P26370 Saccharomyces cerevisiae YDL170w UGA3
          transcriptional activator for GABA catabolic genes
          singleton, hypothetical start
          Length = 681

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%)

Query: 21 KSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRRG 70
          K R      C  CK RK +C + RP C  C++L L+CV+     KD  R 
Sbjct: 11 KRRRHSKKGCLTCKVRKKRCSEDRPICKDCARLSLDCVFPDNLTKDQIRA 60

>KLLA0A10329g 903873..905792 some similarities with
          ca|CA6113|IPF100.3 Candida albicans zinc finger
          protein, 3-prime end (by homology), hypothetical start
          Length = 639

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 22/48 (45%)

Query: 21 KSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGR 68
          K   R    C+ CK  K KCD+ +P CG C K   +C Y       GR
Sbjct: 8  KKVARSYMGCQKCKSLKKKCDEVKPHCGYCKKRGFQCDYSRTLKWGGR 55

>Scas_696.44
          Length = 1164

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 22  SRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELEC-VYDFQENKDGRRG 70
           S +R +  C  C+ +K +CD  RP C +C+ +  EC + D  + K   RG
Sbjct: 73  SNLRIAQACDRCRSKKTRCDGKRPQCSQCAIVGFECKISDKLQRKSFPRG 122

>Sklu_1373.2 YDR207C, Contig c1373 1069-2895
          Length = 608

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%)

Query: 25  RQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDF 61
           R    C  C+ RK KC + +P C  C++L LEC YD 
Sbjct: 536 RSRTGCWICRLRKKKCTEEKPHCNNCTRLNLECFYDI 572

>CAGL0D03850g 384689..387193 weakly similar to sp|Q06639
          Saccharomyces cerevisiae YDR303c RSC3 or sp|P38781
          Saccharomyces cerevisiae YHR056c, hypothetical start
          Length = 834

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 23 RMRQSFVCRNCKKRKIKCDKARPSCGRCSKL-ELECVY 59
          ++++   C+ C++RKI CD+ +P CG C K  + +C Y
Sbjct: 9  KVKKPPACQQCRRRKIGCDRGKPICGNCLKQGKTDCFY 46

>Scas_542.8
          Length = 902

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 7  SNTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          SN    ++EP      R  +S  C  C+KR IKC    P C RC K +L+C Y
Sbjct: 9  SNNDKNNTEP---SSKRRPKSLACILCRKRHIKCSGGNP-CARCIKHDLKCEY 57

>Kwal_27.10232
          Length = 1209

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 3/51 (5%)

Query: 22  SRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRRGLP 72
           S  R +  C  C+ +K +CD  RP C +C+ +  EC      +K  RR  P
Sbjct: 66  SNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKV---SDKLSRRAFP 113

>Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement
          Length = 823

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 8/57 (14%)

Query: 14 SEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRRG 70
          SEP   +  R R +  C  C+K+K+KCD  +P C  C+    EC Y    N+  +RG
Sbjct: 2  SEP---QSKRRRVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTY----NQPTKRG 50

>YBL005W (PDR3) [189] chr2 (217435..220365) Zinc-finger
          transcription factor, in conjunction with Pdr1p
          regulates the expression of a network of genes involved
          in multiple drug resistance [2931 bp, 976 aa]
          Length = 976

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 4/56 (7%)

Query: 20 KKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVY---DFQENKDGRRGLP 72
          K +R + S  C NC+KRKIKC    P C  C   +  CV+      + +D  + LP
Sbjct: 5  KSTRSKVSTACVNCRKRKIKCTGKYP-CTNCISYDCTCVFLKKHLPQKEDSSQSLP 59

>YML099C (ARG81) [3872] chr13 complement(74398..77040) Component
          of the ARGR regulatory complex, contains a Zn[2]-Cys[6]
          fungal-type binuclear cluster domain [2643 bp, 880 aa]
          Length = 880

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 10 GSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELEC 57
          G +S   P+ K  R +    C  C+ RK+KCD   P C RC K  L C
Sbjct: 2  GISSKNGPK-KMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPC 48

>Kwal_26.7160
          Length = 388

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 83/185 (44%), Gaps = 29/185 (15%)

Query: 477 KQDSVHNYEDELESQIHNVLHKQLRMYAKIRILDKLSLQVHEKTDVEEIYAKIRQLEYDL 536
           + +S+ N  +ELE   H+ L++ L+ Y + + L+ L      K DV E  AKI +L    
Sbjct: 58  RDESLRNRTNELEMNYHDSLNEYLKGYNE-KCLESLLTANLLKRDVLETNAKIWKLFISA 116

Query: 537 QSIAPLSHTQSLAGVSGQEAVRRSMNNAVYLKMSMVVKIYFLAI---RASTVAILERQLK 593
            S A ++      GVS Q+                V  + F  +   RA  V   E   +
Sbjct: 117 CSGAKMATL----GVSVQK----------------VTDVAFCEVDIPRAQLVLKNETVCE 156

Query: 594 ERLGDIKSIARCYREVGAEA-FESGLDLC----EILRDYLSTAGDLENARVMPDHRYILN 648
           E  G +K +  C+  V + A + +  DL     E +RDY S AGD+++AR + +  +   
Sbjct: 157 EAAGILKYLGCCHEYVRSGASYHTMSDLAKRTLEYIRDYSSRAGDVDDARQLYELVWFYV 216

Query: 649 QCVQV 653
             +QV
Sbjct: 217 SAIQV 221

>Scas_720.58
          Length = 890

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 29 VCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
           C NC+ +K+KC K  P C +C K  ++C+Y
Sbjct: 19 ACDNCRLKKLKCSKETPKCSKCLKNGMKCLY 49

>Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement
          Length = 718

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 1/31 (3%)

Query: 30 CRNCKKRKIKCDKARPSCGRCSKLEL-ECVY 59
          C  C+KRK+KCD  +P C  C+   L ECVY
Sbjct: 19 CLFCRKRKLKCDHKKPKCSTCAARNLPECVY 49

>ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH]
           (170784..174641) [3858 bp, 1285 aa]
          Length = 1285

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 3/48 (6%)

Query: 25  RQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRRGLP 72
           R +  C  C+ +K +CD  RP C +C+ +  EC      +K  RR  P
Sbjct: 73  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKI---SDKLSRRAFP 117

>Scas_596.4
          Length = 701

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 18  EFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD 60
           E KK+R  +S  C  C+ RK KC + +P+C  C +L L+C +D
Sbjct: 557 ETKKARRSRSG-CWICRLRKKKCTEEKPACFNCQRLNLDCFFD 598

>Sklu_2335.6 YBL005W, Contig c2335 10191-13013
          Length = 940

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 29/64 (45%), Gaps = 8/64 (12%)

Query: 8  NTGSASSEPPE-FKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKD 66
          N  S    PP+   KS  + S  C NC++RKIKC   +P C  C   +  C Y       
Sbjct: 5  NKASVPHMPPKRVTKSSSKVSRACDNCRRRKIKCTGKQP-CSNCQAYQCHCEYSI----- 58

Query: 67 GRRG 70
           RRG
Sbjct: 59 -RRG 61

>CAGL0M03025g complement(341849..345613) similar to sp|P39113
          Saccharomyces cerevisiae YMR280c CAT8 transcription
          factor involved in gluconeogenesis, hypothetical start
          Length = 1254

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 6/53 (11%)

Query: 5  SPSNTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELEC 57
          S SNTGS  S P        R +  C  C+ +K KCD   P C +C+ +  EC
Sbjct: 41 SGSNTGSRGSTPT------YRVAQACDRCRLKKTKCDGKIPQCSQCALVGFEC 87

>CAGL0E05434g 532577..535027 similar to sp|P47988 Saccharomyces
           cerevisiae YOR337w TEA1 TY1 enhancer activator,
           hypothetical start
          Length = 816

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 3   NYSPSNTGSASSEPPEFKKSR-MRQSFVCRNCKKRKIKCDKARPSCGRCSKLELEC 57
           N S   +G+ S E      SR  ++   C NC++R+ KCD   P C  C KL LEC
Sbjct: 48  NGSEQTSGNPSRESSANVTSRPTKKRLACSNCRRRRKKCDLQYP-CFTCDKLGLEC 102

>Kwal_23.4754
          Length = 812

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 18 EFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD 60
          + +  R R +  C  C+K+K+KCD  +P C  C+    EC Y+
Sbjct: 3  DLQNKRRRVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYN 44

>Scas_699.7
          Length = 935

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 6/42 (14%)

Query: 24 MRQSFV------CRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          MR  F+      C  C+ +K+KC K +P C +C K   EC Y
Sbjct: 1  MRYPFIPNSDQACDLCRVKKLKCSKEKPKCAKCLKNNWECCY 42

>YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finger
          transcription factor, in conjunction with Pdr3p
          regulates the expression of a network of genes involved
          in multiple drug resistance [3207 bp, 1068 aa]
          Length = 1068

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 20 KKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          +K R + S  C NC+KRKIKC+   P C  C     EC +
Sbjct: 36 RKPRSKVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTF 74

>KLLA0A02585g complement(226562..227674) some similarities with
          ca|CA5890|CaFCR1 Candida albicans Zinc cluster
          transcription factor, hypothetical start
          Length = 370

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 26/52 (50%), Gaps = 4/52 (7%)

Query: 8  NTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          N   +S+E P  K+   R S  C  C+K K KCD  RP C RC K    C Y
Sbjct: 3  NGSRSSAELPTIKR---RVSKACDACRKSKTKCDGERP-CSRCLKENKLCTY 50

>YOL089C (HAL9) [4731] chr15 complement(150397..153489) Protein
           involved in salt tolerance, has similarity to
           transcription factors, contains a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region [3093 bp, 1030 aa]
          Length = 1030

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 8/62 (12%)

Query: 1   MLNYSPSNTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKA---RPSCGRCSKLELEC 57
           M+ ++ SN  S S      K  + R S  C +C+KRKI+CD+       C  C K +L C
Sbjct: 112 MMEHTNSNDMSGSG-----KNLKKRVSKACDHCRKRKIRCDEVDQQTKKCSNCIKFQLPC 166

Query: 58  VY 59
            +
Sbjct: 167 TF 168

>CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces
          cerevisiae YOR172w, hypothetical start
          Length = 865

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 29 VCRNCKKRKIKCDKARPSCGRCSKLELE-CVYD 60
           C  C++RK+KCD ARP C  C   +   C+Y+
Sbjct: 39 TCAFCRRRKLKCDNARPMCSTCVSRKFSTCIYE 71

>Kwal_23.2905
          Length = 881

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (55%)

Query: 25 RQSFVCRNCKKRKIKCDKARPSCGRCSKLELECV 58
          R    C+ C+ RK+KCD+  PSC RC      CV
Sbjct: 44 RSIAACKRCRIRKVKCDQKFPSCSRCVSANEPCV 77

>Kwal_56.22605
          Length = 865

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 5/53 (9%)

Query: 12 ASSEPPEFKKSRMRQSF--VCRNCKKRKIKCDKARP---SCGRCSKLELECVY 59
          AS  P E    + R+     C +C+KRKIKC    P   +C  C+K    C +
Sbjct: 9  ASESPTELSGGKFRKRVPKACDHCRKRKIKCGPVNPITGTCENCNKFNTSCTF 61

>Kwal_14.819
          Length = 568

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 30 CRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          CR C+ RK++C +  P C  C+K   EC Y
Sbjct: 16 CRQCRDRKVRCSRQIPKCKSCTKRNCECFY 45

>Sklu_2301.1 , Contig c2301 1246-2795 reverse complement
          Length = 517

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (55%)

Query: 25 RQSFVCRNCKKRKIKCDKARPSCGRCSKLELECV 58
          R    C  C+ +K KCD+  PSC RC+ L   C+
Sbjct: 35 RSIVACERCRTKKTKCDQNFPSCARCASLGEPCI 68

>KLLA0F20680g 1924148..1926511 weakly similar to sp|P39001
           Saccharomyces cerevisiae YDR207c UME6 negative
           transcriptional regulator singleton, hypothetical start
          Length = 787

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%)

Query: 25  RQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDF 61
           R    C  C+ RK KC + +P C  C +L LEC YD 
Sbjct: 714 RSRTGCWICRLRKKKCTEEKPQCQNCVRLHLECFYDI 750

>KLLA0E02618g 244696..248025 no similarity, hypothetical start
          Length = 1109

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 38/72 (52%), Gaps = 11/72 (15%)

Query: 7  SNTGSA-SSEPPEFKKSRMRQSFVCRNCKKRKIKCD-KARPS-------CGRCSKLELEC 57
          SN  SA  S  P+ +K ++ +   C  C++RKIKCD +A P        C  C +  LEC
Sbjct: 4  SNEESARDSRHPDSRKRKVAKR-ACLACRERKIKCDGEANPDPSGGPGKCTNCVRSTLEC 62

Query: 58 VYDFQENKDGRR 69
          V+    N+ GRR
Sbjct: 63 VF-VASNRGGRR 73

>Scas_662.8
          Length = 906

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%)

Query: 23 RMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD 60
          R R +  C  C+K+K+KCD  +P C  C+    EC Y+
Sbjct: 30 RRRVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYN 66

>KLLA0A01804g complement(159689..162526) similar to sgd|S0002829
          Saccharomyces cerevisiae YDR421w positive transcription
          regulator of ARO9 and ARO10, start by similarity
          Length = 945

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 32/66 (48%), Gaps = 9/66 (13%)

Query: 8  NTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKA------RPSCGRCSKLELECVYDF 61
          + G+ S   P+ K++  R    C NCK RK+KCD         P C RC +   EC+  F
Sbjct: 3  SNGNESQTAPK-KQTFKRGYKACLNCKMRKVKCDLGPFDNPHGPPCVRCKRESRECM--F 59

Query: 62 QENKDG 67
           E K G
Sbjct: 60 TETKRG 65

>Sklu_2023.3 YHR178W, Contig c2023 2677-4653 reverse complement
          Length = 658

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 27/49 (55%)

Query: 11 SASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          SA++     ++S+  + + C  C++ K KC K  P+C  CS+   EC Y
Sbjct: 5  SATTSITTDRESQQNEPYSCSRCRRLKKKCSKELPACRNCSRAGEECTY 53

>KLLA0C10923g complement(939148..941475) similar to sp|P07272
          Saccharomyces cerevisiae YLR014c PPR1 transcription
          factor regulating pyrimidine pathway, hypothetical
          start
          Length = 775

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (58%)

Query: 25 RQSFVCRNCKKRKIKCDKARPSCGRCSKLELECV 58
          R    C+ C+ RKIKCD   PSC +C + +  C+
Sbjct: 15 RSVAACKRCRIRKIKCDNKFPSCTKCIQAQEPCI 48

>YMR280C (CAT8) [4234] chr13 complement(827027..831328)
          Transcription factor required for derepression of
          gluconeogenic enzymes, contains an N-terminal
          Zn[2]-Cys[6] fungal-type binuclear cluster domain [4302
          bp, 1433 aa]
          Length = 1433

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 29 VCRNCKKRKIKCDKARPSCGRCSKLELEC 57
           C  C+ +K +CD  RP C +C+ +  EC
Sbjct: 69 ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 97

>KLLA0F22880g 2123577..2127071 some similarities with
          ca|CA3639|IPF9251 Candida albicans unknown function,
          hypothetical start
          Length = 1164

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 30 CRNCKKRKIKCDKARPSCGRCSK--LELECVYDFQE 63
          C  C++RK++CD+A+P C  C K    +EC Y+ Q+
Sbjct: 9  CLVCRRRKVRCDRAKPVCLVCVKHGSNMECNYEVQK 44

>Sklu_2321.3 YLR014C, Contig c2321 8747-11467
          Length = 906

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (58%)

Query: 25 RQSFVCRNCKKRKIKCDKARPSCGRCSKLELECV 58
          R    C+ C+ +K+KCD+  PSC +C+     CV
Sbjct: 38 RSIAACKRCRLKKVKCDQKFPSCSKCASANEPCV 71

>Scas_659.10
          Length = 757

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 10 GSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRC 50
          GS+S++   FK+ R +    C  C+ RK+KCDK +P C +C
Sbjct: 2  GSSSTQNIGFKRRR-KPIKSCAFCRGRKLKCDKNKPICNQC 41

>YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive
          regulator of the maltose pathway MAL genes, contains a
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [1413 bp, 470 aa]
          Length = 470

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 3/38 (7%)

Query: 22 SRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          S +RQS  C  C+ R++KCD+ RP C RC +  L C Y
Sbjct: 2  SIVRQS--CDCCRVRRVKCDRNRP-CDRCRQRNLRCTY 36

>KLLA0C04620g complement(422705..426514) weakly similar to
          sp|Q05854 Saccharomyces cerevisiae YLR278c, start by
          similarity
          Length = 1269

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 20 KKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRRG 70
          KK R R    C  C++RK KCD   PSC  C K  ++C+   +   DG  G
Sbjct: 34 KKGRSR---ACLLCQRRKQKCDHKIPSCTACLKAGVKCIQPAKYGYDGAVG 81

>AGL206C [4106] [Homologous to NOHBY] (311846..314053) [2208 bp,
          735 aa]
          Length = 735

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 29/62 (46%), Gaps = 1/62 (1%)

Query: 7  SNTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVY-DFQENK 65
          SN    + +    KK+  R    C  C+ R+ KCD+ RP C  C +  L C + D   N 
Sbjct: 27 SNGRGVNDDSRVLKKTEKRSRNGCLTCRARRKKCDETRPKCIGCQRNLLLCHWADDDGNY 86

Query: 66 DG 67
          DG
Sbjct: 87 DG 88

>YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region, putative transcription
          factor [2895 bp, 964 aa]
          Length = 964

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 23 RMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          R R +  C  C+K+K+KCD  +P C  C+    EC Y
Sbjct: 14 RRRVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTY 49

>YDR207C (UME6) [1046] chr4 complement(865005..867515) Global
           transcriptional regulator containing a zinc binuclear
           cluster domain involved in pathway specific repression
           or induction [2511 bp, 836 aa]
          Length = 836

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%)

Query: 24  MRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD 60
            R    C  C+ RK KC + RP C  C +L+L+C YD
Sbjct: 765 TRSRTGCWICRLRKKKCTEERPHCFNCERLKLDCHYD 801

>CAGL0F05357g 541830..543635 some similarities with sp|P39001
           Saccharomyces cerevisiae YDR207c UME6, hypothetical
           start
          Length = 601

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%)

Query: 20  KKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD 60
           +K   R    C  C+ RK KC + +P+C  C +L L+C YD
Sbjct: 520 RKPATRSRTGCWICRLRKKKCSEEKPACFNCQRLNLDCYYD 560

>YPL248C (GAL4) [5202] chr16 complement(79711..82356)
          Transcription factor involved in expression of
          galactose-induced genes, phosphorylation correlates
          with activity [2646 bp, 881 aa]
          Length = 881

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 18/31 (58%)

Query: 29 VCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
           C  C+ +K+KC K +P C +C K   EC Y
Sbjct: 10 ACDICRLKKLKCSKEKPKCAKCLKNNWECRY 40

>Kwal_23.3178
          Length = 611

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 22/40 (55%)

Query: 22  SRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDF 61
           S  R    C  C+ RK KC + +PSC  C +L L+C YD 
Sbjct: 537 SGSRSRTGCWICRLRKKKCTEEKPSCHNCLRLNLQCFYDH 576

>KLLA0F19602g complement(1814949..1816760) similar to sp|P43634
          Saccharomyces cerevisiae YLR098c CHA4 transcription
          factor, start by similarity
          Length = 603

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 1/38 (2%)

Query: 21 KSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECV 58
          K + +    C+NC+ ++ KCD  RP C  C K  +EC+
Sbjct: 8  KRKRKAHLACQNCRIKRRKCDMERP-CSNCLKYGIECI 44

>KLLA0C16489g 1444456..1446642 some similarities with
          ca|CA2184|IPF6874.3 Candida albicans unknown function,
          3-prime end, hypothetical start
          Length = 728

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 23/40 (57%)

Query: 25 RQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQEN 64
          R    C  C+ +++KCD+  P CGRC +  L C++  + N
Sbjct: 38 RSKSGCFTCRLKRMKCDEQHPICGRCKRNLLTCIWPKEGN 77

>CAGL0D02904g complement(302952..305615) similar to sp|P07272
          Saccharomyces cerevisiae YLR014c PPR1 transcription
          factor regulating pyrimidine pathway, hypothetical
          start
          Length = 887

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 20/30 (66%)

Query: 29 VCRNCKKRKIKCDKARPSCGRCSKLELECV 58
           C+ C+++K+KCD+  PSC  C +  + CV
Sbjct: 24 ACKLCRRKKVKCDQGYPSCKGCLRNNVPCV 53

>CAGL0G08844g complement(846590..849133) similar to sp|P40467
          Saccharomyces cerevisiae YIL130w, hypothetical start
          Length = 847

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 16 PPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD 60
          P   +  R + +  C +C+K+K+KCD  +P C  C+    EC Y+
Sbjct: 6  PHRQEGKRRKVTRACDDCRKKKVKCDGNQP-CIHCTVYSYECTYN 49

>YDR421W (ARO80) [1245] chr4 (1312028..1314880) Positive
          transcription regulator of ARO9 and ARO10, member of
          the Zn2Cys6 transcription factor family [2853 bp, 950
          aa]
          Length = 950

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 12/70 (17%)

Query: 9  TGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKA------RPSCGRCSKLELECVYDFQ 62
          +G+A+ E P+    R R    C +C+ RK+KCD         P C RC +   +C+  F 
Sbjct: 8  SGNAAFELPK----RRRTYQACISCRSRKVKCDLGPVDNPHDPPCARCKRELKKCI--FS 61

Query: 63 ENKDGRRGLP 72
           NK     LP
Sbjct: 62 SNKGTSNDLP 71

>Scas_715.3
          Length = 1115

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 3/34 (8%)

Query: 30  CRNCKKRKIKCDKAR---PSCGRCSKLELECVYD 60
           C +C+++KIKCD ++     C RC K+ L+C  D
Sbjct: 106 CSHCRQQKIKCDASQNFPAPCSRCQKMALQCQID 139

>Kwal_26.7014
          Length = 654

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 25 RQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGR 68
          R+   C NC++R+ KC+   P C  C KL+++C  + ++ +  R
Sbjct: 30 RKRLACSNCRRRRKKCNMEYP-CASCVKLKVDCNVNMEDMRKKR 72

>KLLA0A09119g complement(797533..800781) weakly similar to
          sp|P12383 Saccharomyces cerevisiae YGL013c PDR1
          transcription factor, start by similarity
          Length = 1082

 Score = 37.7 bits (86), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 1/39 (2%)

Query: 21 KSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          K R + S  C +C+K+KIKC    P C  C     ECVY
Sbjct: 46 KPRRKVSRACDSCRKKKIKCSGTLP-CKSCETYGCECVY 83

>CAGL0I02552g 227257..230274 weakly similar to sp|P38699
          Saccharomyces cerevisiae YHR178w STB5 SIN3 binding
          protein, hypothetical start
          Length = 1005

 Score = 37.7 bits (86), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 7  SNTGSASSEPPEFKKSRMRQ--SFVCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          S++G  +++P + KK+R  Q  ++ C  C+K K KC +  P C  C K    C Y
Sbjct: 8  SDSGQTANDPKQ-KKARNGQMETYSCARCRKLKKKCPRQLPECSNCLKAREPCNY 61

>KLLA0D11286g complement(964642..966678) no similarity,
          hypothetical start
          Length = 678

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 28/58 (48%)

Query: 7  SNTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQEN 64
          +N    S++  + +  R R    C  C   K KCD  +PSC RC K  L C Y  +E+
Sbjct: 3  NNLAGKSAKEIKEQIVRKRTPKSCIRCYSIKRKCDHKKPSCTRCFKKSLPCEYFTEEH 60

>ADR199C [1940] [Homologous to ScYDR421W (ARO80) - SH]
          (1048530..1051364) [2835 bp, 944 aa]
          Length = 944

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 6/37 (16%)

Query: 29 VCRNCKKRKIKC-----DKAR-PSCGRCSKLELECVY 59
           C NC+ RK++C     DK R P C RCS+   EC++
Sbjct: 31 ACLNCRTRKVRCDLGPVDKPREPPCVRCSRERKECIF 67

>AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH]
          complement(1320487..1322892) [2406 bp, 801 aa]
          Length = 801

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 23 RMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD 60
          R R +  C  C+K+K+KCD   P C  C+    EC Y+
Sbjct: 11 RRRVTRACDECRKKKVKCDSRHP-CIHCTVYSYECTYN 47

>Scas_657.3
          Length = 856

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%)

Query: 30 CRNCKKRKIKCDKARPSCGRCSKLEL-ECVY 59
          C  C++RK+KCD+ RP C  C   +L  CVY
Sbjct: 45 CAFCRQRKLKCDQKRPICSTCIGRKLTTCVY 75

>KLLA0E18194g 1613115..1615712 similar to sp|P25502 Saccharomyces
          cerevisiae YKL015w PUT3 positive activator of the
          proline utilisation pathway, start by similarity
          Length = 865

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 1/40 (2%)

Query: 20 KKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          KK   R S  C  C++R IKC    P C +C K  + C Y
Sbjct: 36 KKKVKRSSLACTRCRRRHIKCPGGNP-CSKCLKAGVACEY 74

>YLR278C (YLR278C) [3671] chr12 complement(700001..704026) Protein
          with similarity to transcription factors, contains an
          N-terminal Zn[2]-Cys[6] fungal-type binuclear cluster
          domain [4026 bp, 1341 aa]
          Length = 1341

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 3/39 (7%)

Query: 20 KKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECV 58
          KK R R   +CR   +RK +CD   PSC  C K  ++CV
Sbjct: 34 KKGRSRSCLLCR---RRKQRCDHKLPSCTACLKAGIKCV 69

>YBR150C (TBS1) [335] chr2 complement(541165..544449) Protein with
           similarity to transcription factors, contains an
           N-terminal Zn[2]-Cys[6] fungal-type binuclear cluster
           domain [3285 bp, 1094 aa]
          Length = 1094

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 5/52 (9%)

Query: 21  KSRMRQSFVCRNCKKRKIKCDKARPSCGRCS---KLELECVYDFQENKDGRR 69
           KSR+ ++  C  C+KRKI+C +  P  G+C    K   +C + F E    RR
Sbjct: 100 KSRVTKA--CDYCRKRKIRCTEIEPISGKCRNCIKYNKDCTFHFHEELKRRR 149

>YKL038W (RGT1) [3220] chr11 (365248..368760) Protein involved in
          regulation of glucose transporters, acts as a
          transcriptional repressor that is converted to an
          activator upon glucose-induced phosphorylation [3513
          bp, 1170 aa]
          Length = 1170

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 5  SPSNTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCD--KARPSCGRCSKLELECVYD 60
          SP +  SA++     KK R + S  C  C+K+KIKCD    +  C  C +    C +D
Sbjct: 23 SPDDMDSAAAASHAIKK-RTKASRACDQCRKKKIKCDYKDEKGVCSNCQRNGDRCSFD 79

>Scas_669.8
          Length = 637

 Score = 37.7 bits (86), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 3/38 (7%)

Query: 23 RMRQSFVCRNCKKRKIKCDKARPSCGRCSK--LELECV 58
          R +  + C  CKKRK+KCDK  P C  C +  LE EC+
Sbjct: 9  RRKTPYACNVCKKRKVKCDKLIP-CTSCIQKGLENECL 45

>CAGL0G09757g 930351..934622 some similarities with sp|Q05854
          Saccharomyces cerevisiae YLR278c, hypothetical start
          Length = 1423

 Score = 37.7 bits (86), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 3/39 (7%)

Query: 20 KKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECV 58
          KK R R   +CR   +RK +CD   PSC  C K  ++CV
Sbjct: 34 KKGRSRSCLLCR---RRKQRCDHKLPSCTACLKAAVKCV 69

>Scas_526.3
          Length = 1109

 Score = 37.7 bits (86), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 3/39 (7%)

Query: 20 KKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECV 58
          KK R R   +CR   +RK +CD   PSC  C K  ++CV
Sbjct: 34 KKGRSRSCLLCR---RRKQRCDHKMPSCTACLKAAVKCV 69

>Scas_625.5
          Length = 1141

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 4   YSPSNTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCD--KARPSCGRCSKLELECVYD 60
           +S S  G+ ++     +K R + S  C  C+K+KIKCD  + +  C  C +   +C ++
Sbjct: 49  HSISAAGTNAASNSSSQKKRTKASRACDQCRKKKIKCDFSEEKTLCSNCQRNGEKCTFE 107

>YOR162C (YRR1) [4961] chr15 complement(639560..641992)
           Transcription factor involved in drug-induced
           transcriptional regulation, including activation of
           multidrug transporter gene SNQ2, has a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain [2433 bp, 810 aa]
          Length = 810

 Score = 37.7 bits (86), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 41/70 (58%), Gaps = 5/70 (7%)

Query: 7   SNTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLEL-ECVYDFQENK 65
           SN+G+ +S   + K++++ +S  C  C++RK++CD+ +P C  C    L  C Y  + NK
Sbjct: 34  SNSGTPTSTSGK-KRNKLIKS--CGFCRRRKLRCDQQKPMCSTCISRNLTTCQYAEEFNK 90

Query: 66  D-GRRGLPGP 74
           +  ++   GP
Sbjct: 91  NIEKKATYGP 100

>Scas_590.2
          Length = 1172

 Score = 37.7 bits (86), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 21 KSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECV 58
          + +  +S  C  C++RK KCD   PSC  C K  ++CV
Sbjct: 32 RDKKGRSTACLLCRRRKQKCDHQLPSCTACLKAAVKCV 69

>Kwal_23.6537
          Length = 552

 Score = 37.4 bits (85), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 11 SASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD 60
          +  ++ P  K+ R+R++  C  C++RK KCD   P CG C+     C YD
Sbjct: 3  ATGADVPRNKRLRVRKA--CLPCRQRKRKCDSGFP-CGMCTSYGYNCQYD 49

>CAGL0F02519g 245120..247618 weakly similar to sp|P39529
          Saccharomyces cerevisiae YJL206c, hypothetical start
          Length = 832

 Score = 37.4 bits (85), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 1/35 (2%)

Query: 25 RQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          R S  C  CKKRK KC    P C  C K  ++C+Y
Sbjct: 31 RLSRACDLCKKRKTKCQGGNP-CQSCRKANIQCIY 64

>AFL160C [3035] [Homologous to ScYPL248C (GAL4) - SH]
          (130842..132788) [1947 bp, 648 aa]
          Length = 648

 Score = 37.4 bits (85), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 19/31 (61%)

Query: 29 VCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
           C +C++RK+KC K  P C +C +    C+Y
Sbjct: 8  ACDSCRRRKMKCSKTFPKCAKCREDNRVCLY 38

>Scas_691.32
          Length = 906

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 32/68 (47%), Gaps = 10/68 (14%)

Query: 5  SPSNTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCD---KARPSCGRCSKLELECVYDF 61
          SP+N+     +    K+ R    F C  C+++K KCD   KA   C +C K  + CV   
Sbjct: 24 SPANSTDQHQQDTNHKRKR---KFACVECRQQKSKCDAYEKAPDPCTKCQKKGVPCVLK- 79

Query: 62 QENKDGRR 69
             KD RR
Sbjct: 80 ---KDFRR 84

>ABR174W [767] [Homologous to ScYLR451W (LEU3) - SH]
          complement(728569..731163) [2595 bp, 864 aa]
          Length = 864

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 7/55 (12%)

Query: 19 FKKSRMRQSFVCRNCKKRKIKC---DKARPSCGRCSKLELECVYDFQENKDGRRG 70
          + + + R+ F C  C+++K KC   D+A   C RC+K  + CV      +D RR 
Sbjct: 33 YMRRQNRKKFACVECRQQKSKCNAHDRAPEPCSRCAKNNVPCVL----QRDFRRA 83

>Scas_702.7d
          Length = 978

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 20 KKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD 60
          K  ++R S  C NC++RKIKC   +P C  C      CV++
Sbjct: 8  KIKKLRSSRACSNCRRRKIKCSGIQP-CPNCEIYGCLCVFE 47

>Sklu_2384.6 YKL015W, Contig c2384 10929-13424
          Length = 831

 Score = 37.4 bits (85), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 1/45 (2%)

Query: 15 EPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          E  + +K + R S  C  C++R +KC    P C +C    + C Y
Sbjct: 33 EGGQLRKRQKRSSMACVRCRRRHVKCPGGNP-CSKCIAANIACEY 76

>CAGL0F09229g complement(908186..910693) weakly similar to
          sp|P39961 Saccharomyces cerevisiae YER184c,
          hypothetical start
          Length = 835

 Score = 37.4 bits (85), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 5/49 (10%)

Query: 16 PPEFKKSRM----RQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD 60
          PP  KK+++    R    C  C+KRK+KCD  +P C  C      C+Y+
Sbjct: 3  PPLAKKAKLAGKDRVIRACDVCRKRKVKCDGDQP-CSSCMTASTVCIYN 50

>ADR365W [2106] [Homologous to ScYOR337W (TEA1) - SH]
          complement(1355410..1357515) [2106 bp, 701 aa]
          Length = 701

 Score = 37.4 bits (85), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 10 GSASSEPPEFKK--SRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELEC 57
          G  + EP E +      ++   C NC++R+ KCD   P C  C +L+LEC
Sbjct: 25 GPLTEEPAERESYTGVSKKRLACTNCRRRRKKCDLNYP-CSSCLRLKLEC 73

>Kwal_56.24670
          Length = 643

 Score = 37.0 bits (84), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%)

Query: 23 RMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          R  +   C  CK RK +C + +P+C  C +L   CVY
Sbjct: 20 RTHRKTGCIPCKIRKKRCSEHKPTCTDCERLGFTCVY 56

>YLR098C (CHA4) [3513] chr12 complement(337528..339474)
          Zinc-finger protein required for transcriptional
          activation of CHA1, has a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1947 bp, 648 aa]
          Length = 648

 Score = 37.0 bits (84), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 25 RQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGR 68
          ++   C+NC++R+ KC+  +P C  C K   ECV+  Q+ ++ R
Sbjct: 39 KRKLACQNCRRRRRKCNMEKP-CSNCIKFRTECVFTQQDLRNKR 81

>KLLA0F10373g 957948..958994 some similarities with sp|P38141
          Saccharomyces cerevisiae YBR240c THI2 regulator of the
          thiamine biosynthetic genes singleton, hypothetical
          start
          Length = 348

 Score = 36.2 bits (82), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%)

Query: 22 SRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD 60
          S+ R    C  C+ +K KCD+ +P C  C K  +EC YD
Sbjct: 2  SKDRNFTGCWACRFKKRKCDERKPICSLCLKHGVECCYD 40

>Kwal_47.17565
          Length = 628

 Score = 36.6 bits (83), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 5/52 (9%)

Query: 23 RMRQSFVCRNCKKRKIKCDKARPSCGRCSKLEL--ECVYDFQENKDGRRGLP 72
          R R    C+ C + K+KC+K  P C  C++L +   CVY F+  + G   +P
Sbjct: 6  RHRSIKTCKYCYEHKLKCNKQSP-CDNCTRLGITSHCVYGFK--RSGESSVP 54

>Scas_709.65*
          Length = 651

 Score = 36.6 bits (83), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 2/57 (3%)

Query: 6  PSNTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCD--KARPSCGRCSKLELECVYD 60
          P+N    +     + + R + S  C  C  R+IKCD      +C  C K E +C+++
Sbjct: 20 PNNLSVVNKPERSYNRKRKKASRACDQCHHRRIKCDFNPETRNCSGCEKTEEKCLFN 76

>Kwal_55.21884
          Length = 882

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 7/48 (14%)

Query: 25 RQSFVCRNCKKRKIKCD---KARPSCGRCSKLELECVYDFQENKDGRR 69
          R+   C  C+++K KCD   KA   C RC+K  + CV      KD RR
Sbjct: 26 RKKLACVECRQQKSKCDAHEKAPEPCTRCAKKNVACVL----QKDFRR 69

>CAGL0F07755g complement(755947..757782) similar to sp|P40969
          Saccharomyces cerevisiae YMR168c CEP3 kinetochore
          protein complex, start by similarity
          Length = 611

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 19/31 (61%), Gaps = 3/31 (9%)

Query: 30 CRNCKKRKIKCDKARPSCGRCSK--LELECV 58
          C  C KRK+KCD+  P CG C K   E ECV
Sbjct: 14 CSVCSKRKVKCDRLVP-CGHCRKRGTESECV 43

>Scas_630.14
          Length = 701

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 3/61 (4%)

Query: 9  TGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLEL-ECVYDFQENKDG 67
          T +A S+    K++R+ +S  C  C+ RK KCD+ +P C  C    + EC YD +   D 
Sbjct: 7  TKAAKSKDGIRKRNRVPKS--CTVCRLRKSKCDRIKPYCSSCVLHGIKECRYDDRTISDK 64

Query: 68 R 68
          R
Sbjct: 65 R 65

>YDR520C (YDR520C) [1333] chr4 complement(1481073..1483391) Protein
           containing a fungal Zn(2)-Cys(6) binuclear cluster
           domain, which act as transcriptional regulators [2319
           bp, 772 aa]
          Length = 772

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 13/66 (19%)

Query: 5   SPSNTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARP---SCGRCSKLELECVYDF 61
           SP N G+        K  + R++F C  C++ K +CD   P    C RC+ L+L+C    
Sbjct: 54  SPKNNGNK-------KPRKKRKTFSCDTCRRVKTRCD-FEPFIGKCYRCNVLQLDC--SL 103

Query: 62  QENKDG 67
             NKD 
Sbjct: 104 ARNKDN 109

>YBR240C (THI2) [419] chr2 complement(700447..701799) Zinc-finger
          regulatory protein for thiamine pyrophosphokinase
          (THI80) expression [1353 bp, 450 aa]
          Length = 450

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 10 GSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQ 62
           S+S  PP    ++ R    C  C+ +K +CD+ RP C  C+K    C YD +
Sbjct: 14 ASSSKVPP----TKGRTFTGCWACRFKKRRCDENRPICSLCAKHGDNCSYDIR 62

>AGR369W [4680] [Homologous to ScYBL066C (SEF1) - SH]
           complement(1412347..1415502) [3156 bp, 1051 aa]
          Length = 1051

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 3/36 (8%)

Query: 30  CRNCKKRKIKCDKAR---PSCGRCSKLELECVYDFQ 62
           C +C++ KIKC+ +     SC RC ++ L+C  D Q
Sbjct: 92  CTHCRQHKIKCNASENFPSSCSRCERMGLQCEIDPQ 127

>Scas_449.1
          Length = 636

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%)

Query: 25 RQSFVCRNCKKRKIKCDKARPSCGRCSKLELEC 57
          R+   C NC++R+ KCD   P C  C +L L C
Sbjct: 32 RKRLACSNCRRRRKKCDLNFP-CANCIRLGLNC 63

>KLLA0D10593g complement(900326..903103) similar to sp|P08638
          Saccharomyces cerevisiae YLR451w LEU3 transcription
          factor, hypothetical start
          Length = 925

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 32/71 (45%), Gaps = 12/71 (16%)

Query: 7  SNTGSASSEPPEFK-----KSRMRQSFVCRNCKKRKIKCD---KARPSCGRCSKLELECV 58
          S   SASS P   K     K   ++   C  C+++K KCD   +A   C RC K  + CV
Sbjct: 21 SGVSSASSTPVSVKLCNDKKMPQKKKLACVECRQQKSKCDAHERAPEPCSRCLKKGVPCV 80

Query: 59 YDFQENKDGRR 69
                KD RR
Sbjct: 81 L----QKDFRR 87

>KLLA0C03201g complement(286973..288925) similar to sp|P39529
          Saccharomyces cerevisiae YJL206c, start by similarity
          Length = 650

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 3/54 (5%)

Query: 8  NTGSASSEPP--EFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          N    ++EP   + +  R +    C +CK+RK++CD   P C  C    ++C Y
Sbjct: 12 NVSVLATEPSTNQLEPVRHKVKHACSSCKERKVRCDGQSP-CASCINARVKCEY 64

>AFR722C [3915] [Homologous to ScYDR520C - SH] (1765420..1767852)
           [2433 bp, 810 aa]
          Length = 810

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 2/58 (3%)

Query: 20  KKSRMRQSFVCRNCKKRKIKCD--KARPSCGRCSKLELECVYDFQENKDGRRGLPGPG 75
           K+ + R+++ C  C+K K +CD       C RC  L LEC        D  R   G G
Sbjct: 93  KQRKKRRTYSCDLCRKFKTRCDFEPTAGKCHRCHVLNLECSLTKDRQADILRAAEGSG 150

>Kwal_47.16939
          Length = 669

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 8/41 (19%)

Query: 30 CRNCKKRKIKCD--KARPSCGRCSKLELECVYDFQENKDGR 68
          C NCKK K+KC+   + P C RC++  L+C Y      DGR
Sbjct: 13 CSNCKKNKVKCEYLSSLP-CQRCARHSLKCYY-----LDGR 47

>Kwal_26.6732
          Length = 676

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 30 CRNCKKRKIKCDKARPSCGRCSKLELECVY-DFQENKDGRR 69
          C  C+KR+ KCD+ +P C  C    L+C + D+   +  R+
Sbjct: 12 CLTCRKRRKKCDERKPVCTGCESNFLQCTWPDYNGGRVRRK 52

>Scas_597.2
          Length = 540

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 3/65 (4%)

Query: 10 GSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELE--CVYDFQENKDG 67
          G ++ E       R + +  C NC K    CD  RP C RC K EL+  CV   ++ +  
Sbjct: 23 GPSAKEKKSQTGKRRKINVACSNCAKSHSSCDSCRP-CSRCIKKELQDSCVDKPRKKRKY 81

Query: 68 RRGLP 72
            G+P
Sbjct: 82 LDGIP 86

>Kwal_23.4370
          Length = 692

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 3/64 (4%)

Query: 8   NTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDG 67
           + G ++    E+KK  +   + C  C+K K +C K  P C  C+K    C Y  +  +  
Sbjct: 54  DDGVSADTNGEYKKYEL---YSCSRCRKLKKRCSKESPVCVSCAKAGESCTYPGRAPRRT 110

Query: 68  RRGL 71
           R+ L
Sbjct: 111 RKEL 114

>Kwal_23.4016
          Length = 628

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 2/36 (5%)

Query: 25 RQSFVCRNCKKRKIKC--DKARPSCGRCSKLELECV 58
          R+   C NC ++KIKC  +     C +C++L++ CV
Sbjct: 12 RKLVACDNCYRKKIKCRRNNDEEKCAQCTRLKIRCV 47

>YOR172W (YRM1) [4969] chr15 (654210..656570) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [2361 bp, 786 aa]
          Length = 786

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 12 ASSEPPEFKKSRMRQSFV--CRNCKKRKIKCDKARPSCGRC 50
          AS      KK++ R+  +  C  C+KRK++CD+ +P C  C
Sbjct: 11 ASPSEETVKKAQKRRKPIKSCAFCRKRKLRCDQQKPMCSTC 51

>AER291C [2793] [Homologous to ScYHR178W (STB5) - SH]
          (1172383..1174374) [1992 bp, 663 aa]
          Length = 663

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 18/34 (52%)

Query: 26 QSFVCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          +++ C  C++ K KC K  P C  C     ECVY
Sbjct: 19 ETYSCSRCRRLKKKCSKELPRCFSCEAASKECVY 52

>KLLA0D00396g complement(36277..37362) some similarities with
          ca|CA2346|CaSEF1 Candida albicans Putative
          transcription factor1, hypothetical start
          Length = 361

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 20/35 (57%), Gaps = 3/35 (8%)

Query: 30 CRNCKKRKIKCDKA--RPS-CGRCSKLELECVYDF 61
          C  C+K K+KCD A  RP  C  CSK  L C  D+
Sbjct: 8  CTRCRKNKVKCDSANTRPGPCTACSKRGLVCTLDY 42

>YDL170W (UGA3) [701] chr4 (156319..157905) Transcriptional
          activator for 4-aminobutyric acid (GABA) catabolic
          genes, including UGA4, UGA1, and UGS2, contains a
          Zn[2]-Cys[6] fungal-type binuclear cluster domain [1587
          bp, 528 aa]
          Length = 528

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 17/30 (56%)

Query: 30 CRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          C  CK RK +C + +P C  C +L   C+Y
Sbjct: 17 CITCKIRKKRCSEDKPVCRDCRRLSFPCIY 46

>YHR178W (STB5) [2464] chr8 (459297..461528) Probable
          transcriptional activator of multidrug resistance genes
          such as PDR5 and SNQ2 [2232 bp, 743 aa]
          Length = 743

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 19/40 (47%)

Query: 20 KKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          +  R  + + C  C+K K KC K  P+C  C K    C Y
Sbjct: 12 RSQRTTELYSCARCRKLKKKCGKQIPTCANCDKNGAHCSY 51

>YBR297W (MAL33) [474] chr2 (800479..801885) Maltose fermentation
          regulatory protein, has a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1407 bp, 468 aa]
          Length = 468

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 1/42 (2%)

Query: 28 FVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRR 69
          + C  C+ R++KCD  +P C RC +   +C Y     K G +
Sbjct: 6  YACDYCRVRRVKCDGKKP-CSRCIEHNFDCTYQQPLKKRGSK 46

>Kwal_14.1631
          Length = 443

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 24/42 (57%)

Query: 21 KSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQ 62
          K++ R    C  C+ +K +CD+A+P C  C K   +C YD +
Sbjct: 6  KTKARSFTGCWACRFKKRRCDEAKPVCSLCLKHGDQCSYDIR 47

>KLLA0D09977g complement(841852..843756) weakly similar to
          sp|P40969 Saccharomyces cerevisiae YMR168c CEP3
          kinetochore protein complex, 71 KD subunit singleton,
          start by similarity
          Length = 634

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 24/41 (58%)

Query: 30 CRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRRG 70
          C  C+ RK+KCD++ P+C  C +  +  + ++ +N   +R 
Sbjct: 15 CTFCQARKVKCDRSLPACQNCIERNVTELCEYDDNGSRKRA 55

>KLLA0F25630g 2378464..2381487 some similarities with sp|P32862
           Saccharomyces cerevisiae YKL038w RGT1 regulator of
           glucose-induced genes, hypothetical start
          Length = 1007

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 11/61 (18%)

Query: 7   SNTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCD-------KARPSCGRCSKLELECVY 59
           SN  +A++E     + R + S  C  C+K+KIKCD           SC  C K+  +C +
Sbjct: 98  SNVSTATTE----SRRRSKVSRACDQCRKKKIKCDFIEGHDINPDQSCTGCRKIGEKCSF 153

Query: 60  D 60
           +
Sbjct: 154 E 154

>KLLA0D12650g complement(1073580..1075535) weakly similar to
          ca|CA2184|IPF6874.3 Candida albicans unknown function,
          3-prime end, hypothetical start
          Length = 651

 Score = 35.0 bits (79), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 19/35 (54%)

Query: 25 RQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          R S  C  C+ R  KCD+ +P C  C +  L CV+
Sbjct: 27 RSSRGCLTCRDRHKKCDEKKPLCSGCKENFLRCVW 61

>Kwal_26.7448
          Length = 714

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 14/21 (66%)

Query: 30  CRNCKKRKIKCDKARPSCGRC 50
           C  CK+R+IKCD+  P C  C
Sbjct: 95  CDECKRRRIKCDETLPECNNC 115

>Kwal_33.13118
          Length = 779

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 4/54 (7%)

Query: 7  SNTGSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARP---SCGRCSKLELEC 57
          SN+   S      K  + R+++ C  C+K K +CD   P    C RCS L+L+C
Sbjct: 34 SNSREESDRESSRKPRKKRKTYSCEVCRKFKTRCD-FEPLVGRCHRCSVLKLQC 86

>AER183C [2685] [Homologous to ScYOL089C (HAL9) - NSH]
           (975879..978518) [2640 bp, 879 aa]
          Length = 879

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 23  RMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
           R R S  C  C+ +KI+C+   P C  C K  L C Y
Sbjct: 74  RKRVSKACDICRAKKIRCNGEEP-CVNCEKFNLGCTY 109

>YBL066C (SEF1) [131] chr2 complement(96906..100079) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [3174 bp, 1057 aa]
          Length = 1057

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 3/36 (8%)

Query: 30 CRNCKKRKIKCDKARP---SCGRCSKLELECVYDFQ 62
          C +C++ KIKCD ++     C RC K+ L C  + Q
Sbjct: 57 CTHCRQHKIKCDASQNFPHPCSRCEKIGLHCEINPQ 92

>YKL015W (PUT3) [3241] chr11 (408187..411126) Transcription factor
          that activates the proline utilization pathway genes,
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region [2940 bp, 979 aa]
          Length = 979

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 1/40 (2%)

Query: 20 KKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          +K + R S  C +C+KR IKC    P C +C      C Y
Sbjct: 24 QKRQQRSSVACLSCRKRHIKCPGGNP-CQKCVTSNAICEY 62

>YJL206C (YJL206C) [2722] chr10 complement(47659..49935) Protein
          with weak similarity to Put3p and other transcription
          factors, has a Zn[2]-Cys[6] fungal-type binuclear
          cluster domain in the N-terminal region [2277 bp, 758
          aa]
          Length = 758

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 1/43 (2%)

Query: 18 EFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD 60
          E K ++ R    C  C+KRK++C    P C  C     EC YD
Sbjct: 35 ELKPTKGRAHRACIACRKRKVRCSGNIP-CRLCQTNSYECKYD 76

>Sklu_2082.1 YER184C, Contig c2082 2025-2273
          Length = 82

 Score = 31.6 bits (70), Expect = 0.44,   Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 1/41 (2%)

Query: 20 KKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYD 60
          K+   + S  C  C+KRKIKC     SC  C     +C YD
Sbjct: 6  KRQPYKVSKACNECRKRKIKC-TGTFSCSSCVIYGSKCGYD 45

>Kwal_47.16862
          Length = 743

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 6/43 (13%)

Query: 25 RQSFVCRNCKKRKIKC------DKARPSCGRCSKLELECVYDF 61
          R +F C NC  +K KC      D  R  C RC K    C +D 
Sbjct: 55 RNTFACTNCHAQKSKCVPSDVLDIYRKPCVRCRKRNKLCTFDL 97

>AGR280C [4591] [Homologous to ScYLR278C - SH] (1266918..1270238)
          [3321 bp, 1106 aa]
          Length = 1106

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 3/39 (7%)

Query: 20 KKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECV 58
          KK R R    C  C++RK +CD   PSC  C K  + C+
Sbjct: 34 KKGRSRS---CLLCQRRKQRCDHKIPSCTACLKAGVRCI 69

>YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway
          regulatory protein, contains a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1422 bp, 473 aa]
          Length = 473

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%)

Query: 29 VCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGRRGL 71
           C  C+ R++KCD  RP C  C +  L+C Y     K G + +
Sbjct: 12 ACDCCRIRRVKCDGKRP-CSSCLQNSLDCTYLQPSRKRGPKSI 53

>KLLA0B04620g complement(413129..415888) some similarities with
           sp|Q03631 Saccharomyces cerevisiae YML076c singleton,
           hypothetical start
          Length = 919

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 6/43 (13%)

Query: 25  RQSFVCRNCKKRKIKCDKARPS------CGRCSKLELECVYDF 61
           R +F C +C   K KC+   P+      C RC+KL   C +D 
Sbjct: 59  RSTFACISCHSMKQKCNPTDPTDIYRHPCIRCAKLNKICQFDL 101

>AGR061C [4371] [Homologous to ScYLR098C (CHA4) - SH]
          (831058..832896) [1839 bp, 612 aa]
          Length = 612

 Score = 33.9 bits (76), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 1/30 (3%)

Query: 29 VCRNCKKRKIKCDKARPSCGRCSKLELECV 58
           C+ C+KR+ KCD   P C  C K  +EC+
Sbjct: 13 ACQTCRKRRRKCDLQVP-CVNCQKFGVECL 41

>KLLA0E20405g <1805948..1809364 gi|3024604|sp|P87164|SEF1_KLULA
           Kluyveromyces lactis SUPPRESSOR PROTEIN SEF1, start by
           similarity
          Length = 1138

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 3/36 (8%)

Query: 30  CRNCKKRKIKCDKAR--PS-CGRCSKLELECVYDFQ 62
           C +C++ KIKC+ +   P+ C RC ++ L C  D Q
Sbjct: 137 CTHCRQHKIKCNASEKFPAPCSRCERMGLHCEIDPQ 172

>Kwal_14.1636
          Length = 456

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 19/38 (50%), Gaps = 3/38 (7%)

Query: 23 RMRQSFVCRNCKKRKIKCDKARPSCGRCSK--LELECV 58
          R + S  C NC K  + C   RP C RC K  LE  CV
Sbjct: 5  RQKTSVACINCSKSHVTCQAERP-CTRCVKKGLEASCV 41

>Scas_610.9
          Length = 809

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 7/48 (14%)

Query: 25 RQSFVCRNCKKRKIKC---DKARPSCGRCSKLELECVYDFQENKDGRR 69
          R+ + C  C+++K KC   DKA   C +C++  + C+      KD RR
Sbjct: 14 RRKYACVECRQQKSKCDANDKAPNPCSKCARKGVPCIL----KKDFRR 57

>YLR451W (LEU3) [3825] chr12 (1036089..1038749) Transcription
          factor regulating genes of branched chain amino acid
          biosynthesis pathways, acts as both a repressor and an
          inducer [2661 bp, 886 aa]
          Length = 886

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 6/58 (10%)

Query: 7  SNTGSASSEPPEFKKSRM---RQSFVCRNCKKRKIKCD---KARPSCGRCSKLELECV 58
          S +GS  S      ++ M   ++ F C  C+++K KCD   +A   C +C+K  + C+
Sbjct: 11 SQSGSEMSHSETRNRTGMNARKRKFACVECRQQKSKCDAHERAPEPCTKCAKKNVPCI 68

>AFL031W [3162] [Homologous to ScYBR239C - SH]
          complement(376161..377714) [1554 bp, 517 aa]
          Length = 517

 Score = 33.5 bits (75), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 3/38 (7%)

Query: 23 RMRQSFVCRNCKKRKIKCDKARPSCGRCSK--LELECV 58
          R + +  C NC +  + C+  RP C RC K  LE+ CV
Sbjct: 12 RKKTNVACVNCSRSHVTCESQRP-CTRCVKKGLEMSCV 48

>Scas_564.9*
          Length = 609

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 3/46 (6%)

Query: 23 RMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQENKDGR 68
          R+R+  + +   K + KCD   P C  C K E ECVY   + +  R
Sbjct: 6  RLRK--ILKKLAKIRRKCDTGSP-CANCMKFETECVYTGHDLRKAR 48

>Scas_711.31
          Length = 932

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 15/29 (51%)

Query: 29 VCRNCKKRKIKCDKARPSCGRCSKLELEC 57
           C  C+ +KIKCD   P C  C K  + C
Sbjct: 44 ACDRCRLKKIKCDDRTPDCTPCMKAGIPC 72

>YMR168C (CEP3) [4123] chr13 complement(597331..599157) Component
          (subunit b) of the Cbf3 kinetochore protein complex
          [1827 bp, 608 aa]
          Length = 608

 Score = 33.9 bits (76), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 20 KKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSK 52
          + ++++    C  C +RK+KCD+  P CG C K
Sbjct: 4  RTTQLKSKHPCSVCTRRKVKCDRMIP-CGNCRK 35

>AFL033W [3160] [Homologous to ScYBR240C (THI2) - SH]
          complement(373485..374633) [1149 bp, 382 aa]
          Length = 382

 Score = 33.1 bits (74), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 22/43 (51%)

Query: 20 KKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVYDFQ 62
          +K R+R    C  C+ +K +CD+  P C  C K    C YD +
Sbjct: 14 RKPRIRCFTGCWACRFKKRRCDEGVPFCALCVKHGDACSYDVR 56

>CAGL0F03025g 295783..298569 similar to sp|Q04052 Saccharomyces
          cerevisiae YDR421w positive transcription regulator of
          ARO9 and ARO10, hypothetical start
          Length = 928

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 10/67 (14%)

Query: 10 GSASSEPPEFKKSRMRQSFVCRNCKKRKIKCD------KARPSCGRCSKLELECVYDFQE 63
          GS+SS+  + K +       C  CK +KIKCD         P C  C +    C ++  +
Sbjct: 22 GSSSSQGQKHKNTFG----ACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPK 77

Query: 64 NKDGRRG 70
           K G+ G
Sbjct: 78 VKIGKLG 84

>ACL096W [953] [Homologous to ScYKL015W (PUT3) - SH]
          complement(169508..172015) [2508 bp, 835 aa]
          Length = 835

 Score = 33.1 bits (74), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 12/50 (24%), Positives = 22/50 (44%), Gaps = 1/50 (2%)

Query: 10 GSASSEPPEFKKSRMRQSFVCRNCKKRKIKCDKARPSCGRCSKLELECVY 59
          G+ +      K+   R    C  C++R ++C    P C +C+   + C Y
Sbjct: 41 GTLAGREERNKRPAKRAPLACLRCRRRHVRCPGGTP-CAKCAVANIACEY 89

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.136    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,541,406
Number of extensions: 1045106
Number of successful extensions: 3339
Number of sequences better than 10.0: 286
Number of HSP's gapped: 3326
Number of HSP's successfully gapped: 310
Length of query: 827
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 717
Effective length of database: 12,788,129
Effective search space: 9169088493
Effective search space used: 9169088493
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 66 (30.0 bits)