Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.70831400138066870.0
KLLA0A04059g136656812071e-142
YAL024C (LTE1)143559911711e-136
ACR292W143948311611e-135
Scas_505.3136457411391e-132
CAGL0G06226g131845610291e-118
YLR310C (CDC25)15891531744e-12
YLL016W (SDC25)10481851682e-11
Kwal_14.231315171751682e-11
CAGL0E03476g15641541663e-11
Sklu_2189.415261581556e-10
KLLA0D09306g15371211378e-08
Scas_621.1*13231511351e-07
ADL038W15091441342e-07
Scas_604.1516761821314e-07
Kwal_33.1359814121691127e-05
CAGL0D06512g13082091010.002
KLLA0C03410g1360154810.30
Scas_476.2133057810.32
CAGL0B01287g1247184780.63
CAGL0C00407g55078770.81
KLLA0F11319g84343761.2
YMR120C (ADE17)59260723.5
YDR216W (ADR1)132396724.0
YGR185C (TYS1)39441705.0
Scas_659.2339641697.0
Sklu_1679.240941697.2
Kwal_26.7830108478689.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.7083
         (1380 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.7083                                                         2580   0.0  
KLLA0A04059g complement(361328..365428) similar to sp|P07866 Sac...   469   e-142
YAL024C (LTE1) [44] chr1 complement(101568..105875) GDP/GTP exch...   455   e-136
ACR292W [1339] [Homologous to ScYAL024C (LTE1) - SH] complement(...   451   e-135
Scas_505.3                                                            443   e-132
CAGL0G06226g 592179..596135 similar to sp|P07866 Saccharomyces c...   400   e-118
YLR310C (CDC25) [3699] chr12 complement(752226..756995) Guanine-...    72   4e-12
YLL016W (SDC25) [3403] chr12 (112846..115992) Protein of unknown...    69   2e-11
Kwal_14.2313                                                           69   2e-11
CAGL0E03476g complement(318956..323650) similar to sp|P04821 Sac...    69   3e-11
Sklu_2189.4 YLR310C, Contig c2189 8340-12920                           64   6e-10
KLLA0D09306g 783852..788465 weakly similar to sp|P04821 Saccharo...    57   8e-08
Scas_621.1*                                                            57   1e-07
ADL038W [1703] [Homologous to ScYLR310C (CDC25 ) - SH; ScYLL016W...    56   2e-07
Scas_604.15                                                            55   4e-07
Kwal_33.13598                                                          48   7e-05
CAGL0D06512g complement(617453..621379) some similarities with s...    44   0.002
KLLA0C03410g 303739..307821 weakly similar to ca|CA0382|IPF16030...    36   0.30 
Scas_476.2                                                             36   0.32 
CAGL0B01287g 114832..118575 similar to KLLA0C03410g Kluyveromyce...    35   0.63 
CAGL0C00407g 40815..42467 similar to tr|Q12418 Saccharomyces cer...    34   0.81 
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    34   1.2  
YMR120C (ADE17) [4077] chr13 complement(507501..509279) 5-aminoi...    32   3.5  
YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger transcri...    32   4.0  
YGR185C (TYS1) [2136] chr7 complement(866339..867523) Tyrosyl-tR...    32   5.0  
Scas_659.23                                                            31   7.0  
Sklu_1679.2 YGR185C, Contig c1679 2614-3843                            31   7.2  
Kwal_26.7830                                                           31   9.2  

>Kwal_26.7083
          Length = 1400

 Score = 2580 bits (6687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1281/1380 (92%), Positives = 1281/1380 (92%)

Query: 1    MVPEDMQGRKTEGTSVFSEREYYPTPSAEKMSYLKRGANTLIIKTDLHALIIKLTSPLDP 60
            MVPEDMQGRKTEGTSVFSEREYYPTPSAEKMSYLKRGANTLIIKTDLHALIIKLTSPLDP
Sbjct: 1    MVPEDMQGRKTEGTSVFSEREYYPTPSAEKMSYLKRGANTLIIKTDLHALIIKLTSPLDP 60

Query: 61   IDYPFLADFFLSYRKFLAPNELLRLLESRLQWAFNESLQADKERQKIGQVTSVRTFVVIR 120
            IDYPFLADFFLSYRKFLAPNELLRLLESRLQWAFNESLQADKERQKIGQVTSVRTFVVIR
Sbjct: 61   IDYPFLADFFLSYRKFLAPNELLRLLESRLQWAFNESLQADKERQKIGQVTSVRTFVVIR 120

Query: 121  HWILNYFAQDFLADQELRRQFVDSINSLSWGATEMAPKSIRGIVVSIKKSWVLCLKLMWE 180
            HWILNYFAQDFLADQELRRQFVDSINSLSWGATEMAPKSIRGIVVSIKKSWVLCLKLMWE
Sbjct: 121  HWILNYFAQDFLADQELRRQFVDSINSLSWGATEMAPKSIRGIVVSIKKSWVLCLKLMWE 180

Query: 181  DVTFENSPSNVDEWLDFKIQDIDTQSSTKEGGRRLSFYALQSRQNPDFRNRSVLSLYVGI 240
            DVTFENSPSNVDEWLDFKIQDIDTQSSTKEGGRRLSFYALQSRQNPDFRNRSVLSLYVGI
Sbjct: 181  DVTFENSPSNVDEWLDFKIQDIDTQSSTKEGGRRLSFYALQSRQNPDFRNRSVLSLYVGI 240

Query: 241  ENFQLPENSAQINRRLGAKIKQRTASMFLFPQDNLPSARLKXXXXXXXXXXXXXXXXXXX 300
            ENFQLPENSAQINRRLGAKIKQRTASMFLFPQDNLPSARLK                   
Sbjct: 241  ENFQLPENSAQINRRLGAKIKQRTASMFLFPQDNLPSARLKASSESSEPANSHSSGHSKS 300

Query: 301  XXXPDVMKDLQYPTSPSVDKVIPPTPAKKVEFILRSSYLPSDSPTEEADPANAKTDKVKK 360
               PDVMKDLQYPTSPSVDKVIPPTPAKKVEFILRSSYLPSDSPTEEADPANAKTDKVKK
Sbjct: 301  ESGPDVMKDLQYPTSPSVDKVIPPTPAKKVEFILRSSYLPSDSPTEEADPANAKTDKVKK 360

Query: 361  HNNHSYNKGMVGLLSKWKKNHNLRSENHKAHSESPKNQEIENLIKLVFSITSLEHKQDQS 420
            HNNHSYNKGMVGLLSKWKKNHNLRSENHKAHSESPKNQEIENLIKLVFSITSLEHKQDQS
Sbjct: 361  HNNHSYNKGMVGLLSKWKKNHNLRSENHKAHSESPKNQEIENLIKLVFSITSLEHKQDQS 420

Query: 421  EDAANALSSKFDILSARTIDEVEYFLAIENDLLSKIRNRGGLFNFERIHHENPQTQSPEA 480
            EDAANALSSKFDILSARTIDEVEYFLAIENDLLSKIRNRGGLFNFERIHHENPQTQSPEA
Sbjct: 421  EDAANALSSKFDILSARTIDEVEYFLAIENDLLSKIRNRGGLFNFERIHHENPQTQSPEA 480

Query: 481  VSAMDNLNLYKTXXXXXXXXXXXXKTLQYHHAVSPSAAAQERRRVKSAEVFFRNNSVLNF 540
            VSAMDNLNLYKT            KTLQYHHAVSPSAAAQERRRVKSAEVFFRNNSVLNF
Sbjct: 481  VSAMDNLNLYKTVSSIASSVISLSKTLQYHHAVSPSAAAQERRRVKSAEVFFRNNSVLNF 540

Query: 541  TDALLTRDIKTPATGNDGPRKLVFHGPMGMERIRKEEFRFHHYKTPTKTGLTSHSTPSVM 600
            TDALLTRDIKTPATGNDGPRKLVFHGPMGMERIRKEEFRFHHYKTPTKTGLTSHSTPSVM
Sbjct: 541  TDALLTRDIKTPATGNDGPRKLVFHGPMGMERIRKEEFRFHHYKTPTKTGLTSHSTPSVM 600

Query: 601  QSVNTKEVNTEDRSRYSPTKGIRISSVITEVDDTFSKHENSMNSAQSVNSVSLDTELPLK 660
            QSVNTKEVNTEDRSRYSPTKGIRISSVITEVDDTFSKHENSMNSAQSVNSVSLDTELPLK
Sbjct: 601  QSVNTKEVNTEDRSRYSPTKGIRISSVITEVDDTFSKHENSMNSAQSVNSVSLDTELPLK 660

Query: 661  RKEGLKNLREFNFEEVADHPEVTDQQEVTDQQELGEGENGERLSSADLQNDAEDDNASFF 720
            RKEGLKNLREFNFEEVADHPEVTDQQEVTDQQELGEGENGERLSSADLQNDAEDDNASFF
Sbjct: 661  RKEGLKNLREFNFEEVADHPEVTDQQEVTDQQELGEGENGERLSSADLQNDAEDDNASFF 720

Query: 721  TTFDDVSVRESIKRFTPASSVAQKSVTXXXXXXXXXXXXXXVSQPRTSVLGGLIVQEGAF 780
            TTFDDVSVRESIKRFTPASSVAQKSVT              VSQPRTSVLGGLIVQEGAF
Sbjct: 721  TTFDDVSVRESIKRFTPASSVAQKSVTSSGRISIRKSRGQSVSQPRTSVLGGLIVQEGAF 780

Query: 781  SRLDXXXXXXXXXXXXXXXRTSALVLSAXXXXXXXXXXXXXXXXXXXXXXXXXTSVSTQL 840
            SRLD               RTSALVLSA                         TSVSTQL
Sbjct: 781  SRLDEELLNNEEEMKNLEERTSALVLSAKEDEKEKERSDCEEEDAADDRASNATSVSTQL 840

Query: 841  LFTSQNNSPNKMDLKELLDNDRFPPGNKLIRLSSIPSMHSIVSGDSFSSFQTTNTFGLHS 900
            LFTSQNNSPNKMDLKELLDNDRFPPGNKLIRLSSIPSMHSIVSGDSFSSFQTTNTFGLHS
Sbjct: 841  LFTSQNNSPNKMDLKELLDNDRFPPGNKLIRLSSIPSMHSIVSGDSFSSFQTTNTFGLHS 900

Query: 901  TNSKTGARAVVTPSMDAEFSGPKDSLLGPEGDDREANKYLFSPDSDSLDFASPEKNMEDL 960
            TNSKTGARAVVTPSMDAEFSGPKDSLLGPEGDDREANKYLFSPDSDSLDFASPEKNMEDL
Sbjct: 901  TNSKTGARAVVTPSMDAEFSGPKDSLLGPEGDDREANKYLFSPDSDSLDFASPEKNMEDL 960

Query: 961  KNKFISPIVSEAPSLNEEQTSREFDDDQEGEPNDSQLSSTTQPERLPHEHHRRSITPIVS 1020
            KNKFISPIVSEAPSLNEEQTSREFDDDQEGEPNDSQLSSTTQPERLPHEHHRRSITPIVS
Sbjct: 961  KNKFISPIVSEAPSLNEEQTSREFDDDQEGEPNDSQLSSTTQPERLPHEHHRRSITPIVS 1020

Query: 1021 PYKANDSRLNKFAKLTDESLHGDPVNVALMKLEGTFSKENKEKGENDADIEKLKERRLTG 1080
            PYKANDSRLNKFAKLTDESLHGDPVNVALMKLEGTFSKENKEKGENDADIEKLKERRLTG
Sbjct: 1021 PYKANDSRLNKFAKLTDESLHGDPVNVALMKLEGTFSKENKEKGENDADIEKLKERRLTG 1080

Query: 1081 LGSRERRSFLIEKRRQIKSEIPLTPRSKEKVKQEEEVRATDLEITELLENYKIQDKRLNV 1140
            LGSRERRSFLIEKRRQIKSEIPLTPRSKEKVKQEEEVRATDLEITELLENYKIQDKRLNV
Sbjct: 1081 LGSRERRSFLIEKRRQIKSEIPLTPRSKEKVKQEEEVRATDLEITELLENYKIQDKRLNV 1140

Query: 1141 SNAQQHVPFILMYDSRSIAEQLTLVEREILNEIXXXXXXXXXXXREVPSVTSWLQLLLQN 1200
            SNAQQHVPFILMYDSRSIAEQLTLVEREILNEI           REVPSVTSWLQLLLQN
Sbjct: 1141 SNAQQHVPFILMYDSRSIAEQLTLVEREILNEIDWKDLLDLKLKREVPSVTSWLQLLLQN 1200

Query: 1201 ERLSGIDLAIARFNLTVDWIISEIVMTCDNKLRRNTIQRLIHVAEHCKTFQNYNTLMQII 1260
            ERLSGIDLAIARFNLTVDWIISEIVMTCDNKLRRNTIQRLIHVAEHCKTFQNYNTLMQII
Sbjct: 1201 ERLSGIDLAIARFNLTVDWIISEIVMTCDNKLRRNTIQRLIHVAEHCKTFQNYNTLMQII 1260

Query: 1261 LALSSLVVQSYRDAWRLIEPGDLLTWESLKNVPSLEKNYYNIRMLLNDINPIKGCIPFIV 1320
            LALSSLVVQSYRDAWRLIEPGDLLTWESLKNVPSLEKNYYNIRMLLNDINPIKGCIPFIV
Sbjct: 1261 LALSSLVVQSYRDAWRLIEPGDLLTWESLKNVPSLEKNYYNIRMLLNDINPIKGCIPFIV 1320

Query: 1321 VYLSDLTLNAEKSNWIVPNQVLNYSKFQTNVQIVKNFIQRAQWSKFYQFSVNEELLSKCV 1380
            VYLSDLTLNAEKSNWIVPNQVLNYSKFQTNVQIVKNFIQRAQWSKFYQFSVNEELLSKCV
Sbjct: 1321 VYLSDLTLNAEKSNWIVPNQVLNYSKFQTNVQIVKNFIQRAQWSKFYQFSVNEELLSKCV 1380

>KLLA0A04059g complement(361328..365428) similar to sp|P07866
            Saccharomyces cerevisiae YAL024c LTE1 GDP/GTP exchange
            factor, start by similarity
          Length = 1366

 Score =  469 bits (1207), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 268/568 (47%), Positives = 345/568 (60%), Gaps = 57/568 (10%)

Query: 835  SVSTQLLFTSQNNSPNKMDLKE---LLDNDRFP--PGNKLIR-----LSSIPSMHSIVSG 884
            S+ST LLF+S   SP K+ +KE   + +    P  P   L +     LS  PS+ SI S 
Sbjct: 815  SISTNLLFSSAQASPQKLVIKEVDVIQEKSEHPDVPTPVLCKQPISKLSETPSIKSIGSR 874

Query: 885  DSFSSFQTTNTFGLHSTNSKTGARAVVTPSMDAEFSGPKDSL--LGPEGDDREANKYLFS 942
            DS  SF  T+     +    T  R        A     ++ +  L PE      NKYLFS
Sbjct: 875  DSEESFDLTSIASKPNRAQSTTLREKYHLEKQATNDIFEEDVENLNPEN-----NKYLFS 929

Query: 943  PDSDSLDFASPEKNMEDLKNKFISPIVSEAPSLNEEQTSREFDDDQEGEPNDSQLSSTTQ 1002
            PD+DS+DFASPEKN++DLK +FI     E  SL+EE+ +      Q+ E  D        
Sbjct: 930  PDTDSIDFASPEKNLDDLKQQFIDQSTDEQTSLDEEEIAT-----QDNENKD-------- 976

Query: 1003 PERLPHEHHRRSITPIVSPYKANDSRLNKFAKLTDESLHGDPVNVALMKLEGTFSKENKE 1062
                 H   ++ +  I          +N      D S+  DPVN+ALMKLEGT+ K  KE
Sbjct: 977  -----HGIDKKKLEDI----------MNGIDDTADTSM--DPVNLALMKLEGTYDKGEKE 1019

Query: 1063 KGENDADIEKLKERRLTGL----------GSRERRSFLIEKRRQIKSEIPLTPRSKEKVK 1112
              +    I     R +              +R+R+S  I++RR    +  +     +K  
Sbjct: 1020 IDDKSPSINSELAREVENFQIVQTAALPESARKRQSMFIQRRRNTMIDFSVRDSLIDKDS 1079

Query: 1113 QEEEVRATDLEITELLENYKIQDKRLNVSNAQQHVPFILMYDSRSIAEQLTLVEREILNE 1172
                +  TD +I  LL  Y + D RL + N +QH+PFILMYDS+S+A QLTL+E+EIL+E
Sbjct: 1080 SCTRLENTDEQIRNLLNQYTLTDSRLKIDNLEQHIPFILMYDSKSVANQLTLIEKEILSE 1139

Query: 1173 IXXXXXXXXXXXREVPSVTSWLQLLLQNERLSGIDLAIARFNLTVDWIISEIVMTCDNKL 1232
            +            ++P  TSWLQLL+QNE LSGIDLAIARFNLTVDWIISEIVMT D +L
Sbjct: 1140 VDWKDLLDLTMSEQLPQFTSWLQLLVQNENLSGIDLAIARFNLTVDWIISEIVMTQDIRL 1199

Query: 1233 RRNTIQRLIHVAEHCKTFQNYNTLMQIILALSSLVVQSYRDAWRLIEPGDLLTWESLKNV 1292
            RRNTIQR IH+AEHCK  QNYNTLM+IILAL+S+VVQ + + WRL+EPGDLLTWE+LK +
Sbjct: 1200 RRNTIQRFIHIAEHCKELQNYNTLMEIILALNSIVVQKFTETWRLVEPGDLLTWETLKAI 1259

Query: 1293 PSLEKNYYNIRMLLNDINPIKGCIPFIVVYLSDLTLNAEKSNWIVPNQVLNYSKFQTNVQ 1352
            PSLEKNY NIR L++++ P+ GCIPFIVVYLSDL+LN EK  WIV ++VLNY+KFQTNVQ
Sbjct: 1260 PSLEKNYSNIRQLIDEVEPLSGCIPFIVVYLSDLSLNIEKRTWIVHDEVLNYNKFQTNVQ 1319

Query: 1353 IVKNFIQRAQWSKFYQFSVNEELLSKCV 1380
            IVKNF+Q+ QWSKFY   ++ ELLSKCV
Sbjct: 1320 IVKNFVQKMQWSKFYNIDIDHELLSKCV 1347

 Score =  367 bits (942), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 259/755 (34%), Positives = 393/755 (52%), Gaps = 99/755 (13%)

Query: 16  VFSEREYYPTPSAEKMSYLKRGANTLIIKTDLHALIIKLTSPLDPIDYPFLADFFLSYRK 75
           +FS  E YP PS   ++   R     I+K  L AL+++L+SPLD +DY  L DFFL YR 
Sbjct: 15  LFSRPELYPVPSESVLTVDLRDGTVRILKCTLPALLVQLSSPLDKVDYSMLTDFFLVYRN 74

Query: 76  FLAPNELLRLLESRLQWAFNESLQADKERQKI-GQVTSVRTFVVIRHWILNYFAQDFLAD 134
           F++  +LL L++ R QWA +        ++KI  +V  VR FV++RHW+ NYFAQDF+ D
Sbjct: 75  FMSSQKLLDLIQERFQWAIDLRQSDPSSQEKITSEVILVRMFVLVRHWLSNYFAQDFVVD 134

Query: 135 QELRRQFVDSINSLSWGATEMAPKSIRGIVVSIKKSWVLCLKLMWED---VTFENSPSNV 191
             LRRQF+  IN  S        + +  I++S+KK WV  +++MWED   +  EN+  + 
Sbjct: 135 TSLRRQFLQFINGYS-----PVDRFLDNIIISLKKLWVQNVQIMWEDLENLIVENNVVSR 189

Query: 192 DEWLDFKIQDIDTQSSTKEG-----GRRLSFYALQSRQNPDFRNRSVLSLYVGIENFQLP 246
           D+WL ++I+D+ + SS++ G     G+RLSF ALQ+  NP  RN S+LSL    E   LP
Sbjct: 190 DDWLKWEIEDVPSGSSSETGEGSTKGKRLSFIALQNINNPVLRNESLLSLLHTREKIPLP 249

Query: 247 ENSAQINRRLGAKIKQRTASMFLFPQDNLPSARLKXXXXXXXXXXXXXXXXXXXXXXPD- 305
           + S   +++   +IKQRT SM LFP++      +                       P  
Sbjct: 250 QQSEDESKKQSTRIKQRTGSMLLFPENASNGLSINEKLTASGVSPEATPKQEREITDPKN 309

Query: 306 -------------------VMKDLQYPTSPSVDKVIPPTPAKKVEFILRSSYLPSDSPTE 346
                              +MKDL+YP++PSVD  +PPTPAK +EFIL++SY+ +D P E
Sbjct: 310 SKDNKHILPQLSRVTNVSYMMKDLEYPSTPSVDIFVPPTPAKNIEFILQTSYMETDLP-E 368

Query: 347 EADPANAKTDKVKKHNNHSYNKGMVGLLSKWKKNHNLRSENHKAHSESPKNQEIENLIKL 406
           +++ +++       + NH   KG++GLLSKWK NH  R          P+   +ENLIK 
Sbjct: 369 QSNGSDSTNTVNGNNTNH---KGILGLLSKWKLNHQ-RKPTVNPVQNPPR---VENLIKY 421

Query: 407 VFSITSLEHKQDQSEDAANALSSKFDILSARTIDEVEYFLAIENDLLSKIRNRGGLFNFE 466
           VFSI+SL++  +   D   +LSS FDILSARTIDEVEY +++E+DLL+K+  +       
Sbjct: 422 VFSISSLDNHANPLPD---SLSSMFDILSARTIDEVEYLVSVESDLLAKLEAKKLTTEIS 478

Query: 467 RIHHENPQTQSPEAVSAMDNLNLYKTXXXXXXXXXXXXKTLQYH------HAVSPSAAAQ 520
           ++     ++Q     S +DNLNLYKT            KTL         H +SPS +A 
Sbjct: 479 KLETNEDESQD---YSVIDNLNLYKTVSSIANSVISLSKTLNVRTNKSTTHLLSPSTSAL 535

Query: 521 ERRRVKSAE--VFFRNNSVLNFTDALLTRDIKTPATG-NDGPRKLVFHGPMGMERIRKEE 577
           ER+ ++++   ++  NNS  + T+AL+      P T  N  P++LVFH P          
Sbjct: 536 ERKNIRNSAPMLYSYNNSRYSITNALM----GLPNTNDNSSPKRLVFHDPTR-------- 583

Query: 578 FRFHHYKTPTKTGLTSHSTPSVMQSVNTKEVNTEDRSRYSPTKGIRISSVITEVDDTFSK 637
                  +PTK  + +++        N  E N E  S  S        S I+   +  S+
Sbjct: 584 ------NSPTKKAILANNLN------NIGEYNGERDSITSIVTYDSAFSDISSSGNILSQ 631

Query: 638 HENSMNSAQSVNSVSLDTELPLKRKEGLKNLREFNFEEVADHPEVTDQQEVTDQ-QELGE 696
           H+ S N       + +++   LKRK  + +LR FNFE+     + TD +  + Q +E  E
Sbjct: 632 HKGSSN-------IFMESAPTLKRKLNVNDLRRFNFEK----SDSTDDRSCSPQNREATE 680

Query: 697 GENGERLSSAD---LQNDAEDDN---ASFFTTFDD 725
                  S A+   +Q++ E++N   AS  T +++
Sbjct: 681 TSATSMESDANDNAIQDEYENENEDIASLITAYEE 715

>YAL024C (LTE1) [44] chr1 complement(101568..105875) GDP/GTP exchange
            factor, required for termination of M phase [4308 bp,
            1435 aa]
          Length = 1435

 Score =  455 bits (1171), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 274/599 (45%), Positives = 356/599 (59%), Gaps = 84/599 (14%)

Query: 841  LFTSQNNSPNKMDLKELLDNDR-FPPGNKL-----IRLSSIPSMHSIVS-------GDSF 887
            LF S  NSP    LK+  +  R FP G  +     IRLS  P++ S+VS       G + 
Sbjct: 847  LFESAQNSP----LKQTQNPQREFPNGTSVSETNRIRLSIAPTIESVVSDLNSITTGSTV 902

Query: 888  SSFQTTNTFGL-HS------TNSKTGARAVV--TPSMD----AEFSGPKDSLLGPEGDDR 934
             +F+T+    + H          + G + ++  T S+      + S   + L  P    +
Sbjct: 903  ETFETSRDLPVPHQRIINLREEYQRGNQDIISNTSSLHELKTIDLSDSNNDLESPSTHAK 962

Query: 935  EANKYLFSPDSDSLDFASPEKNMEDLKNKFISPIVSEAPSLNEEQTSREFDDD----QEG 990
              NKY FSPD  S+D ASP KN+E+LK+KF+          NE +T+           + 
Sbjct: 963  N-NKYFFSPDDGSIDVASPMKNVEELKSKFLK---------NESETNSNISGSVLTMDDI 1012

Query: 991  EPNDSQLSSTTQPERLPHEHHRRSITPIVSPYKANDSRLNKFAKLTDESLHGDPVNVALM 1050
            + ND+  +  T          RR+ +        N   LN+ A + D+S++ DP+ VALM
Sbjct: 1013 DINDTSSARNT----------RRANSESAFTGSLNKKNLNEIANMLDDSINDDPITVALM 1062

Query: 1051 KLEGTFSKENKEKGEN----DA----------DIEKLKERRLTGLG---SRERRSFLIEK 1093
            KLEGT+ K   EK EN    DA          ++E L    L       + +R+S LIE+
Sbjct: 1063 KLEGTYEKI-PEKPENTKSSDAIGIKTSKLADEVEMLNLNNLPSFQNSPAEKRKSLLIER 1121

Query: 1094 RRQIKSEIPLTPRSKEK------------VKQEEEVRATDLEITELLENYKIQDKRLNVS 1141
            RRQ    IP TP   EK            V    +V     +I EL+  Y+I D RL +S
Sbjct: 1122 RRQTIMNIPFTPDQSEKEGFTSSSPEKIDVSANVDVAVQAAQIQELIGQYRIHDSRLMIS 1181

Query: 1142 NAQQHVPFILMYDSRSIAEQLTLVEREILNEIXXXXXXXXXXXREVPSVTSWLQLLLQNE 1201
            N + HVPFILMYDS S+A+Q+TL+E+EIL EI            E P V SWLQLL++NE
Sbjct: 1182 NNESHVPFILMYDSLSVAQQMTLIEKEILGEIDWKDLLDLKMKHEGPQVISWLQLLVRNE 1241

Query: 1202 RLSGIDLAIARFNLTVDWIISEIVMTCDNKLRRNTIQRLIHVAEHCKTFQNYNTLMQIIL 1261
             LSGIDLAI+RFNLTVDWIISEI++T  +K++RN IQR IHVA+HC+TFQN+NTLM+IIL
Sbjct: 1242 TLSGIDLAISRFNLTVDWIISEILLTKSSKMKRNVIQRFIHVADHCRTFQNFNTLMEIIL 1301

Query: 1262 ALSSLVVQSYRDAWRLIEPGDLLTWESLKNVPSLEKNYYNIRMLLNDINPIKGCIPFIVV 1321
            ALSS VVQ + DAWRLIEPGDLLTWE LK +PSL++NY  IR LLN +NP+ GC+PFIVV
Sbjct: 1302 ALSSSVVQKFTDAWRLIEPGDLLTWEELKKIPSLDRNYSTIRNLLNSVNPLVGCVPFIVV 1361

Query: 1322 YLSDLTLNAEKSNWIVPNQVLNYSKFQTNVQIVKNFIQRAQWSKFYQFSVNEELLSKCV 1380
            YLSDL+ NAEK +WI+ ++V+NY+KF TNVQIVKNFIQR QWSKFY F VN ELLSKCV
Sbjct: 1362 YLSDLSANAEKKDWILEDKVVNYNKFDTNVQIVKNFIQRVQWSKFYTFKVNHELLSKCV 1420

 Score =  323 bits (828), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 255/725 (35%), Positives = 365/725 (50%), Gaps = 84/725 (11%)

Query: 16  VFSEREYYPTPSAEKMSYLKRGANTLIIKTDLHALIIKLTSPLDPIDYPFLADFFLSYRK 75
           +FS+++YYPTPS+  +SY     +  +   DL ALI+ L+SPL+ +DY   ADFFL YR 
Sbjct: 3   IFSQKDYYPTPSSNVISYESDCVSKPVNSADLPALIVHLSSPLEGVDYNASADFFLIYRN 62

Query: 76  FLAPNELLRLLESRLQWAFNE--SLQADKERQKIGQVTSVRTFVVIRHWILNYFAQDFLA 133
           F+ P +L  LL  R +W   E  +  A  +R++IG+V  VRTFV++RH ILNYF QDFL 
Sbjct: 63  FITPQDLHDLLIYRFRWCIREITTNAAKAKRRRIGEVALVRTFVLLRHSILNYFVQDFLP 122

Query: 134 DQELRRQFVDSINSLSWGATEMAPKSIRGIVVSIKKSWVLCLKLMWEDVTFENSPSNV-- 191
           +  LR + ++ +N       E  PK I   ++++KK+WV C KL+WE++   N P  +  
Sbjct: 123 NITLRLRLIEFLND---KHIEQYPKIISSCIINLKKNWVHCSKLVWENIEL-NEPDKLDF 178

Query: 192 DEWLDFKIQDIDTQSSTKEGGRRLSFYALQSRQNPDFRNRSVLSLYVGIENFQLPENSAQ 251
           D WL + ++D     S  + G RLS YA QS  +PDFRN+SVLSLY   + F+LPE    
Sbjct: 179 DAWLHYSLKDFTQLESLHKRGSRLSIYARQSFASPDFRNQSVLSLYKTSDVFRLPEKLQS 238

Query: 252 INRRLGAKIKQRTASMFLFPQDNLPSARLKXXXXX----------XXXXXXXXXXXXXXX 301
            N    +   QR+ SM LFP DN  +   K                              
Sbjct: 239 SN----SSKNQRSPSMLLFP-DNTSNVYSKHRIAKEPSVDNESEDMSDSKQKISHLSKVT 293

Query: 302 XXPDVMKDLQYPTSPSVDKVIPPTPAKKVEFILRSSYLPSD-----------SPTEEADP 350
               +MK + YP+S +VDK++PPTPAKKVEFIL S Y+P D           S T   D 
Sbjct: 294 LVSTLMKGVDYPSSYAVDKIMPPTPAKKVEFILNSLYIPEDLNEQSGTLQGTSTTSSLDN 353

Query: 351 ANAKTDKVKKHNNHSYNKGMVGLLSKWKKNHNLR-SENHKAHSES--PKNQ--EIENLIK 405
            +    +    +    ++  +GLL+KW KNHN   S N K    +  P NQ  E++  +K
Sbjct: 354 NSNSNSRSNTSSMSVLHRSAIGLLAKWMKNHNRHDSSNDKKFMSAIKPANQKPEMDAFVK 413

Query: 406 LVFSITSLEHKQDQSEDAA--NALSSKFDILSARTIDEVEYFLAIENDLLSKIR-----N 458
            V SI+SL  K  + E+    N+ SSKFDILSARTIDEVE  L ++N L+ K++     N
Sbjct: 414 YVVSISSLNRKSSKEEEEEFLNSDSSKFDILSARTIDEVESLLHLQNQLIEKVQTHSNNN 473

Query: 459 RGGLFNF-----ERIH-----HENPQTQSPEAVSAMDNLNLYKTXXXXXXXXXXXXKTL- 507
           RG   N      E IH      +N    S +  SAMDNL+LY+T             TL 
Sbjct: 474 RGPTVNVDCERREHIHDIKILQQNSFKPSNDNFSAMDNLDLYQTVSSIAQSVISLTNTLN 533

Query: 508 ------QYHHAVSPSAAAQERRRVKSAEVFFRNNSVLNFTDA---LLTRDIKTPATGNDG 558
                 + +   SPS  A +RR+VKS    + N    +++     L  +D  +  T  +G
Sbjct: 534 KQLQNNESNMQPSPSYDALQRRKVKSLTTAYYNKMHGSYSAESMRLFDKDNSSSRTDENG 593

Query: 559 PRKLVFH--GPMGMERIRKEEFRFHHYKTPTKTGLTSHSTPSVMQSVNTKEVNTEDRSRY 616
           P++L+FH       E I     R  ++    K+ +TS    +V+  +  KE +  + SR 
Sbjct: 594 PQRLLFHETDKTNSEAITNMTPRRKNHSQSQKS-MTSSPLKNVLPDL--KESSPLNDSR- 649

Query: 617 SPTKGIRISSVITEVD-----DTFSKHENSMNSAQSVNSVSLDTELP-LKRKEGLKNLRE 670
             T+ I  S            DT +K       ++ V ++  +T+ P LK K G  NLRE
Sbjct: 650 EDTESITYSYDSELSSSSPPRDTVTK------KSRKVRNIVNNTDSPTLKTKTGFLNLRE 703

Query: 671 FNFEE 675
           F FE+
Sbjct: 704 FTFED 708

>ACR292W [1339] [Homologous to ScYAL024C (LTE1) - SH]
            complement(891524..895843) [4320 bp, 1439 aa]
          Length = 1439

 Score =  451 bits (1161), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 245/483 (50%), Positives = 322/483 (66%), Gaps = 47/483 (9%)

Query: 917  AEFSGPKDSLLGPEGDDREANKYLFSPDSDSLDFASPEKNMEDLKNKFIS---PIVSEAP 973
            + F+   DSLLG   ++   NKY+FSP   + D ASP+K+ME LK KF++   P V   P
Sbjct: 969  SRFASQPDSLLGYINEN--GNKYIFSPGETAED-ASPKKDMETLKTKFMTTKEPPV--CP 1023

Query: 974  SLNEEQTSREFDDDQEGEPNDSQLSSTTQPERLPHEHHRRSITPIVSPYKANDSRLNKFA 1033
            S N+   +      +E  P+          ER+  E+       +  P            
Sbjct: 1024 SGNDADLALIISKLKETNPS---------AERIETENPNDDANNLTPPA----------T 1064

Query: 1034 KLTDESLHGDPVNVALMKLEGTFSKENKEKGENDA-------------DIEKL---KERR 1077
              ++     DPV VALMKLEGTF+K  KE  +N A             ++EKL   K R 
Sbjct: 1065 SSSNNENSSDPVAVALMKLEGTFAKPAKE--DNTASKLNSPRSSVLAKEVEKLDFQKWRF 1122

Query: 1078 LTGLGSRERRSFLIEKRRQIKSEIPLTPRSKEKVKQEEEVRATDLEITELLENYKIQDKR 1137
             +     +R+S  IE+RR + ++I  +  +++   +E+  + +D EI ELLE YK+QD R
Sbjct: 1123 PSSKTMNKRQSMFIERRRTM-TDI-FSSATEDTSSEEQSPKLSDREIRELLETYKLQDPR 1180

Query: 1138 LNVSNAQQHVPFILMYDSRSIAEQLTLVEREILNEIXXXXXXXXXXXREVPSVTSWLQLL 1197
            LN+ N + HVPFILMYDS SIA+Q+TL+ERE++NEI           + +P VTSWLQLL
Sbjct: 1181 LNIKNVEHHVPFILMYDSCSIAKQMTLIEREVMNEIDWKDLLDLNMKKSLPRVTSWLQLL 1240

Query: 1198 LQNERLSGIDLAIARFNLTVDWIISEIVMTCDNKLRRNTIQRLIHVAEHCKTFQNYNTLM 1257
            L NE LSGIDLAIARFNLTVDWIISE+VMT D KLRRN IQRLIHVAEHC+ +QNYNT+M
Sbjct: 1241 LHNEELSGIDLAIARFNLTVDWIISELVMTTDIKLRRNAIQRLIHVAEHCRMYQNYNTVM 1300

Query: 1258 QIILALSSLVVQSYRDAWRLIEPGDLLTWESLKNVPSLEKNYYNIRMLLNDINPIKGCIP 1317
            +I+LAL+S+VVQ +  +WRLIEP D+LTWE LK++PSL++NY+N+R LLN I+PIKGCIP
Sbjct: 1301 EIVLALNSVVVQKFTSSWRLIEPADMLTWEHLKSIPSLDRNYHNVRNLLNSIDPIKGCIP 1360

Query: 1318 FIVVYLSDLTLNAEKSNWIVPNQVLNYSKFQTNVQIVKNFIQRAQWSKFYQFSVNEELLS 1377
            F+VVYLSDL LN+EK +WIVPN+++NY+KFQTNVQIVKNFIQR QW++FY    +E+LLS
Sbjct: 1361 FLVVYLSDLALNSEKRDWIVPNEIVNYNKFQTNVQIVKNFIQRVQWARFYDIRADEDLLS 1420

Query: 1378 KCV 1380
            KCV
Sbjct: 1421 KCV 1423

 Score =  346 bits (888), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 256/723 (35%), Positives = 368/723 (50%), Gaps = 63/723 (8%)

Query: 13  GTSVFSEREYYPTPSAEKMSYLKRGANTLIIKTDLHALIIKLTSPLDPIDYPFLADFFLS 72
           G +VFS  +YYP PS   ++Y   G    I+  D+ AL+  LTSP+D ++Y   ADFFL 
Sbjct: 12  GRAVFSAADYYPAPSGRVITYAAGGRGRQIMAADVTALVAALTSPVDGVEYELFADFFLV 71

Query: 73  YRKFLAPNELLRLLESRLQWAFNESLQADKERQKIGQVTSVRTFVVIRHWILNYFAQDFL 132
           YR FL    LL LLE+R  W+  E      + + +G++T VRTFV++RHW++NYFAQDFL
Sbjct: 72  YRNFLEARRLLELLEARFDWSLGEIGAGRAKARVVGEITLVRTFVLLRHWVINYFAQDFL 131

Query: 133 ADQELRRQFVDSINSLSWGATEMAPKSIRGIVVSIKKSWVLCLKLMWEDVTFEN--SPSN 190
            D  LR +F+  +N L   A    PK +  IVVS+KK+W   ++L+W+D+  E      +
Sbjct: 132 PDVALRERFLAFVNGLGGAAGGTRPKIVANIVVSLKKTWAYTVRLIWDDLDLEREFELRS 191

Query: 191 VDEWLDFKIQDIDTQSSTKEG---GRRLSFYALQSRQNPDFRNRSVLSLYVGIENFQLPE 247
            D WL F+I D+ TQ  T+ G     RLSFYA QS  NP FRN SVLSLY   +NFQLP 
Sbjct: 192 ADAWLQFQIPDV-TQLKTEAGLQRDSRLSFYARQSSTNPSFRNESVLSLYRPKDNFQLPV 250

Query: 248 NSAQINRRLGAKIKQRTASMFLFPQDNL--PSARLKXXXXX-----XXXXXXXXXXXXXX 300
            +   N + G +IK+RTASMFL+PQD+L  PS   K                        
Sbjct: 251 RNNDYNIKQGTRIKKRTASMFLYPQDSLNAPSGNQKPQCSLEPPFPAHSHVRKISHISKV 310

Query: 301 XXXPDVMKDLQYPTSPSVDKVIPPTPAKKVEFILRSSYLPSDSPTEEADPANAKTDKVKK 360
               +V+K++ YPTSP+V+   PPTP+KK+EF + S+Y+P  +     +P+  K  K + 
Sbjct: 311 TNVSNVIKEVAYPTSPAVESFFPPTPSKKLEFTVNSTYVPPAAAECSREPSAQK--KPRS 368

Query: 361 HNNHSYNKGMVGLLSKWKKNHNLRSENHKAHSE-SPKNQEIENLIKLVFSITSLEHKQDQ 419
            N +   + + GLLSKW+ NH  R   HKA    S     ++NLIK VFSI+SLE  +  
Sbjct: 369 PNGY---RAVTGLLSKWRMNHLSR---HKACDRTSTVEPAMDNLIKYVFSISSLESPKGD 422

Query: 420 SEDAANALSSKFDILSARTIDEVEYFLAIENDLLSKIRNRGGLF----------NFERIH 469
            ++      SKFDILSARTI+EVE+ + +EN++L K+    G             F  + 
Sbjct: 423 IQEEREISPSKFDILSARTIEEVEHLITVENEVLQKVTAHEGKVPITSSSAREARFPPLL 482

Query: 470 HENPQT-QSP----EAVSAMDNLNLYKTXXXXXXXXXXXXKTL-QYHHAVSPSAAAQERR 523
           +E P   Q+P    +  S +DNLNLY+T            +T  Q    V+       R+
Sbjct: 483 NEAPLLDQAPLGNGQEYSVIDNLNLYRTVSTIATSVIKLTRTASQRQTKVTLPPPPPLRQ 542

Query: 524 RVKSAEVFFRNNSVLNFTDALLTRDIKTPATGNDGPRKLVFHGPMG----------MERI 573
           R  S   F  ++S +  +D+ L RD      G    +  +   P+           ++  
Sbjct: 543 RPTSLSAFRGSSSRMLLSDS-LRRD------GYQNSKASLHLRPLASADENAEGSSVQAS 595

Query: 574 RKEEFRFHHY---KTPTKTGLTSHSTPSVMQSVNTKEVNTEDRSRYSPTKGIRISSVITE 630
              +  FH +   KTPT     + +      S  T  V+T+      P+    I +  ++
Sbjct: 596 NPPQVIFHTHALIKTPTDKVFDAKAVEDT--SPKTSLVSTQVTDARPPSYESTI-TYDSD 652

Query: 631 VDDTFSKHENSMNSAQSVNSVSLDTELP-LKRKEGLKNLREFNFE-EVADHPEVTDQQEV 688
           + D   +  N+ N  ++ N  +LDT  P L RK    NLREF FE   +  P     QE 
Sbjct: 653 LQDITMRDYNTSNQTENHNDGTLDTNQPILNRKTNHSNLREFLFEASTSGSPAAHTTQEP 712

Query: 689 TDQ 691
           TD+
Sbjct: 713 TDE 715

>Scas_505.3
          Length = 1364

 Score =  443 bits (1139), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 256/574 (44%), Positives = 356/574 (62%), Gaps = 70/574 (12%)

Query: 834  TSVSTQLLFTSQNNSPNKMDLKELLDNDRFPPGNKLIRLSSIPSMHSIV-------SGDS 886
            +SV+T  LF S+ NSP K+  +           NK +RLS+ PS++SI+          S
Sbjct: 817  SSVATDNLFNSRKNSPKKVTAE-----------NK-VRLSTTPSIYSILDDSSLSSGNTS 864

Query: 887  FS-----SFQTTNT--FGLHSTNSKTGARAVVTPSMDAE-FSGPKDSLLGPEGDDREANK 938
            ++     S Q TN     L         + V++  + ++  SG  +  L   G +  +NK
Sbjct: 865  YNDPARDSMQFTNDKRIDLREVFHNGSVQNVISNDLSSDAISGLSE--LKDNGINGVSNK 922

Query: 939  YLFSPDSDSLDFASPEKNMEDLKNKFISPIVSEAPSLNEEQTSREFDDDQEGEPNDSQLS 998
            YLFSP+ D+ D  SP K++E LKNKF+           EE++    D  QE     +   
Sbjct: 923  YLFSPEEDNTDLISPGKDVEVLKNKFL------KNETFEEESESIIDGIQEASDEGA--- 973

Query: 999  STTQPERLPHEHHRRSITPIVSPYKANDSRLNKFAKLTDESLHGDPVNVALMKLEGTF-S 1057
                   +P+                +  +L   A + D++  GDP+++A+MKLEGT+ +
Sbjct: 974  -------MPN-------------VDLDKEKLKDIADIPDDTGSGDPISIAMMKLEGTYKT 1013

Query: 1058 KENKEKGENDA--------DIEKLKERRLTGLGS---RERRSFLIEKRRQIKSEIPLTPR 1106
             ++  K   D+        ++E L  ++L         +R+S +IE+RRQ    IP TP+
Sbjct: 1014 NDDDNKTHEDSSSVQDLIKEVEMLNLKKLPTFPKSPLEKRKSLMIERRRQTIMNIPFTPQ 1073

Query: 1107 SKEKVKQEEEVRATDLEITELLENYKIQDKRLNVSNAQQHVPFILMYDSRSIAEQLTLVE 1166
            + E+    E+   + L++  L+ NY++QD  L +SN + H+PFILMYDS+SIAEQ+TL+E
Sbjct: 1074 NSEEGLAIEDKCVSPLQVQTLVMNYEVQDSSLQISNNEHHIPFILMYDSKSIAEQMTLIE 1133

Query: 1167 REILNEIXXXXXXXXXXXREVPSVTSWLQLLLQNERLSGIDLAIARFNLTVDWIISEIVM 1226
            +E+L+EI            +  +VTSWLQLL+QNE LSG+DLAIARFNLTVDWI+SEI +
Sbjct: 1134 KELLSEIDWKDLLNLKIQYKGKAVTSWLQLLIQNETLSGVDLAIARFNLTVDWIVSEITL 1193

Query: 1227 TCDNKLRRNTIQRLIHVAEHCKTFQNYNTLMQIILALSSLVVQSYRDAWRLIEPGDLLTW 1286
            T D K+RRNTIQR IHVA++C+ FQNYNTLM+IILALSS+VVQ + DAWRLIEPGD+L W
Sbjct: 1194 TRDVKMRRNTIQRFIHVAQYCREFQNYNTLMEIILALSSIVVQKFTDAWRLIEPGDMLLW 1253

Query: 1287 ESLKNVPSLEKNYYNIRMLLNDINPIKGCIPFIVVYLSDLTLNAEKSNWIVPNQVLNYSK 1346
            E LK++PSL++NY  IR LLN ++P KGCIPFIVVYLSDL+LN+EK NWIV  +V+NY K
Sbjct: 1254 EELKHIPSLDRNYSTIRNLLNSLDPKKGCIPFIVVYLSDLSLNSEKRNWIVDRKVVNYHK 1313

Query: 1347 FQTNVQIVKNFIQRAQWSKFYQFSVNEELLSKCV 1380
            F+T+VQIVKNFIQR QW+KFY   V+ ELLSKCV
Sbjct: 1314 FETSVQIVKNFIQRVQWAKFYNIEVDHELLSKCV 1347

 Score =  368 bits (944), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 262/707 (37%), Positives = 378/707 (53%), Gaps = 73/707 (10%)

Query: 16  VFSEREYYPTPSAEKMSYLKRGANTL---IIKTDLHALIIKLTSPLDPIDYPFLADFFLS 72
           +FS  +YYP PS   ++Y +   N +   + K D+ ALI  L+SP+DP+DY   +DFFL 
Sbjct: 10  IFSADDYYPVPSTSVITYNESRTNKIRKTVSKADIIALITYLSSPIDPVDYTIFSDFFLI 69

Query: 73  YRKFLAPNELLRLLESRLQWAFNESLQ---ADKERQKIGQVTSVRTFVVIRHWILNYFAQ 129
           YR FL+PNEL  LL  R +W   E L+    D E+QK+G+V  +RTFV++RH ILNYF Q
Sbjct: 70  YRDFLSPNELHELLILRFRWCILEILENKNVDVEKQKVGEVALIRTFVLLRHSILNYFVQ 129

Query: 130 DFLADQELRRQFVDSINSLSWGATEMAPKSIRGIVVSIKKSWVLCLKLMWEDVTFENSPS 189
           DFL D  LR   ++ +N       + +P+ + G +V++K++W+   K  WE++ F N PS
Sbjct: 130 DFLPDSHLRYMLLNFLND---NVYQTSPRIVSGSIVNLKRAWIHSAKQTWENIPF-NEPS 185

Query: 190 NVD--EWLDFKIQDIDTQSSTKEGGRRLSFYALQSRQNPDFRNRSVLSLYVGIENFQLPE 247
           +VD  EWL F+I+D+       + G RLS YA+Q   +PDFRNRSVLSLY   +NF+LPE
Sbjct: 186 SVDFNEWLLFEIKDVIQMEEQLKRGSRLSEYAIQGSSSPDFRNRSVLSLYNSTDNFKLPE 245

Query: 248 NSAQINRRLGAKIKQRTASMFLFPQDN-------LPSAR--LKXXXXX-XXXXXXXXXXX 297
            S   N     + KQ TASM L+P DN       +P  +  LK                 
Sbjct: 246 -SLDFN---SNRTKQ-TASMMLYPNDNSNIPKIPIPKGKEPLKITLINDNKNDIRKISHL 300

Query: 298 XXXXXXPDVMKDLQYPTSPSVDKVIPPTPAKKVEFILRSSYLPSDSPTEEADPANAKTDK 357
                   V+KD+ YPTSP+++++IPPTPAKKVEFIL S Y+P D+     D    K+  
Sbjct: 301 SKIAHMSTVIKDVDYPTSPAINRIIPPTPAKKVEFILNSLYIPEDNDETIEDNPRVKSTP 360

Query: 358 VKKHNNHSYNKGMVGLLSKWKKNHNLRSENHKAHS-----ESPKNQ-EIENLIKLVFSIT 411
               ++    +G +GLL++WK+NH   S   K  +      +P ++ +++N +K V SIT
Sbjct: 361 PPIQSSL-LQRGAIGLLARWKRNHTRNSRKEKIKTTQSGVNTPISKPDMDNFVKYVISIT 419

Query: 412 SLEH-KQDQSEDAANALSSKFDILSARTIDEVEYFLAIENDLLSKIRNRGGL--FNFERI 468
           SLE+ K   S +  + ++SKFDILSARTIDEVEY +++EN+L  K+R +  L   N + I
Sbjct: 420 SLENTKSHASGEINDMITSKFDILSARTIDEVEYLISLENELQQKVRGQANLNNNNLKSI 479

Query: 469 HHENPQTQSPEA----VSAMDNLNLYKTXXXXXXXXXXXXKTLQYHHAV----SPSAAAQ 520
             EN     P       SAMDNL+LYKT             TL     +    SPS +A 
Sbjct: 480 GLENTMPFEPPKDTANFSAMDNLDLYKTVSSLAQSVISLSNTLNKSTKLKIVNSPSLSAL 539

Query: 521 ERRRVKSAEVFFR----NNSVLNFTDALLTRDIKTPATGNDGPRKLVFHGPMGMERIRKE 576
           ERR V S+         ++S +   D L+  +I  P   NDGP++LVFH          +
Sbjct: 540 ERRMVMSSFPALNGKVSSSSKIGIEDELVI-NITPPRAKNDGPQRLVFHD---------D 589

Query: 577 EFRFHHYKTPTKTGLTS---HSTP--SVMQSVN----TKEVNTEDRSRYSPTKGIRISSV 627
                  +TPTK+   S   HS+P  +V+ ++N    +  V ++D S  S    I   S+
Sbjct: 590 GSTLSLPQTPTKSNRKSNIRHSSPLKNVLPNLNEVDLSDSVCSDDESFVS---TISYDSL 646

Query: 628 ITEVDDTFSKHENSMNSAQSVNSVSLDTELPLKRKEGLKNLREFNFE 674
           ++           S   ++ +     + E  LK+K   KNLREF FE
Sbjct: 647 LSSKSFKHKSSRRSNLYSRPL--TFKNEEQTLKKKTASKNLREFTFE 691

>CAGL0G06226g 592179..596135 similar to sp|P07866 Saccharomyces
            cerevisiae YAL024c LTE1, start by similarity
          Length = 1318

 Score =  400 bits (1029), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 219/456 (48%), Positives = 295/456 (64%), Gaps = 38/456 (8%)

Query: 936  ANKYLFSPDSDSLDFASPEKNMEDLKNKFISPIVSEAPSLNEEQTSREFDDDQEGEPNDS 995
            ANKYLFSPD++SLD ASP KN+EDLK++F+      A S             Q G   ++
Sbjct: 871  ANKYLFSPDNESLDIASPVKNVEDLKSRFLKGNNQSASS------------SQIGASINT 918

Query: 996  QLSSTTQPERLPHEHHRRSITPIVSPYKANDSRLNKFAKLTDESLHGDPVNVALMKLEGT 1055
             +++T +   +             S +  N   L      ++E L  DPV +A+MKLEGT
Sbjct: 919  SVTATPKNNDM-----------FGSDFDKNG--LKNIMTASEEKLSKDPVELAMMKLEGT 965

Query: 1056 FSKENKEKGEN---DADIEK----LKERRLTGLG---SRERRSFLIEKRRQIKSEI-PLT 1104
            F K+NK  G N    +D+EK    L    L  +    S +R+S ++++RRQ    I P  
Sbjct: 966  F-KKNKS-GNNTGYSSDLEKEVDILNIANLPEMNANPSDKRKSLMLDRRRQTMFNIGPSI 1023

Query: 1105 PRSKEKVKQEEEVRATDLEITELLENYKIQDKRLNVSNAQQHVPFILMYDSRSIAEQLTL 1164
              S    +  +E   TD +I  L+  Y I D+ L   N   HVPFILMY+S+ +A+Q TL
Sbjct: 1024 YPSNTNDEGYDEESITDDKIWSLIAQYHIDDENLLAKNHANHVPFILMYESKDVAQQFTL 1083

Query: 1165 VEREILNEIXXXXXXXXXXXREVPSVTSWLQLLLQNERLSGIDLAIARFNLTVDWIISEI 1224
            +EREIL+EI            + P++TSWLQLL+QN+  +GIDLA+ARFNLTVDW ISEI
Sbjct: 1084 IEREILSEIDWKDLLDIKLLYKGPNLTSWLQLLIQNQEFTGIDLAVARFNLTVDWAISEI 1143

Query: 1225 VMTCDNKLRRNTIQRLIHVAEHCKTFQNYNTLMQIILALSSLVVQSYRDAWRLIEPGDLL 1284
            V+T D K+RRNTI+R IHVAEHC+  QN+NT+MQIILAL+S+VVQ + +AWRLIEPGD+L
Sbjct: 1144 VLTTDLKMRRNTIERFIHVAEHCRKLQNFNTMMQIILALNSVVVQKFTEAWRLIEPGDML 1203

Query: 1285 TWESLKNVPSLEKNYYNIRMLLNDINPIKGCIPFIVVYLSDLTLNAEKSNWIVPNQVLNY 1344
             WE L+ +P+L+ NY+ +R ++  ++P+KGCIPFIVVYLSDLT+N+EK+ WIV  +V+NY
Sbjct: 1204 LWEDLRKIPALDWNYHALRTMMKTVDPLKGCIPFIVVYLSDLTINSEKNTWIVEKRVVNY 1263

Query: 1345 SKFQTNVQIVKNFIQRAQWSKFYQFSVNEELLSKCV 1380
            SKF T VQIVKNFIQ+ QWS FY     +ELLSKC+
Sbjct: 1264 SKFSTCVQIVKNFIQKVQWSSFYDIIPIQELLSKCI 1299

 Score =  273 bits (698), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 226/699 (32%), Positives = 343/699 (49%), Gaps = 70/699 (10%)

Query: 16  VFSEREYYPTPSAEKMSYL----KRGANTLIIKTDLHALIIKLTSPLDPIDYPFLADFFL 71
           +FS+R+YYP PS + + Y     K+     +I+ D+ ++I+ L+SP+D +DY   +DFFL
Sbjct: 3   IFSQRDYYPIPSDDVIKYKHMVHKKWNKNEVIQADIPSIIVHLSSPVDSVDYKGFSDFFL 62

Query: 72  SYRKFLAPNELLRLLESRLQWAFNESLQADKERQ-----KIGQVTSVRTFVVIRHWILNY 126
            YR FL P EL   L  R +W   E      +R      +IG+V  +RTFV++RH ILN+
Sbjct: 63  FYRNFLTPAELYDYLILRFKWCMREIESYQHQRSGDNQLRIGKVALIRTFVLLRHGILNH 122

Query: 127 FAQDFLADQELRRQFVDSINSLSWGATEMAPKSIRGIVVSIKKSWVLCLKLMWEDVTFEN 186
           FA DFL ++ LR + +   N       +   K I   ++S+KK+W+  +KL W++V F N
Sbjct: 123 FADDFLLNENLRLRLISFFNE----DIKSDMKVIVSCLISLKKAWLHAMKLNWDNVLF-N 177

Query: 187 SP--SNVDEWLDFKIQDIDTQSSTKEGGRRLSFYALQSRQNPDFRNRSVLSLYVGIENF- 243
            P  S   +W+D+KI+D+      ++   R S++ +QS  NPD RNRS+LS+Y   +NF 
Sbjct: 178 EPAFSAYTDWIDYKIKDVSQLDMAQKRNSRFSYHGIQSISNPDMRNRSILSIYKS-DNFD 236

Query: 244 -QLPENSAQINRRLGAKIKQRTASMFLFPQDNLPSARLKXXXXXXXXXXXXXXXXXXXXX 302
             +  NS +I+R        RT S  LF +D+  S                         
Sbjct: 237 HMVQSNSNKISR-------NRTPSTLLFQKDSSNSEMATVYSNRKGAQKKTIALPNILTS 289

Query: 303 XPD-------------VMKDLQYPTSPSVDKVIPPTPAKKVEFILRSSYLPSDSPTEEA- 348
             D             +++D +   S  V+K+IP TPAKKVE IL + Y P    +E   
Sbjct: 290 ELDRKDVMSNVTRMSHIIQDAKTLRSSDVNKIIPSTPAKKVELILNTIYSPDCLESENIQ 349

Query: 349 DPANAKTDKVKKHNNHSYNKGMVGLLSKWKKNHNLRSENHK--AHSESPKNQEIENLIKL 406
           +  N  T   +K    S+ KG++ LL++WKKNH +     +      + +  E++N +K 
Sbjct: 350 ESLNQDTSSTQK----SFPKGIMSLLARWKKNHKIADPKIRKPVGFTNKREAELDNFVKY 405

Query: 407 VFSITSLEHKQDQSEDAANALSSKFDILSARTIDEVEYFLAIENDLLSKI----RNRGGL 462
           V SI+SL +K++  +     L SKFDILSARTIDEVEY   +E+ LL+++    +    L
Sbjct: 406 VISISSLTNKEEDLKRLNENLDSKFDILSARTIDEVEYLFRLESKLLAQLSTMQKTTRTL 465

Query: 463 FNFERIHHENPQTQSPEAVSAMDNLNLYKTXXXXXXXXXXXXKTLQYHHAVSPSAAAQER 522
            N E      P     + +SAMDNL+L++T             ++   + +S  +   +R
Sbjct: 466 SNDEFNDVNVPNNIDSKQISAMDNLDLFRTVNGVARSVISLTNSVNKLNNLSDHSVL-DR 524

Query: 523 RRVKSAEVFFRNN----SVLNFTDALLTRDIKTPATG-NDGPRKLVFHGPMGMERIRKEE 577
           RRVKS+   F N     S L+    L   D  +  +  +D P+KLVFH  +       +E
Sbjct: 525 RRVKSSMPNFYNRERSLSGLSNYAGLQFYDASSEMSAEDDKPQKLVFHDGV-------DE 577

Query: 578 FRFHHYKTPTKTGLTSHSTPSVMQSVNTKEVNTEDRSRYSPTKGIRISSVITEVDDTFSK 637
            + H  +T TK G  S+S+P      N  E  + D    S   G   S V    D   S+
Sbjct: 578 LKNHLTQTFTKPGSISNSSPLKKVLPNLFEHPSVD----SLASGDACSYVT--YDSQLSQ 631

Query: 638 HENSMNSAQSVNSVSLDTELP-LKRKEGLKNLREFNFEE 675
                 S +   S   + E P LK+K    NLREF FE+
Sbjct: 632 MGTVKKSMKDETSRYSNYEGPVLKKKVAYDNLREFTFED 670

>YLR310C (CDC25) [3699] chr12 complement(752226..756995)
            Guanine-nucleotide exchange protein for Ras1p and Ras2p,
            has an SH3 domain [4770 bp, 1589 aa]
          Length = 1589

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 76/153 (49%), Gaps = 7/153 (4%)

Query: 1210 IARFNLTVDWIISEIVMTCDNKLRRNTIQRLIHVAEHCKTFQNYNTLMQIILALSSLVVQ 1269
            IA  N   +++   IV   D K R    Q  + VA+HCK   N++++  I+ AL S  + 
Sbjct: 1351 IANANTLTNFVSHTIVKQADVKTRSKLTQYFVTVAQHCKELNNFSSMTAIVSALYSSPIY 1410

Query: 1270 SYRDAWRLI--EPGDLLTWESLKNVPSLEKNYYNIRMLLNDINPIKGCIPFIVVYLSDLT 1327
              +  W L+  E  DLL  ++L N+   ++N+   R LL  +  +  C+PF  VYLSDLT
Sbjct: 1411 RLKKTWDLVSTESKDLL--KNLNNLMDSKRNFVKYRELLRSVTDV-ACVPFFGVYLSDLT 1467

Query: 1328 LNAEKSNWIVPN--QVLNYSKFQTNVQIVKNFI 1358
                 +   + N   ++N+SK      IV+  I
Sbjct: 1468 FTFVGNPDFLHNSTNIINFSKRTKIANIVEEII 1500

>YLL016W (SDC25) [3403] chr12 (112846..115992) Protein of unknown
            function [3147 bp, 1048 aa]
          Length = 1048

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 83/185 (44%), Gaps = 22/185 (11%)

Query: 1150 ILMYDSRSIAEQLTLVEREILNEIXXXXXXXXXXXREVPSVTSWLQLLLQNERLS----- 1204
            IL  D    A QLT++E EI  EI               ++   LQ + +N+        
Sbjct: 744  ILAVDPVLFATQLTILEHEIYCEI---------------TIFDCLQKIWKNKYTKSYGAS 788

Query: 1205 -GIDLAIARFNLTVDWIISEIVMTCDNKLRRNTIQRLIHVAEHCKTFQNYNTLMQIILAL 1263
             G++  I+  N   ++I   +V   D   R   +   I +AE+C+ F N++++  II AL
Sbjct: 789  PGLNEFISFANKLTNFISYSVVKEADKSKRAKLLSHFIFIAEYCRKFNNFSSMTAIISAL 848

Query: 1264 SSLVVQSYRDAWRLIEPGDLLTWESLKNVPSLEKNYYNIRMLLNDINPIKGCIPFIVVYL 1323
             S  +      W+ + P      +SL  +   +KN+ N R  L  ++    C+PF  VYL
Sbjct: 849  YSSPIYRLEKTWQAVIPQTRDLLQSLNKLMDPKKNFINYRNELKSLHS-APCVPFFGVYL 907

Query: 1324 SDLTL 1328
            SDLT 
Sbjct: 908  SDLTF 912

>Kwal_14.2313
          Length = 1517

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/175 (28%), Positives = 86/175 (49%), Gaps = 6/175 (3%)

Query: 1210 IARFNLTVDWIISEIVMTCDNKLRRNTIQRLIHVAEHCKTFQNYNTLMQIILALSSLVVQ 1269
            I+  N   +++   IV   + K R    Q  I VAEHC    N++++  I+ AL S  + 
Sbjct: 1284 ISSANSLTNYVSFAIVKQTNTKKRARVTQHFISVAEHCYELNNFSSMTAIVSALYSSPIF 1343

Query: 1270 SYRDAWRLIEPGDLLTWESLKNVPSLEKNYYNIRMLLNDINPIKGCIPFIVVYLSDLTLN 1329
              + +W L+        E+L  +    KN+   R  L  I     C+PF  VYLSDLT  
Sbjct: 1344 RLKKSWALVPEESQKVLENLNTLMDPAKNFATYRNWLKTIQDT-ACVPFFGVYLSDLTFI 1402

Query: 1330 AEKS-NWI-VPNQVLNYSKFQTNVQIVKNF--IQRAQWSKFYQFSVNEELLSKCV 1380
            AE + N++   ++++N+SK    V+I+K     Q  ++ KF ++   +  + +C+
Sbjct: 1403 AEGNPNYLHRSSEIINFSKRVRIVEILKEIASYQSIRY-KFKRYDDVQAFIGECM 1456

>CAGL0E03476g complement(318956..323650) similar to sp|P04821
            Saccharomyces cerevisiae YLR310c CDC25 GDP/GTP exchange
            factor for RAS1P and RAS2P, start by similarity
          Length = 1564

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 78/154 (50%), Gaps = 9/154 (5%)

Query: 1210 IARFNLTVDWIISEIVMTCDNKLRRNTIQRLIHVAEHCKTFQNYNTLMQIILALSSLVVQ 1269
            IA  N   +++   IV   D + R   IQ  I VA+HCK   N++++  I+ AL S  + 
Sbjct: 1325 IANANSLTNYVSFTIVKHADVQKRAKLIQYFITVAQHCKELNNFSSMTAIVSALYSSPIY 1384

Query: 1270 SYRDAWRLIEPGDLLTWESLKNVPSL---EKNYYNIRMLLNDINPIKGCIPFIVVYLSDL 1326
              +  W L+ P +  T E L N+ SL   ++N+   R LL  +  +  C+PF  VYLSDL
Sbjct: 1385 RLKQTWNLV-PTE--TKEVLDNLNSLMDSKRNFIKYRELLRSVKDV-ACVPFFGVYLSDL 1440

Query: 1327 TLN-AEKSNWI-VPNQVLNYSKFQTNVQIVKNFI 1358
            T   A  S+++     ++N+ K      I++  +
Sbjct: 1441 TFTFAGNSDYLDGKTDIINFGKRSKIANIIEGIL 1474

>Sklu_2189.4 YLR310C, Contig c2189 8340-12920
          Length = 1526

 Score = 64.3 bits (155), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 50/158 (31%), Positives = 75/158 (47%), Gaps = 5/158 (3%)

Query: 1210 IARFNLTVDWIISEIVMTCDNKLRRNTIQRLIHVAEHCKTFQNYNTLMQIILALSSLVVQ 1269
            I+  N   +++   IV   D K R   IQ  I+VA HC    N+++L  II AL S  + 
Sbjct: 1289 ISNSNHLTNYVSFMIVKQTDIKKRIQLIQFFINVAAHCHELNNFSSLTAIISALYSSPIY 1348

Query: 1270 SYRDAWRLIEPGDLLTWESLKNVPSLEKNYYNIRMLLNDINPIKGCIPFIVVYLSDLTLN 1329
              +  W  +        E L  +    KN+   R LL  I     C+PF  VYLSDLT  
Sbjct: 1349 RLKRTWAAVPEEYKKLLEELNTLMDSAKNFIRYRQLLKSIGDFP-CVPFFGVYLSDLTFT 1407

Query: 1330 AEKS-NWIVPNQVL-NYSKFQTNVQIVK--NFIQRAQW 1363
            A  + +++  N VL N+ K    ++I+K  +  QR+ +
Sbjct: 1408 ANGNPDFLHRNTVLVNFGKRVRILEILKEISVYQRSHY 1445

>KLLA0D09306g 783852..788465 weakly similar to sp|P04821 Saccharomyces
            cerevisiae YLR310c CDC25 GDP/GTP exchange factor for
            RAS1P and RAS2P, hypothetical start
          Length = 1537

 Score = 57.4 bits (137), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 59/121 (48%), Gaps = 1/121 (0%)

Query: 1210 IARFNLTVDWIISEIVMTCDNKLRRNTIQRLIHVAEHCKTFQNYNTLMQIILALSSLVVQ 1269
            I   N   D++   IV   D K R   +Q  I V+E C   +N++++  I+ AL S  + 
Sbjct: 1313 ITSSNHLTDFVSYTIVKETDLKKRAQILQFFIQVSEQCYNLKNFSSMTAIVSALYSSPIF 1372

Query: 1270 SYRDAWRLIEPGDLLTWESLKNVPSLEKNYYNIRMLLNDINPIKGCIPFIVVYLSDLTLN 1329
              +  +  +    L + + L  +    +N++  R LL  ++ +  C+PF  VYLSDLT  
Sbjct: 1373 RLKKTFDRLPKHILNSLDKLNTLMDSTRNFFRYRDLLKTVHDVP-CVPFFGVYLSDLTFT 1431

Query: 1330 A 1330
            A
Sbjct: 1432 A 1432

>Scas_621.1*
          Length = 1323

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 71/151 (47%), Gaps = 12/151 (7%)

Query: 1214 NLTVDWIISEIVMTCDNKLRRNTIQRLIHVAEHCKTFQNYNTLMQIILALSSLVVQSYRD 1273
            NLT +++   IV   +   R   I   I VA++C+   N++++  II AL S  V   + 
Sbjct: 1134 NLT-NFVSYTIVSNANISRRIQIITYFIAVAQYCRDINNFSSMTAIISALYSSPVYRLKK 1192

Query: 1274 AWRLIEPGDLLTWESLKNVPSLEKNYYNIRMLLNDINPIKGCIPFIVVYLSDLTLNAEKS 1333
             W L+          L  +    KN+   R LL  +  +  C+PF  VYLSDLT  A   
Sbjct: 1193 TWHLVPESSKALLRELNTLMDSTKNFIRYRQLLKSVRQVV-CVPFFGVYLSDLTF-AHTG 1250

Query: 1334 NWIVPN------QVLNYSKFQTNVQIVKNFI 1358
            N   P+      +++N+SK    V+I++  I
Sbjct: 1251 N---PDFLSGSTELINFSKRAKVVEIIEEVI 1278

>ADL038W [1703] [Homologous to ScYLR310C (CDC25 ) - SH; ScYLL016W -
            SH] complement(623312..627841) [4530 bp, 1509 aa]
          Length = 1509

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 66/144 (45%), Gaps = 3/144 (2%)

Query: 1214 NLTVDWIISEIVMTCDNKLRRNTIQRLIHVAEHCKTFQNYNTLMQIILALSSLVVQSYRD 1273
            N   +++   IV   D K R   +Q  I VAE C+   N++++  I  A+ S  +   + 
Sbjct: 1282 NHLTNYVSYMIVKQTDLKRRVQIVQYFIDVAETCRALNNFSSMTAITSAMLSSSIYRLKR 1341

Query: 1274 AWRLIEPGDLLTWESLKNVPSLEKNYYNIRMLLNDINPIKGCIPFIVVYLSDLTLNAEKS 1333
             W ++      + + +  +    KN+   R LL  +     C+PF  VYLSDLT  A  +
Sbjct: 1342 TWAMVHDNYKESLDRMNALMDSAKNFRKYRELLESLGDCP-CVPFFGVYLSDLTFTAGGN 1400

Query: 1334 NWIVPNQ--VLNYSKFQTNVQIVK 1355
               +     V+N++K    V ++K
Sbjct: 1401 PDYLKGTTGVINFAKRARIVNVLK 1424

>Scas_604.15
          Length = 1676

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 78/182 (42%), Gaps = 17/182 (9%)

Query: 1150 ILMYDSRSIAEQLTLVEREILNEIXXXXXXXXXXXREVPSVTSWLQLLLQNERLSGIDLA 1209
            +L  D    A+QLT+ E E+  EI                  +W            I   
Sbjct: 1365 LLDIDPYVYAQQLTIREHELYLEITMFECLDR----------AWGSKYCNMGGSRNISKF 1414

Query: 1210 IARFNLTVDWIISEIVMTCDNKLRRNTIQRLIHVAEHCKTFQNYNTLMQIILALSSLVVQ 1269
            I   N   +++   IV   D K R   IQ  I VAEHCK   N++++  I+ AL S  + 
Sbjct: 1415 IMNANSLTNFVSYTIVRHMDVKKRSKLIQYFITVAEHCKDLNNFSSMTAIVSALYSSPIF 1474

Query: 1270 SYRDAWRLIEPGDLLTWESLKNVPSL---EKNYYNIRMLLNDINPIKGCIPFIVVYLSDL 1326
              +  W  I P ++   +SLK + SL   ++N+   R  L  +  +   IPF  +YLSDL
Sbjct: 1475 RLKKTWSKI-PVEIK--KSLKKLNSLMDSKRNFIKYRESLKLVKDVPR-IPFFGIYLSDL 1530

Query: 1327 TL 1328
            T 
Sbjct: 1531 TF 1532

>Kwal_33.13598
          Length = 1412

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 76/169 (44%), Gaps = 25/169 (14%)

Query: 1206 IDLAIARFNLTVDWIISEIVMT-CDNKLRRNTIQRLIHVAEHCKTFQNYNTLMQIILALS 1264
            ID A    NL  +++I  IV +    K+R + +   +++A     F+N+NT+  I+ AL 
Sbjct: 1168 IDFA----NLLSNYVIESIVASKLTLKVRASRLTAWLNIALSALYFRNFNTVATIMTALQ 1223

Query: 1265 SLVVQSYRDAWRLIEPGDLLTWESLKNVPSLEKNYYNIRMLLNDI-------------NP 1311
            S ++      W  I    L  ++ L  +   +KNY   R+ L ++             +P
Sbjct: 1224 SHILSRVELVWENISEKYLELYKYLSKIIHPDKNYSIYRLKLRELATGFSIPESGGNRSP 1283

Query: 1312 IKGCIPFIVVYLSDLTLNAEK------SNWIVPNQVLNYSKFQTNVQIV 1354
            I   +PF  ++L DLT   E        +   PN+++N  KF    +I+
Sbjct: 1284 IP-IVPFFALFLQDLTFIHEGIHDFRDPSSFRPNKLINIDKFFRTTKII 1331

>CAGL0D06512g complement(617453..621379) some similarities with
            sp|P04821 Saccharomyces cerevisiae YLR310c CDC25 or
            sp|P14771 Saccharomyces cerevisiae YLL016w SDC25,
            hypothetical start
          Length = 1308

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 84/209 (40%), Gaps = 19/209 (9%)

Query: 1125 TELLENYKIQDKRLNVSNAQQHVPF-------ILMYDSRSIAEQLTLVEREILNEIXXXX 1177
            TE+LE Y    KR+  SN      F       IL   + ++A+QL L+E  +  +I    
Sbjct: 957  TEILE-YNNDLKRIGFSNLVHDAKFTANVYESILDIPAENVAQQLALIEENLYEKITIFD 1015

Query: 1178 XXXXXXXREVPSVTSWLQLLLQNERLSGIDLAIARFNLTVDWIISEIVMTCDNKLRRNTI 1237
                     +  V    Q      +   I   I+  N    ++  +I+       R   I
Sbjct: 1016 C--------LDRVWGCKQCDFGGSK--NISEFISFANSITKYVSYKILQYDTAAKRGQAI 1065

Query: 1238 QRLIHVAEHCKTFQNYNTLMQIILALSSLVVQSYRDAWRLIEPGDLLTWESLKNVPSLEK 1297
               I VA       N++++  II  + +  V    ++W+L+      T   L ++    K
Sbjct: 1066 GYFIKVARISYEINNFSSMTAIISGIYASPVNRLHESWKLVSRELQNTLRELDDLMISTK 1125

Query: 1298 NYYNIRMLLNDINPIKGCIPFIVVYLSDL 1326
            N+   R+ L ++   + CIPF  VYLSDL
Sbjct: 1126 NFLKYRLTLKNVGN-RPCIPFFGVYLSDL 1153

>KLLA0C03410g 303739..307821 weakly similar to ca|CA0382|IPF16030
            Candida albicans, hypothetical start
          Length = 1360

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 34/154 (22%), Positives = 63/154 (40%), Gaps = 20/154 (12%)

Query: 1214 NLTVDWIISEIVM-TCDNKLRRNTIQRLIHVAEHCKTFQNYNTLMQIILALSSLVVQSYR 1272
            NL  ++++  I+M     K R   I+  + +A     F+N+N L  I+  L S V+    
Sbjct: 1122 NLLSNYVLESILMPGIPLKKRALRIKSWLRIALSSLYFRNFNALASIMTTLQSYVISRLS 1181

Query: 1273 DAWRLIEPGDLLTWESLKNVPSLEKNYYNIRMLLNDI-------------NPIKGCIPFI 1319
              W ++   D+  +E L  +     NY   R  +  +               +   +PF 
Sbjct: 1182 MLWGMLSNEDVELFEYLSKIIHPNNNYKVYRKKIEKLVTESSSSSGLLSSKSVLPVVPFF 1241

Query: 1320 VVYLSDLTL------NAEKSNWIVPNQVLNYSKF 1347
             ++L DLT       N +  +   PN+++N  K+
Sbjct: 1242 NLFLQDLTFIDEGNPNFKNPDSFRPNKLINIDKY 1275

>Scas_476.2
          Length = 1330

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%)

Query: 34  LKRGANTLIIKTDLHALIIKLTSPLDPIDYPFLADFFLSYRKFLAPNELLRLLESRL 90
           L R ++  II     AL+IKLT  +D  D   +  F L++R F  P  L+ +L  R 
Sbjct: 750 LVRNSSNNIIGGSFRALVIKLTDEIDKADDFLIFSFLLNFRIFGTPETLIEILIERF 806

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 56/133 (42%), Gaps = 18/133 (13%)

Query: 1233 RRNTIQRLIHVAEHCKTFQNYNTLMQIILALSSLVVQSYRDAWRLIEPGDLLTWESLKNV 1292
            R + ++  + +A     F+NYN+L  I++AL S  +      W  +   D+  ++ L  +
Sbjct: 1114 RCSRLKGWLRIALSTLYFRNYNSLASIMIALQSHSLSRLYFLWEDLTEKDIKLYDFLCQI 1173

Query: 1293 PSLEKNYYNIRMLL------NDINPIK------GCIPFIVVYLSDLTLNAE------KSN 1334
                 NY   R  L      N+  P+         +PF  ++L DLT   E        +
Sbjct: 1174 IHPNNNYRVYREKLRILKSGNNQAPLSLSKSPLPIVPFFNLFLQDLTFINEGLPDYRNPD 1233

Query: 1335 WIVPNQVLNYSKF 1347
               PN+++N  KF
Sbjct: 1234 SFRPNKIINMDKF 1246

>CAGL0B01287g 114832..118575 similar to KLLA0C03410g Kluyveromyces
            lactis, hypothetical start
          Length = 1247

 Score = 34.7 bits (78), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 40/184 (21%), Positives = 78/184 (42%), Gaps = 27/184 (14%)

Query: 1209 AIARF-NLTVDWIISEIVMTCDNKLRRNTIQRL-IHVAEHCKTFQNYNTLMQIILALSSL 1266
            AI  F N    ++++ I+    N   R TI +  + +A      +N+N++  I+ A+ + 
Sbjct: 1005 AITSFTNQLSQYVMNGILTPRINDATRTTILKAWLRIALSALYLRNFNSVASIMTAIQNH 1064

Query: 1267 VVQSYRDAWRLIEPGDLLTWESLKNVPSLEKNY----YNIRMLLND-----INPIKG--- 1314
             +      W+ +   D L +E L  +     N+      ++ +++D     I P+K    
Sbjct: 1065 SITRLTGVWQQLSRKDTLLYEYLSRIIHPNHNFKVYRQKLKKIIDDSSQGSIIPVKSHVP 1124

Query: 1315 CIPFIVVYLSDLTLNAEKS------NWIVPNQVLNYSKFQTNVQIVKNFIQRAQWSKFYQ 1368
             +PF  ++L D+T   E +      +   PN+ +N  KF    +IV          +F+Q
Sbjct: 1125 VVPFFNLFLQDITFIHEGNSTFRNPDSFRPNKPINVDKFYRITKIVTTM-------QFFQ 1177

Query: 1369 FSVN 1372
               N
Sbjct: 1178 VGYN 1181

 Score = 34.3 bits (77), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 69/154 (44%), Gaps = 14/154 (9%)

Query: 25  TPSAEKMSY--LKRGANTLIIKTDLHALIIKLTSPLDPIDYPFLADFFLSYRKFLAPNEL 82
           T S++K+S   L   +N  +I      L+ KLT  LD     F++ F L++R F+   EL
Sbjct: 665 TNSSDKLSEEDLIYDSNNELITATCRGLVFKLTDELDHPSSFFVSTFLLNFRSFMKSYEL 724

Query: 83  LRLLESRLQWAFNES-LQADKERQKIGQVTSV----RTFV--VIRHWILNYFAQDFLADQ 135
           +  L +R   A  E+ L+ +K + K     S     R  +  V   W+ +Y+  D+  D 
Sbjct: 725 VTELINRFDLADMENKLRDNKPKGKYSTTASKLKNRRRLICSVFNEWMESYW--DYNTDF 782

Query: 136 ELRRQFVDSINSLSWGATEMAPKSIRGIVVSIKK 169
           E     ++  N    G  +  P+  + ++ +  K
Sbjct: 783 ECISTMINFFNE---GMADYLPRESKMLIQTAAK 813

>CAGL0C00407g 40815..42467 similar to tr|Q12418 Saccharomyces
           cerevisiae YLR094c GIS3, hypothetical start
          Length = 550

 Score = 34.3 bits (77), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 10/78 (12%)

Query: 153 TEMAPKSIRGIVVSIKKSWVLCLKLMWEDVTFENSPSNVDEWLDFKIQDID----TQSST 208
           T++APK I+  +++ KK W   L     D+  E++P N    + F +QD D      +ST
Sbjct: 432 TDVAPKDIKIALITKKKLWSDLLHQTRRDLYGEHTPWN----MKFVVQDTDPVANIDNST 487

Query: 209 KEGGRRLSFYALQSRQNP 226
           +E  RR+S   L+S   P
Sbjct: 488 EE--RRVSLVRLKSEVKP 503

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 867 NKLIRLSSIPSMHSIVSGDSFSS-FQTTNTFGLHSTNSKTGAR 908
           N+ IR SSI S HS +S D+F+S + T    G  S N+++ +R
Sbjct: 566 NRGIRRSSIASQHSAISNDTFNSDYSTDAQSGFRSNNTQSSSR 608

>YMR120C (ADE17) [4077] chr13 complement(507501..509279)
           5-aminoimidazole-4-carboxamide ribonucleotide (AICAR)
           transformylase/IMP cyclohydrolase [1779 bp, 592 aa]
          Length = 592

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 10/60 (16%)

Query: 227 DFRNRSVLSLY-------VGIENF---QLPENSAQINRRLGAKIKQRTASMFLFPQDNLP 276
           D RNR  L  +         I +F   Q  E  AQI  R GA   Q+ A  ++  QD+LP
Sbjct: 168 DLRNRLALKAFEHTADYDAAISDFFRKQYSEGQAQITLRYGANPHQKPAQAYVSQQDSLP 227

>YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger
           transcription factor involved in regulation of ADH2 and
           peroxisomal genes [3972 bp, 1323 aa]
          Length = 1323

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 46/96 (47%), Gaps = 9/96 (9%)

Query: 846 NNSPNKMDLKELLDNDRFPPGNKLIRLSSIPSMHSIVSGDSFSSFQTTNTFGLHS---TN 902
           +N P+ +D +ELLDND    GN L+  +++     ++  DS S+  T+N   L     +N
Sbjct: 417 DNQPDFVDFQELLDNDTL--GNDLLETTAVLKEFELLHDDSVSATATSNEIDLSHLNLSN 474

Query: 903 SKTGARAVVTPSMDAEFSGPKDSLLGPEGDDREANK 938
           S      ++  + +    G  D +L   G D  +N+
Sbjct: 475 SPISPHKLIYKNKE----GTNDDMLISFGLDHPSNR 506

>YGR185C (TYS1) [2136] chr7 complement(866339..867523)
          Tyrosyl-tRNA synthetase, cytoplasmic, charges its
          cognate tRNAs with tyrosine during protein synthesis
          [1185 bp, 394 aa]
          Length = 394

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 22/41 (53%)

Query: 23 YPTPSAEKMSYLKRGANTLIIKTDLHALIIKLTSPLDPIDY 63
          Y  P  +   +LK G    ++  DLHA +  + +PL+ ++Y
Sbjct: 56 YFVPMTKLADFLKAGCEVTVLLADLHAFLDNMKAPLEVVNY 96

>Scas_659.23
          Length = 396

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 21/41 (51%)

Query: 23 YPTPSAEKMSYLKRGANTLIIKTDLHALIIKLTSPLDPIDY 63
          Y  P  +   +LK G    ++  DLHA +  + +PL+ + Y
Sbjct: 52 YFVPMTKLADFLKAGCEVTVLLADLHAFLDNMKAPLEVVQY 92

>Sklu_1679.2 YGR185C, Contig c1679 2614-3843
          Length = 409

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 22/41 (53%)

Query: 23 YPTPSAEKMSYLKRGANTLIIKTDLHALIIKLTSPLDPIDY 63
          Y  P  +   +LK G    ++  DLHA +  + +PL+ ++Y
Sbjct: 58 YFVPMTKLAHFLKAGCEVTVLLADLHAFLDNMKAPLEVVNY 98

>Kwal_26.7830
          Length = 1084

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 3/78 (3%)

Query: 986  DDQEGEPNDSQLSSTTQPERLPHEHHRRSITPIVSPYK-ANDSRLNK--FAKLTDESLHG 1042
            D  +G+     L+ T + E +   H    +T ++S Y+  ND  L K  FA    E+L+ 
Sbjct: 931  DISQGKEGTLDLTKTLKQEAILLYHRLEHLTNVLSDYEYPNDIILGKTEFALFLVENLYL 990

Query: 1043 DPVNVALMKLEGTFSKEN 1060
            D  N   + L G+F++E+
Sbjct: 991  DEANHVELDLAGSFARED 1008

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.130    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 43,417,790
Number of extensions: 1949512
Number of successful extensions: 7030
Number of sequences better than 10.0: 158
Number of HSP's gapped: 7281
Number of HSP's successfully gapped: 175
Length of query: 1380
Length of database: 16,596,109
Length adjustment: 114
Effective length of query: 1266
Effective length of database: 12,649,657
Effective search space: 16014465762
Effective search space used: 16014465762
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)