Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.70822992968791e-118
ADR349W3201947711e-102
KLLA0A04037g3021947641e-101
CAGL0G06248g2971947452e-98
Scas_663.23041946862e-89
YAL025C (MAK16)3061946853e-89
CAGL0F00715g3102045212e-64
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.7082
         (296 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.7082                                                          343   e-118
ADR349W [2090] [Homologous to ScYAL025C (MAK16) - SH] complement...   301   e-102
KLLA0A04037g complement(359981..360889) some similarities with s...   298   e-101
CAGL0G06248g 596704..597597 highly similar to sp|P10962 Saccharo...   291   2e-98
Scas_663.2                                                            268   2e-89
YAL025C (MAK16) [43] chr1 complement(100228..101148) Nuclear pro...   268   3e-89
CAGL0F00715g complement(80864..81796) similar to sp|P10962 Sacch...   205   2e-64

>Kwal_26.7082
          Length = 299

 Score =  343 bits (879), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 182/296 (61%), Positives = 182/296 (61%)

Query: 1   MSDEIIWQVINQQFCAYKLKTDKGQNFCRNEYNVTGLCNRQSCPLANAKYATVKNVDGRL 60
           MSDEIIWQVINQQFCAYKLKTDKGQNFCRNEYNVTGLCNRQSCPLANAKYATVKNVDGRL
Sbjct: 1   MSDEIIWQVINQQFCAYKLKTDKGQNFCRNEYNVTGLCNRQSCPLANAKYATVKNVDGRL 60

Query: 61  YLYMKTAERAHTPAKLWERIRLSKNYAKALTQVDDHLLYWNKFLIHKCKQRLTRLTQIAV 120
           YLYMKTAERAHTPAKLWERIRLSKNYAKALTQVDDHLLYWNKFLIHKCKQRLTRLTQIAV
Sbjct: 61  YLYMKTAERAHTPAKLWERIRLSKNYAKALTQVDDHLLYWNKFLIHKCKQRLTRLTQIAV 120

Query: 121 TXXXXXXXXXXXHYVGVAPKVKRRDENXXXXXXXXXXXXXXXXXXXXXXXXSGAYGDKPL 180
           T           HYVGVAPKVKRRDEN                        SGAYGDKPL
Sbjct: 121 TERRMELREEERHYVGVAPKVKRRDENRERKALAAAKIEKAIEKELLERLKSGAYGDKPL 180

Query: 181 NVDEKIWKKVLGHVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRWLDDPEA 240
           NVDEKIWKKVLGHV                                      RWLDDPEA
Sbjct: 181 NVDEKIWKKVLGHVEDEQEEDYDEEEEEESDAEIEYVEDDGDEDLVDVEDIERWLDDPEA 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVEIEYEEETHPVQQE 296
                                                    VEIEYEEETHPVQQE
Sbjct: 241 SDSESSEDEDSEEDSEDDSEKSSKSDKRKKQAPAARKKRPRVEIEYEEETHPVQQE 296

>ADR349W [2090] [Homologous to ScYAL025C (MAK16) - SH]
           complement(1319477..1320439) [963 bp, 320 aa]
          Length = 320

 Score =  301 bits (771), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 140/194 (72%), Positives = 151/194 (77%)

Query: 1   MSDEIIWQVINQQFCAYKLKTDKGQNFCRNEYNVTGLCNRQSCPLANAKYATVKNVDGRL 60
           MSDEIIWQVINQ FCAYK+KTDKGQNFCRNEYNVTG CNR SCPLANAKYATVK VDG+L
Sbjct: 22  MSDEIIWQVINQHFCAYKIKTDKGQNFCRNEYNVTGFCNRSSCPLANAKYATVKQVDGKL 81

Query: 61  YLYMKTAERAHTPAKLWERIRLSKNYAKALTQVDDHLLYWNKFLIHKCKQRLTRLTQIAV 120
           YLYMKT ERAHTPAKLWERIRLSKNY+ AL Q+D+HLL+WNKFLIHKCKQRLT+LTQ+ +
Sbjct: 82  YLYMKTVERAHTPAKLWERIRLSKNYSTALKQIDEHLLFWNKFLIHKCKQRLTKLTQVMI 141

Query: 121 TXXXXXXXXXXXHYVGVAPKVKRRDENXXXXXXXXXXXXXXXXXXXXXXXXSGAYGDKPL 180
           T           HYVGVAPKVKRRDEN                        SGAYGDKPL
Sbjct: 142 TERRMALREEERHYVGVAPKVKRRDENRERKALAAAKIEKAIEKELLDRLKSGAYGDKPL 201

Query: 181 NVDEKIWKKVLGHV 194
           NVDEKIWK+V+GHV
Sbjct: 202 NVDEKIWKRVMGHV 215

>KLLA0A04037g complement(359981..360889) some similarities with
           sp|P10962 Saccharomyces cerevisiae YAL025c MAK16 nuclear
           viral propagation protein singleton, hypothetical start
          Length = 302

 Score =  298 bits (764), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 137/194 (70%), Positives = 152/194 (78%)

Query: 1   MSDEIIWQVINQQFCAYKLKTDKGQNFCRNEYNVTGLCNRQSCPLANAKYATVKNVDGRL 60
           MSDEIIWQVINQ FCAYK+KTDKGQNFCRNEYNVTGLC+RQ+CPLAN+KYATVKNVDG L
Sbjct: 1   MSDEIIWQVINQHFCAYKVKTDKGQNFCRNEYNVTGLCSRQACPLANSKYATVKNVDGTL 60

Query: 61  YLYMKTAERAHTPAKLWERIRLSKNYAKALTQVDDHLLYWNKFLIHKCKQRLTRLTQIAV 120
           YLYMKTAERAHTPAKLWER++LSKNY KAL Q+D+HLLYWNKFLIHKCKQR+T+LTQ+ +
Sbjct: 61  YLYMKTAERAHTPAKLWERVKLSKNYTKALAQIDEHLLYWNKFLIHKCKQRMTKLTQVMI 120

Query: 121 TXXXXXXXXXXXHYVGVAPKVKRRDENXXXXXXXXXXXXXXXXXXXXXXXXSGAYGDKPL 180
           T           HYVG+APKVKRR+EN                        SG YGDKPL
Sbjct: 121 TERRLALREEERHYVGIAPKVKRREENRERKALSAAKIEKAIEKELLERLKSGVYGDKPL 180

Query: 181 NVDEKIWKKVLGHV 194
           NVDEKIWKKV+G V
Sbjct: 181 NVDEKIWKKVMGRV 194

>CAGL0G06248g 596704..597597 highly similar to sp|P10962
           Saccharomyces cerevisiae YAL025c MAK16, start by
           similarity
          Length = 297

 Score =  291 bits (745), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 152/194 (78%)

Query: 1   MSDEIIWQVINQQFCAYKLKTDKGQNFCRNEYNVTGLCNRQSCPLANAKYATVKNVDGRL 60
           MSDEI+WQVINQQFCAYK+KTDKGQ FCRNEYNVTGLC+RQSCPLAN+KYATVK+ +GRL
Sbjct: 1   MSDEIVWQVINQQFCAYKVKTDKGQTFCRNEYNVTGLCSRQSCPLANSKYATVKSENGRL 60

Query: 61  YLYMKTAERAHTPAKLWERIRLSKNYAKALTQVDDHLLYWNKFLIHKCKQRLTRLTQIAV 120
           YLY++T ERAHTPAK WE+IRLSKNY+KAL Q+DDHLLYWNKF IHKCKQR T+LTQ+A+
Sbjct: 61  YLYIRTVERAHTPAKWWEKIRLSKNYSKALKQIDDHLLYWNKFSIHKCKQRFTKLTQVAI 120

Query: 121 TXXXXXXXXXXXHYVGVAPKVKRRDENXXXXXXXXXXXXXXXXXXXXXXXXSGAYGDKPL 180
           T           HYVGVAPKVKRR+EN                        SGAYGDKP+
Sbjct: 121 TERRLAMREMERHYVGVAPKVKRREENRERKALAAAKIEKSIEKELLDRLKSGAYGDKPM 180

Query: 181 NVDEKIWKKVLGHV 194
           NVDEKIWKKV+GH+
Sbjct: 181 NVDEKIWKKVMGHL 194

>Scas_663.2
          Length = 304

 Score =  268 bits (686), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 144/194 (74%)

Query: 1   MSDEIIWQVINQQFCAYKLKTDKGQNFCRNEYNVTGLCNRQSCPLANAKYATVKNVDGRL 60
           MSDEI+WQVINQ FC++++K+  GQ FCR+ YNVTGLC RQSCPLAN+KYATV+   GR+
Sbjct: 1   MSDEIVWQVINQSFCSHRIKSPSGQTFCRDPYNVTGLCTRQSCPLANSKYATVRADKGRI 60

Query: 61  YLYMKTAERAHTPAKLWERIRLSKNYAKALTQVDDHLLYWNKFLIHKCKQRLTRLTQIAV 120
           YLYMKT ERAHTPAKLWERI+LSKNY+KAL Q+D+HLL+W  F IHKCKQR T+LTQ+A+
Sbjct: 61  YLYMKTPERAHTPAKLWERIKLSKNYSKALKQIDEHLLHWKNFFIHKCKQRFTKLTQVAI 120

Query: 121 TXXXXXXXXXXXHYVGVAPKVKRRDENXXXXXXXXXXXXXXXXXXXXXXXXSGAYGDKPL 180
           T           HYVGVAPKVKRR++N                        SGAYGDKPL
Sbjct: 121 TERRLAMREEERHYVGVAPKVKRREQNRERKALAAAKIEKAIEKELLDRLKSGAYGDKPL 180

Query: 181 NVDEKIWKKVLGHV 194
           NVDEKIWKKVLGH+
Sbjct: 181 NVDEKIWKKVLGHL 194

>YAL025C (MAK16) [43] chr1 complement(100228..101148) Nuclear
           protein with HMG-like acidic region, required for
           propagation of M1 double-stranded RNA (dsRNA) virus [921
           bp, 306 aa]
          Length = 306

 Score =  268 bits (685), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 122/194 (62%), Positives = 144/194 (74%)

Query: 1   MSDEIIWQVINQQFCAYKLKTDKGQNFCRNEYNVTGLCNRQSCPLANAKYATVKNVDGRL 60
           MSDEI+WQVINQ FC++++K   GQNFCRNEYNVTGLC RQSCPLAN+KYATVK  +G+L
Sbjct: 1   MSDEIVWQVINQSFCSHRIKAPNGQNFCRNEYNVTGLCTRQSCPLANSKYATVKCDNGKL 60

Query: 61  YLYMKTAERAHTPAKLWERIRLSKNYAKALTQVDDHLLYWNKFLIHKCKQRLTRLTQIAV 120
           YLYMKT ERAHTPAKLWERI+LSKNY KAL Q+D+HLL+W+KF  HKCKQR T+LTQ+ +
Sbjct: 61  YLYMKTPERAHTPAKLWERIKLSKNYTKALQQIDEHLLHWSKFFRHKCKQRFTKLTQVMI 120

Query: 121 TXXXXXXXXXXXHYVGVAPKVKRRDENXXXXXXXXXXXXXXXXXXXXXXXXSGAYGDKPL 180
           T           HYVGVAPKVKRR++N                        SGAYGDKPL
Sbjct: 121 TERRLALREEERHYVGVAPKVKRREQNRERKALVAAKIEKAIEKELMDRLKSGAYGDKPL 180

Query: 181 NVDEKIWKKVLGHV 194
           NVDEK+WKK++G +
Sbjct: 181 NVDEKVWKKIMGQM 194

>CAGL0F00715g complement(80864..81796) similar to sp|P10962
           Saccharomyces cerevisiae YAL025c MAK16 nuclear viral
           propagation protein, hypothetical start
          Length = 310

 Score =  205 bits (521), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 128/204 (62%), Gaps = 10/204 (4%)

Query: 1   MSDEIIWQVINQQFCAYKLKTDKGQNFCRNEYNVTGLCNRQSCPLANAKYATVKNVD--G 58
           +SD++IW +IN  FCA K+KT  GQ F R+ YNVTGL  RQSCPLAN+KYATV+     G
Sbjct: 3   VSDDLIWDIINHGFCATKIKTKVGQTFDRDPYNVTGLFTRQSCPLANSKYATVREYGDKG 62

Query: 59  RLYLYMKTAERAHTPAKLWERIRLSKNYAKALTQVDDHLLYWNKFLIHKCKQRLTRLTQI 118
           RLYL +KT ERAHTPAK+W+RIRLS NY+KAL Q+D+HL+YWNKF +H+CKQR  +L+QI
Sbjct: 63  RLYLCIKTPERAHTPAKMWQRIRLSNNYSKALKQIDEHLMYWNKFFLHRCKQRYVKLSQI 122

Query: 119 AVTXXXX---XXXXXXXHYVGVAPKVKRRDENXXXXXXXXXXXXXXXXXXXXXXXXSGAY 175
            +                 VG+APKVKRR+ N                        SGAY
Sbjct: 123 KLVERRQLKLQMNGEQKRLVGIAPKVKRREMNRERKALVAAKIEESISKELLNRLKSGAY 182

Query: 176 GD-----KPLNVDEKIWKKVLGHV 194
            +      PLNVDE IW K++G +
Sbjct: 183 SNADKTLTPLNVDENIWNKIMGKL 206

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,176,496
Number of extensions: 173994
Number of successful extensions: 299
Number of sequences better than 10.0: 7
Number of HSP's gapped: 289
Number of HSP's successfully gapped: 8
Length of query: 296
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 195
Effective length of database: 13,099,691
Effective search space: 2554439745
Effective search space used: 2554439745
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)