Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.70701315129667420.0
KLLA0A04015g1343126449790.0
YAL026C (DRS2)1355125548850.0
CAGL0G06270g1328124847670.0
ADR350W1311130047310.0
Scas_505.4102542918270.0
CAGL0G08085g1578104717910.0
KLLA0C17644g1576108817520.0
CAGL0L11814g1576104817340.0
Scas_636.161554107717190.0
AGR120C1547103217150.0
YER166W (DNF1)1571104217020.0
YDR093W (DNF2)1612106017010.0
Scas_576.81591104516820.0
Scas_704.381161107811211e-132
Sklu_2193.11143108111161e-132
ADL079C1166107411161e-131
KLLA0C08393g1148117811121e-131
CAGL0L00715g114493711091e-131
YIL048W (NEO1)1151107311031e-130
Kwal_23.5789113394010861e-127
CAGL0H04477g16265338643e-95
KLLA0E01650g15505338544e-94
Kwal_23.355615975338457e-93
YMR162C (DNF3)16565438324e-91
Scas_669.316385178093e-88
AFL191W15754867914e-86
Scas_89.12712643943e-42
AFL011W12427572235e-18
Kwal_47.1754712409432211e-17
Scas_665.3014398492182e-17
Kwal_26.920714694792093e-16
CAGL0M11308g14524802022e-15
KLLA0A08910g12808941994e-15
KLLA0B08217g14394731942e-14
Kwal_23.3160110010511823e-13
AFR567W14493251815e-13
YOR291W14728431781e-12
YDR040C (ENA1)10919231753e-12
YDR039C (ENA2)10919231734e-12
YGL167C (PMR1)9506931725e-12
CAGL0I04312g9514661725e-12
YDR038C (ENA5)10919231726e-12
KLLA0F20658g10825501663e-11
AEL301W9575401654e-11
CAGL0A00517g11227431637e-11
Scas_707.48*7414611592e-10
CAGL0J01870g9464511582e-10
KLLA0E14630g10823091564e-10
YGL006W (PMC1)11734441441e-08
CAGL0L01419g12146991412e-08
Kwal_14.14989398011413e-08
Scas_583.14*8752881342e-07
KLLA0E22352g12067191332e-07
Kwal_56.234672801501231e-06
AGL097C10963011262e-06
AFR354C12102951234e-06
CAGL0K12034g10874041234e-06
YEL031W (SPF1)12156901234e-06
KLLA0A03157g9383081181e-05
Kwal_47.175228992961020.001
KLLA0A09031g8992961010.001
YPL036W (PMA2)947296910.020
CAGL0D04510g2480108890.034
YGL008C (PMA1)918296880.038
Scas_688.1913296880.038
CAGL0A00495g902171870.054
AGL085C909301860.076
Scas_710.41904303850.11
Scas_297.180059820.22
Scas_569.0d46860800.31
KLLA0F07447g975113790.43
Kwal_26.833342287741.4
YDR270W (CCC2)1004146732.3
Kwal_27.106231142101732.4
Scas_630.1470159714.6
CAGL0H08393g612136688.8
CAGL0M08602g1012275689.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.7070
         (1296 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.7070                                                         2601   0.0  
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...  1922   0.0  
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...  1886   0.0  
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...  1840   0.0  
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...  1826   0.0  
Scas_505.4                                                            708   0.0  
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...   694   0.0  
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...   679   0.0  
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...   672   0.0  
Scas_636.16                                                           666   0.0  
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...   665   0.0  
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...   660   0.0  
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...   659   0.0  
Scas_576.8                                                            652   0.0  
Scas_704.38                                                           436   e-132
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement         434   e-132
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...   434   e-131
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...   432   e-131
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...   431   e-131
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...   429   e-130
Kwal_23.5789                                                          422   e-127
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...   337   3e-95
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...   333   4e-94
Kwal_23.3556                                                          330   7e-93
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...   325   4e-91
Scas_669.3                                                            316   3e-88
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...   309   4e-86
Scas_89.1                                                             156   3e-42
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    91   5e-18
Kwal_47.17547                                                          90   1e-17
Scas_665.30                                                            89   2e-17
Kwal_26.9207                                                           85   3e-16
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...    82   2e-15
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...    81   4e-15
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...    79   2e-14
Kwal_23.3160                                                           75   3e-13
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...    74   5e-13
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    73   1e-12
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...    72   3e-12
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...    71   4e-12
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...    71   5e-12
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...    71   5e-12
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...    71   6e-12
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    69   3e-11
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...    68   4e-11
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...    67   7e-11
Scas_707.48*                                                           66   2e-10
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    65   2e-10
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...    65   4e-10
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...    60   1e-08
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    59   2e-08
Kwal_14.1498                                                           59   3e-08
Scas_583.14*                                                           56   2e-07
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    56   2e-07
Kwal_56.23467                                                          52   1e-06
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....    53   2e-06
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    52   4e-06
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    52   4e-06
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    52   4e-06
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....    50   1e-05
Kwal_47.17522                                                          44   0.001
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    44   0.001
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    40   0.020
CAGL0D04510g 440080..447522 similar to tr|Q06116 Saccharomyces c...    39   0.034
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...    39   0.038
Scas_688.1                                                             39   0.038
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    38   0.054
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...    38   0.076
Scas_710.41                                                            37   0.11 
Scas_297.1                                                             36   0.22 
Scas_569.0d                                                            35   0.31 
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...    35   0.43 
Kwal_26.8333                                                           33   1.4  
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...    33   2.3  
Kwal_27.10623                                                          33   2.4  
Scas_630.14                                                            32   4.6  
CAGL0H08393g 821998..823836 highly similar to sp|P41815 Saccharo...    31   8.8  
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...    31   9.4  

>Kwal_26.7070
          Length = 1315

 Score = 2601 bits (6742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1257/1296 (96%), Positives = 1257/1296 (96%)

Query: 1    MCAARRKSNXXXXXXXXXXXXXXSPIGQRNQNSNNPFNEAQVVDSDYDLLEDVRRGHIPQ 60
            MCAARRKSN              SPIGQRNQNSNNPFNEAQVVDSDYDLLEDVRRGHIPQ
Sbjct: 1    MCAARRKSNDDTLFDIDFLDDDFSPIGQRNQNSNNPFNEAQVVDSDYDLLEDVRRGHIPQ 60

Query: 61   ETMNLDLHSTTLPEADNIENDIVQNPFSDERRARSSSHNQGVVHLTPQNGSAFQRAINKI 120
            ETMNLDLHSTTLPEADNIENDIVQNPFSDERRARSSSHNQGVVHLTPQNGSAFQRAINKI
Sbjct: 61   ETMNLDLHSTTLPEADNIENDIVQNPFSDERRARSSSHNQGVVHLTPQNGSAFQRAINKI 120

Query: 121  KKGLGRSGSGNSYQGFEMHNYDDLGNDDRYAKSRNKFDIKIIFKRYILRRNDYSDDDKSS 180
            KKGLGRSGSGNSYQGFEMHNYDDLGNDDRYAKSRNKFDIKIIFKRYILRRNDYSDDDKSS
Sbjct: 121  KKGLGRSGSGNSYQGFEMHNYDDLGNDDRYAKSRNKFDIKIIFKRYILRRNDYSDDDKSS 180

Query: 181  PRQIYINDKEANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQQVPN 240
            PRQIYINDKEANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQQVPN
Sbjct: 181  PRQIYINDKEANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQQVPN 240

Query: 241  VTPTNRYTTIGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVFSEQLQDFTLSKWVN 300
            VTPTNRYTTIGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVFSEQLQDFTLSKWVN
Sbjct: 241  VTPTNRYTTIGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVFSEQLQDFTLSKWVN 300

Query: 301  ISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKFIDKD 360
            ISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKFIDKD
Sbjct: 301  ISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKFIDKD 360

Query: 361  DLAGMRGKVLSEHPNSSLYTYEGTMNLNGKNISLSPEQMVLRGATLRNTAWIYGLVVFTG 420
            DLAGMRGKVLSEHPNSSLYTYEGTMNLNGKNISLSPEQMVLRGATLRNTAWIYGLVVFTG
Sbjct: 361  DLAGMRGKVLSEHPNSSLYTYEGTMNLNGKNISLSPEQMVLRGATLRNTAWIYGLVVFTG 420

Query: 421  HETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNVIKVTSDAEHLTYLY 480
            HETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNVIKVTSDAEHLTYLY
Sbjct: 421  HETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNVIKVTSDAEHLTYLY 480

Query: 481  LQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLYDEASDSPTV 540
            LQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLYDEASDSPTV
Sbjct: 481  LQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLYDEASDSPTV 540

Query: 541  VRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAATTEDGIEIG 600
            VRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAATTEDGIEIG
Sbjct: 541  VRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAATTEDGIEIG 600

Query: 601  FRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQEDGSIKYQAASPDEGALVEG 660
            FRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQEDGSIKYQAASPDEGALVEG
Sbjct: 601  FRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQEDGSIKYQAASPDEGALVEG 660

Query: 661  AASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRLPNGEIKLFCK 720
            AASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRLPNGEIKLFCK
Sbjct: 661  AASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRLPNGEIKLFCK 720

Query: 721  GADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAAST 780
            GADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAAST
Sbjct: 721  GADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAAST 780

Query: 781  TLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQET 840
            TLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQET
Sbjct: 781  TLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQET 840

Query: 841  AVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGKS 900
            AVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGKS
Sbjct: 841  AVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGKS 900

Query: 901  LGFXXXXXXXXXXXXIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSM 960
            LGF            IGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSM
Sbjct: 901  LGFALEADLEDYLLAIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSM 960

Query: 961  IQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIA 1020
            IQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIA
Sbjct: 961  IQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIA 1020

Query: 1021 LYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQFVSSRLLDRYPQLYK 1080
            LYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQFVSSRLLDRYPQLYK
Sbjct: 1021 LYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQFVSSRLLDRYPQLYK 1080

Query: 1081 LGQRGQFFSVRIFWGWVINGFYHSAVTFIGSTLFYRNGNVLNSHGETADHWAWGVSIYTC 1140
            LGQRGQFFSVRIFWGWVINGFYHSAVTFIGSTLFYRNGNVLNSHGETADHWAWGVSIYTC
Sbjct: 1081 LGQRGQFFSVRIFWGWVINGFYHSAVTFIGSTLFYRNGNVLNSHGETADHWAWGVSIYTC 1140

Query: 1141 SVIIVIGKAALVTNQWTKFTAFAIPGSLVFWLVFFPIYASILPHANVSKEYYGVVSHVYG 1200
            SVIIVIGKAALVTNQWTKFTAFAIPGSLVFWLVFFPIYASILPHANVSKEYYGVVSHVYG
Sbjct: 1141 SVIIVIGKAALVTNQWTKFTAFAIPGSLVFWLVFFPIYASILPHANVSKEYYGVVSHVYG 1200

Query: 1201 SATFWLMCIVLPTFALMRDLVWKYYKRTYTPESYHVVQEMQKYNIGDYRPRIEQFQKAIX 1260
            SATFWLMCIVLPTFALMRDLVWKYYKRTYTPESYHVVQEMQKYNIGDYRPRIEQFQKAI 
Sbjct: 1201 SATFWLMCIVLPTFALMRDLVWKYYKRTYTPESYHVVQEMQKYNIGDYRPRIEQFQKAIR 1260

Query: 1261 XXXXXXXXXXXXGFAFSQSETGGQDKVMRMYDTTLK 1296
                        GFAFSQSETGGQDKVMRMYDTTLK
Sbjct: 1261 RVRQVQRMKKQRGFAFSQSETGGQDKVMRMYDTTLK 1296

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score = 1922 bits (4979), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 928/1264 (73%), Positives = 1052/1264 (83%), Gaps = 22/1264 (1%)

Query: 34   NNPFNEAQVVDSDYDLLEDVRRGHIPQETMNLDLHSTTLPEADNIENDIVQNPFSDERRA 93
            N+P   + V+DS  D     +RG +PQET++L         +DNIENDI +NPF+D R +
Sbjct: 58   NSP---SAVIDSGMD---TSQRGLLPQETIDL---------SDNIENDI-ENPFND-RYS 100

Query: 94   RSSSHNQGVVHLTPQNGSAFQRAINKIKKGLGRSGS-GNSYQGFEMHNYDDLGNDDRYAK 152
             S +       + PQ  S F R ++ +K  +G +G     +Q FEM++YD   N +RY  
Sbjct: 101  ASFADTNPRNSVLPQ-PSGFNRFMSNVKSAVGMNGGHKGQFQSFEMNDYDQ-SNTNRYES 158

Query: 153  SRNKFDIKIIFKRYILRRNDYSDDDKSSPRQIYINDKEANRARGFGSNHISTTKYNLATF 212
            S  KFDIK++F RYILR+   S      PR I +ND  AN   G+  NHISTTKYN ATF
Sbjct: 159  STRKFDIKVLFNRYILRKGKTSCK-SDEPRTILLNDSSANSRFGYRDNHISTTKYNAATF 217

Query: 213  IPKFLFQEFSKYANLFFLFTSAIQQVPNVTPTNRYTTIGTLLIVLIVSAIKEIVEDLKRA 272
            +PKFLFQEFSKYANLFFLFTS IQQVPNVTPTNRYTTIGTLL+VLIVSA+KE VEDLKR+
Sbjct: 218  LPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRYTTIGTLLVVLIVSAVKESVEDLKRS 277

Query: 273  QSDSELNDSRAQVFSEQLQDFTLSKWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCY 332
             +D ELN S   V  E+  +F   KW++I+VGDII+V SEEAIPAD+I+++SSEPEGLCY
Sbjct: 278  NADKELNHSLCDVLDERSGEFVRKKWIDIAVGDIIRVRSEEAIPADLIILSSSEPEGLCY 337

Query: 333  IETANLDGETNLKIKQARIETSKFIDKDDLAGMRGKVLSEHPNSSLYTYEGTMNLNGKNI 392
            IETANLDGETNLKIKQAR ET+ ++D+  L  + G+V SEHPNSSLYTYEGTM LNG   
Sbjct: 338  IETANLDGETNLKIKQARQETANYLDEKALCKLHGRVQSEHPNSSLYTYEGTMTLNGSTF 397

Query: 393  SLSPEQMVLRGATLRNTAWIYGLVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFG 452
             LSP+QM+LRGATLRNTAWI+GL+VFTGHETKLMRNATATPIKRTAVERVINMQI+ALFG
Sbjct: 398  PLSPDQMLLRGATLRNTAWIFGLIVFTGHETKLMRNATATPIKRTAVERVINMQILALFG 457

Query: 453  VLIVLALISSIGNVIKVTSDAEHLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVT 512
            VLIVLALISS GNVI    D+ HL YLY++GTNK GLFFKDILT+WILFSNLVPISLFVT
Sbjct: 458  VLIVLALISSTGNVIMTKRDSAHLGYLYIEGTNKAGLFFKDILTFWILFSNLVPISLFVT 517

Query: 513  VEMIKYYQAYMIASDLDLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFK 572
            VEMIKYYQAYMI SDLDLY E SD+PTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFK
Sbjct: 518  VEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFK 577

Query: 573  SCSIAGKCYIETIPEDKAATTEDGIEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATC 632
            S SIAG+CYIETIPED+ AT EDGIEIGF  F+S+K+ + D +D ++ I+ +FLTLLATC
Sbjct: 578  SVSIAGRCYIETIPEDRRATVEDGIEIGFHSFESLKDKMTDPEDDEAGIVIEFLTLLATC 637

Query: 633  HTVIPEFQEDGSIKYQAASPDEGALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLL 692
            HTVIPE Q DG+IKYQAASPDEGALV+GAA LG++F IR+PNSVS+      ++ EYQLL
Sbjct: 638  HTVIPETQSDGTIKYQAASPDEGALVQGAADLGFRFDIRRPNSVSISTP-FSEQLEYQLL 696

Query: 693  NICEFNSTRKRMSAIFRLPNGEIKLFCKGADTVILERLKAGENPYIEATLRHLEDYAAEG 752
            NICEFNSTRKRMSAIFR+P+G IKLFCKGADTVILERL +  NPY+++TLRHLEDYAAEG
Sbjct: 697  NICEFNSTRKRMSAIFRMPDGSIKLFCKGADTVILERLDSEFNPYVQSTLRHLEDYAAEG 756

Query: 753  LRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKL 812
            LRTLC+ASRT+ E EY EW  IY+AASTT+ DR ++LD AAELIE DLF LGATAIEDKL
Sbjct: 757  LRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAELIEHDLFFLGATAIEDKL 816

Query: 813  QDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNL 872
            Q+GVPETIH LQ+AG+KVWVLTGDRQETA+NIGMSCRLLSEDMNLLI+NEE KE TR NL
Sbjct: 817  QEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLSEDMNLLIVNEETKEDTRTNL 876

Query: 873  TEKLKAISDHQISQQDMNSLALVIDGKSLGFXXXXXXXXXXXXIGKLCKAVICCRVSPLQ 932
              KL AI  HQISQQDMNSLALVIDGKSLG+            IGKLCKAVICCRVSPLQ
Sbjct: 877  QSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLEDQFLTIGKLCKAVICCRVSPLQ 936

Query: 933  KALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYL 992
            KALVVKMVKRKT SLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAI QF++L
Sbjct: 937  KALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIGQFRFL 996

Query: 993  KKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFF 1052
            +KLL+VHGSWSYQRIS AILYSFYKN+ALYMTQFWYVFANA+SGQSIMESWT+TFYNVFF
Sbjct: 997  RKLLIVHGSWSYQRISLAILYSFYKNMALYMTQFWYVFANAFSGQSIMESWTLTFYNVFF 1056

Query: 1053 TVLPPFVMGVFDQFVSSRLLDRYPQLYKLGQRGQFFSVRIFWGWVINGFYHSAVTFIGST 1112
            TV+PPFV+G+FDQFV+SRLLDRYPQLYKLGQ+GQFFSV IFWGWV+NGFYHSAV FIGS 
Sbjct: 1057 TVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQFFSVTIFWGWVLNGFYHSAVVFIGSV 1116

Query: 1113 LFYRNGNVLNSHGETADHWAWGVSIYTCSVIIVIGKAALVTNQWTKFTAFAIPGSLVFWL 1172
            LFYR GN LN  GETADHW WGV IYT S+IIV+GKAAL+T+QWTKFT  AIPGSLV WL
Sbjct: 1117 LFYRYGNCLNMGGETADHWVWGVGIYTTSIIIVLGKAALITSQWTKFTLVAIPGSLVIWL 1176

Query: 1173 VFFPIYASILPHANVSKEYYGVVSHVYGSATFWLMCIVLPTFALMRDLVWKYYKRTYTPE 1232
            +FFP Y+++ P  NVSKEYYG++ HVYGSATFWLMCIVLP FAL+RD VWKYYKRTY+PE
Sbjct: 1177 LFFPFYSAVFPRVNVSKEYYGIIGHVYGSATFWLMCIVLPVFALLRDFVWKYYKRTYSPE 1236

Query: 1233 SYHVVQEMQKYNIGDYRPRIEQFQKAIXXXXXXXXXXXXXGFAFSQSETGGQDKVMRMYD 1292
            SYHVVQEMQKYNI DYRPR+EQFQKAI             GFAFSQSE GGQD+++RMYD
Sbjct: 1237 SYHVVQEMQKYNISDYRPRMEQFQKAIRKVRQVQRMKKQRGFAFSQSEEGGQDRIIRMYD 1296

Query: 1293 TTLK 1296
            TTLK
Sbjct: 1297 TTLK 1300

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
            Ca-ATPase (P-type) required for ribosome assembly and
            involved in late Golgi function, member of the cation
            transporting (E1-E2) P-type ATPase superfamily [4068 bp,
            1355 aa]
          Length = 1355

 Score = 1886 bits (4885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 906/1255 (72%), Positives = 1042/1255 (83%), Gaps = 27/1255 (2%)

Query: 58   IPQETMNLDLHSTTLPEADNIENDIVQNPFSDERRARSSSHNQGVVHLTPQNGSAFQ-RA 116
            +P+ET++LD       + DNIEND+ +N F        +S N         +  A+Q ++
Sbjct: 54   LPEETIDLD------ADDDNIENDVHENLFMSNNHDDQTSWNANRF-----DSDAYQPQS 102

Query: 117  INKIKK-GL-GRSGSG--NSY--------QGFEMHNYDDLGN---DDRYAKSRNKFDIKI 161
            +  +K  GL  R G+G  N++        + FEM++Y+ + N   DD Y  SRNKF+IKI
Sbjct: 103  LRAVKPPGLFARFGNGLKNAFTFKRKKGPESFEMNHYNAVTNNELDDNYLDSRNKFNIKI 162

Query: 162  IFKRYILRRNDYSDDDKSSPRQIYINDKEANRARGFGSNHISTTKYNLATFIPKFLFQEF 221
            +F RYILR+N    +    PR I+IND  AN + G+  NHISTTKYN ATF+PKFLFQEF
Sbjct: 163  LFNRYILRKNVGDAEGNGEPRVIHINDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEF 222

Query: 222  SKYANLFFLFTSAIQQVPNVTPTNRYTTIGTLLIVLIVSAIKEIVEDLKRAQSDSELNDS 281
            SKYANLFFL TSAIQQVP+V+PTNRYTTIGTLL+VLIVSA+KE +ED+KRA SD ELN+S
Sbjct: 223  SKYANLFFLCTSAIQQVPHVSPTNRYTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNS 282

Query: 282  RAQVFSEQLQDFTLSKWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGE 341
             A++FSE   DF   +W++I VGDII+V SEE IPAD I+++SSEPEGLCYIETANLDGE
Sbjct: 283  TAEIFSEAHDDFVEKRWIDIRVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGE 342

Query: 342  TNLKIKQARIETSKFIDKDDLAGMRGKVLSEHPNSSLYTYEGTMNLNGKNISLSPEQMVL 401
            TNLKIKQ+R+ET+KFID   L  M GKV+SE PNSSLYTYEGTM LN + I LSP+QM+L
Sbjct: 343  TNLKIKQSRVETAKFIDVKTLKNMNGKVVSEQPNSSLYTYEGTMTLNDRQIPLSPDQMIL 402

Query: 402  RGATLRNTAWIYGLVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALIS 461
            RGATLRNTAWI+GLV+FTGHETKL+RNATATPIKRTAVE++IN QI+ LF VLIVL LIS
Sbjct: 403  RGATLRNTAWIFGLVIFTGHETKLLRNATATPIKRTAVEKIINRQIIRLFTVLIVLILIS 462

Query: 462  SIGNVIKVTSDAEHLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQA 521
            SIGNVI  T+DA+HL+YLYL+GTNK GLFFKD LT+WILFSNLVPISLFVTVE+IKYYQA
Sbjct: 463  SIGNVIMSTADAKHLSYLYLEGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQA 522

Query: 522  YMIASDLDLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCY 581
            +MI SDLDLY E +D+PTVVRTSSLVEELGQIEYIFSDKTGTLTRN+MEFKSCSIAG CY
Sbjct: 523  FMIGSDLDLYYEKTDTPTVVRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCY 582

Query: 582  IETIPEDKAATTEDGIEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQE 641
            I+ IPEDK AT EDGIE+G+RKFD +K+ LND  D DS IINDFLTLLATCHTVIPEFQ 
Sbjct: 583  IDKIPEDKTATVEDGIEVGYRKFDDLKKKLNDPSDEDSPIINDFLTLLATCHTVIPEFQS 642

Query: 642  DGSIKYQAASPDEGALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTR 701
            DGSIKYQAASPDEGALV+G A LGYKFIIRK NSV+VL+E+ G+E+EYQLLNICEFNSTR
Sbjct: 643  DGSIKYQAASPDEGALVQGGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTR 702

Query: 702  KRMSAIFRLPNGEIKLFCKGADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLASR 761
            KRMSAIFR P+G IKLFCKGADTVILERL    N Y+EAT+RHLEDYA+EGLRTLCLA R
Sbjct: 703  KRMSAIFRFPDGSIKLFCKGADTVILERLDDEANQYVEATMRHLEDYASEGLRTLCLAMR 762

Query: 762  TVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIH 821
             ++E EY EW  IY+ A+TTLD+RA+KLD+AA LIEK+L L+GATAIEDKLQDGVPETIH
Sbjct: 763  DISEGEYEEWNSIYNEAATTLDNRAEKLDEAANLIEKNLILIGATAIEDKLQDGVPETIH 822

Query: 822  TLQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISD 881
            TLQ+AGIK+WVLTGDRQETA+NIGMSCRLLSEDMNLLIINEE ++ T +NL EK+ A+++
Sbjct: 823  TLQEAGIKIWVLTGDRQETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLEKINALNE 882

Query: 882  HQISQQDMNSLALVIDGKSLGFXXXXXXXXXXXXIGKLCKAVICCRVSPLQKALVVKMVK 941
            HQ+S  DM SLALVIDGKSLGF            + KLCKAVICCRVSPLQKALVVKMVK
Sbjct: 883  HQLSTHDMKSLALVIDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVK 942

Query: 942  RKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGS 1001
            RK+ SLLLAI  GANDVSMIQAAHVGVGISGMEGMQAARSAD A+ QFK+LKKLLLVHGS
Sbjct: 943  RKSSSLLLAIASGANDVSMIQAAHVGVGISGMEGMQAARSADIALGQFKFLKKLLLVHGS 1002

Query: 1002 WSYQRISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMG 1061
            WSYQRIS AILYSFYKN ALYMTQFWYVFANA+SGQSIMESWTM+FYN+FFTV PPFV+G
Sbjct: 1003 WSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIG 1062

Query: 1062 VFDQFVSSRLLDRYPQLYKLGQRGQFFSVRIFWGWVINGFYHSAVTFIGSTLFYRNGNVL 1121
            VFDQFVSSRLL+RYPQLYKLGQ+GQFFSV IFWGW+INGF+HSA+ FIG+ L YR G  L
Sbjct: 1063 VFDQFVSSRLLERYPQLYKLGQKGQFFSVYIFWGWIINGFFHSAIVFIGTILIYRYGFAL 1122

Query: 1122 NSHGETADHWAWGVSIYTCSVIIVIGKAALVTNQWTKFTAFAIPGSLVFWLVFFPIYASI 1181
            N HGE ADHW+WGV++YT SVIIV+GKAALVTNQWTKFT  AIPGSL+FWL+FFPIYASI
Sbjct: 1123 NMHGELADHWSWGVTVYTTSVIIVLGKAALVTNQWTKFTLIAIPGSLLFWLIFFPIYASI 1182

Query: 1182 LPHANVSKEYYGVVSHVYGSATFWLMCIVLPTFALMRDLVWKYYKRTYTPESYHVVQEMQ 1241
             PHAN+S+EYYGVV H YGS  FWL  IVLP FAL+RD +WKYYKR Y PE+YHV+QEMQ
Sbjct: 1183 FPHANISREYYGVVKHTYGSGVFWLTLIVLPIFALVRDFLWKYYKRMYEPETYHVIQEMQ 1242

Query: 1242 KYNIGDYRPRIEQFQKAIXXXXXXXXXXXXXGFAFSQSETGGQDKVMRMYDTTLK 1296
            KYNI D RP ++QFQ AI             GFAFSQ+E GGQ+K++RMYDTT K
Sbjct: 1243 KYNISDSRPHVQQFQNAIRKVRQVQRMKKQRGFAFSQAEEGGQEKIVRMYDTTQK 1297

>CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharomyces
            cerevisiae YAL026c DRS2, start by similarity
          Length = 1328

 Score = 1840 bits (4767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 885/1248 (70%), Positives = 1026/1248 (82%), Gaps = 22/1248 (1%)

Query: 59   PQETMNLDLHSTTLPEADNIENDIVQNPFSDERRARSSSHNQ-----GVVHLTP--QNGS 111
            P+E ++LD         D+IEND+  NPFS+       + N+        HLT     G+
Sbjct: 42   PEEIIDLD--------NDSIENDLHDNPFSEYGGEGDWNTNRFDRINNQPHLTQIGNKGN 93

Query: 112  AFQRAINKIKKGLGRSGSGNSYQGFEMHNYDDLGN---DDRYAKSRNKFDIKIIFKRYIL 168
             F R    IK G+    S +  Q FEM NY+ +     DD + KSRNKFDIKI+F +Y+L
Sbjct: 94   VFTRMGRSIK-GIFTFQSNSEPQSFEMSNYNTVSTGEMDDNFQKSRNKFDIKILFNKYLL 152

Query: 169  RRNDYSDDDKSSPRQIYINDKEANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLF 228
            R+N     D   PR+I+I+D+E+N   G+  NHISTTKYN ATF+PKFLFQEFSKYANLF
Sbjct: 153  RKNTSDGQDSGEPREIHISDRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYANLF 212

Query: 229  FLFTSAIQQVPNVTPTNRYTTIGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVFSE 288
            FL TSAIQQVP+V+PTNRYTTIGTL++VLIVSAIKE VEDLKRA SD+ELN+S+A+++ E
Sbjct: 213  FLCTSAIQQVPHVSPTNRYTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEIYFE 272

Query: 289  QLQDFTLSKWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQ 348
               DF   +W++I VGDII+VNSEE IPAD+I+++SSEPEGLCYIETANLDGETNLKIKQ
Sbjct: 273  AEGDFIQKRWIDIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQ 332

Query: 349  ARIETSKFIDKDDLAGMRGKVLSEHPNSSLYTYEGTMNLNGKNISLSPEQMVLRGATLRN 408
            AR ET+K +D  +L  ++G + SE PNSSLYTYEGT+ +NG  I LSPEQM+LRGATLRN
Sbjct: 333  ARTETAKIMDSRELRNIKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRN 392

Query: 409  TAWIYGLVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNVIK 468
            T WI+G+V+FTGHETKLMRNATATPIKRTAVE+VINMQI+ALF VL+VL LISSIGNVI 
Sbjct: 393  TGWIFGIVIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIM 452

Query: 469  VTSDAEHLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDL 528
             T+DA+HL+YLYLQGTNK GLFFKD LT+WILFSNLVPISLFVTVE+IKYYQA+MI SDL
Sbjct: 453  STADAKHLSYLYLQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDL 512

Query: 529  DLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPED 588
            DLY E +D+PTVV+TSSLVEELGQIEYIFSDKTGTLTRN+MEFKSCSIAG+CY E IPED
Sbjct: 513  DLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPED 572

Query: 589  KAATTEDGIEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQEDGSIKYQ 648
            KAAT EDGIE+G+R FD +K+ L    D D  II++FLTLLATCHTVIPEFQ DGSIKYQ
Sbjct: 573  KAATFEDGIEVGYRSFDDLKKQLTTNSD-DCKIIDEFLTLLATCHTVIPEFQADGSIKYQ 631

Query: 649  AASPDEGALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIF 708
            AASPDEGALVEG A LGYKF+IRKPNSV++LI +  +E+EYQLLNICEFNSTRKRMSAIF
Sbjct: 632  AASPDEGALVEGGALLGYKFLIRKPNSVTILINE-EEEREYQLLNICEFNSTRKRMSAIF 690

Query: 709  RLPNGEIKLFCKGADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEY 768
            R P+  IKL CKGAD+VILERL    N Y++AT RHLEDYA EGLRTLCLA++ + E EY
Sbjct: 691  RFPDDSIKLLCKGADSVILERLSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEY 750

Query: 769  AEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGI 828
              W   Y  A+TTLD RA+KLD  AE IE  L L+GATAIEDKLQ+GVP+TI TLQ+AGI
Sbjct: 751  NAWNKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGI 810

Query: 829  KVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQD 888
            K+WVLTGD+QETA+NIGMSCRLLSEDMNLLII+EE KEATR+N+ EKL A+ +H +S+ D
Sbjct: 811  KIWVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHD 870

Query: 889  MNSLALVIDGKSLGFXXXXXXXXXXXXIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLL 948
            MN+LALVIDG SL F            IGK+CKAVICCRVSPLQKALVVKMVKRKT+SLL
Sbjct: 871  MNTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLL 930

Query: 949  LAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQRIS 1008
            LAIGDGANDVSMIQAAHVGVGISGMEGMQAARSAD ++ QF++LKKLLLVHG+WSYQRIS
Sbjct: 931  LAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVGQFRFLKKLLLVHGAWSYQRIS 990

Query: 1009 QAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQFVS 1068
             AILYSFYKN ALYMTQFWYVFANA+SGQSIMESWTM+ YNVFFTVLPPFV+GVFDQFV+
Sbjct: 991  VAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSLYNVFFTVLPPFVIGVFDQFVN 1050

Query: 1069 SRLLDRYPQLYKLGQRGQFFSVRIFWGWVINGFYHSAVTFIGSTLFYRNGNVLNSHGETA 1128
            SRLL+RYPQLYKLGQ+GQFFSV IFWGW++NGFYHSAV F+G+ LFYR G  L  HGETA
Sbjct: 1051 SRLLERYPQLYKLGQKGQFFSVSIFWGWIVNGFYHSAVVFVGTILFYRYGFALRKHGETA 1110

Query: 1129 DHWAWGVSIYTCSVIIVIGKAALVTNQWTKFTAFAIPGSLVFWLVFFPIYASILPHANVS 1188
            DHW+WG++IYT SVIIV+GKAALVTNQWTKFT FAIPGSL FWL+FFPIY SI P+A +S
Sbjct: 1111 DHWSWGIAIYTSSVIIVLGKAALVTNQWTKFTLFAIPGSLFFWLIFFPIYGSIFPYAKIS 1170

Query: 1189 KEYYGVVSHVYGSATFWLMCIVLPTFALMRDLVWKYYKRTYTPESYHVVQEMQKYNIGDY 1248
            +EY+GVV H YGSATFWL  IVLPTFAL RD +WKYYKR Y PESYH++QEMQKYN+ DY
Sbjct: 1171 REYFGVVEHTYGSATFWLTLIVLPTFALTRDFIWKYYKRMYAPESYHLIQEMQKYNVSDY 1230

Query: 1249 RPRIEQFQKAIXXXXXXXXXXXXXGFAFSQSETGGQDKVMRMYDTTLK 1296
            RP ++ FQ AI             GFAFSQ+E  GQ+K++RMYDTT K
Sbjct: 1231 RPHVQHFQNAIRKVRQVQRMKKQRGFAFSQAEE-GQEKIIRMYDTTQK 1277

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score = 1826 bits (4731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 896/1300 (68%), Positives = 1038/1300 (79%), Gaps = 11/1300 (0%)

Query: 1    MCAARRKSNXXXXXXXXXXXXXXSPIGQRNQNSNNPFNEAQVVDSDYDLLEDVRRGHIPQ 60
            M  +R K N              +P   R  N +       ++DS  D L  ++R   PQ
Sbjct: 1    MSGSRDKHNEETLFDIDFLDDRYTPEPARPVNDSGS-RSGPIIDSGIDDLVQMQRTGFPQ 59

Query: 61   ETMNLDLHSTTLPEADNIENDIVQNPFSDER---RARSSSHNQGVVHLTPQNGSAFQRAI 117
            E ++LD         D+IEND+++NPF DER   R  +S++   V    PQ  S +QR +
Sbjct: 60   EVIDLD-DEPPFRHDDSIENDLIENPFDDERGQQRYLASANRLSV----PQP-SGWQRLV 113

Query: 118  NKIKKGLGRSGSGNS-YQGFEMHNYDDLGNDDRYAKSRNKFDIKIIFKRYILRRNDYSDD 176
              ++  +G  G+ NS YQ FEM +Y D  + DRY +SRNKF++K +F  Y+LR+   +D 
Sbjct: 114  GGLRDSVGGRGTENSQYQSFEMQDYRDTHSGDRYQRSRNKFNLKALFDHYVLRKPAAADT 173

Query: 177  DKSSPRQIYINDKEANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQ 236
                PR IYIN++ AN A G+G NHISTTKYN ATF+PKFLFQEFSKYANLFFLFTS IQ
Sbjct: 174  GAGEPRVIYINERRANGAMGYGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQ 233

Query: 237  QVPNVTPTNRYTTIGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVFSEQLQDFTLS 296
            QVPNVTPTNR+TTIGTL++VL+VSAIKE VEDLKR+ SD ELN SRA V+S+++  F   
Sbjct: 234  QVPNVTPTNRFTTIGTLIVVLVVSAIKESVEDLKRSNSDKELNHSRADVYSDEMGQFISK 293

Query: 297  KWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKF 356
            KW++I+VGDII+V SEEAIPAD+IV++SSEPEGLCYIETANLDGETNLKIKQAR ETSK 
Sbjct: 294  KWIDIAVGDIIRVRSEEAIPADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPETSKI 353

Query: 357  IDKDDLAGMRGKVLSEHPNSSLYTYEGTMNLNGKNISLSPEQMVLRGATLRNTAWIYGLV 416
            +D  +L+ MRGK+LSE PN+SLYTYEGTM L+   I LSP+Q++LRGATLRNT WI+G+V
Sbjct: 354  LDVRELSAMRGKILSEQPNTSLYTYEGTMILHNNRIPLSPDQILLRGATLRNTVWIFGIV 413

Query: 417  VFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNVIKVTSDAEHL 476
            +FTGHETKL RNATATPIKRTAVERVIN+QIVALFGVLI L+LISS GN+I + +  E+L
Sbjct: 414  IFTGHETKLTRNATATPIKRTAVERVINLQIVALFGVLICLSLISSFGNLIVMYNQKENL 473

Query: 477  TYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLYDEASD 536
            +YLYLQGTN V LFFK+ILT+WILFSNLVPISLFVTVEMIKYYQAYMIASDLDL+ E S+
Sbjct: 474  SYLYLQGTNMVALFFKNILTFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESN 533

Query: 537  SPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAATTEDG 596
             PTVVRTSSLVEELGQIEYIFSDKTGTLT+NVMEFKSCSIAG+CYI++IPEDK A  ++G
Sbjct: 534  MPTVVRTSSLVEELGQIEYIFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPEDKDAAFDEG 593

Query: 597  IEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQEDGSIKYQAASPDEGA 656
            IE+G+R +D M E L+     D  II++FLTLL+ CHTVIPEFQE+GSIKYQAASPDEGA
Sbjct: 594  IEVGYRTYDDMHELLHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGA 653

Query: 657  LVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRLPNGEIK 716
            LV+GAA LGYKFIIRKPNSV++L ED+ +E  Y+LLNICEFNSTRKRMSAIFR P+  I+
Sbjct: 654  LVQGAADLGYKFIIRKPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPDNSIR 713

Query: 717  LFCKGADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYD 776
            L CKGADTVILERL A  NPY+ ATLRHLEDYAAEGLRTLC+ASRT+ ESEY EW  +YD
Sbjct: 714  LLCKGADTVILERLAATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYD 773

Query: 777  AASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGD 836
            AA+TT+ +R+++LD  AE+IEK L LLGATAIEDKLQDGVPETIHTLQ AGIKVWVLTGD
Sbjct: 774  AAATTMHNRSEELDKVAEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGD 833

Query: 837  RQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVI 896
            RQETA+NIGMSC+LLSEDMNLLI+NE+ KE+TR NL +KL+AI+DHQISQQDMN+LALVI
Sbjct: 834  RQETAINIGMSCKLLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVI 893

Query: 897  DGKSLGFXXXXXXXXXXXXIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGAN 956
            DGKSLGF            IGK+C+AVICCRVSPLQKALVVKMVKR+T SLLLAIGDGAN
Sbjct: 894  DGKSLGFALEPDLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGAN 953

Query: 957  DVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQRISQAILYSFY 1016
            DVSMIQAAHVGVGISGMEGMQAARSADFA+ QFKYLKKLLLVHGSWSYQRISQAILYSFY
Sbjct: 954  DVSMIQAAHVGVGISGMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFY 1013

Query: 1017 KNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQFVSSRLLDRYP 1076
            KNIALYMTQFWYV  NA+SGQSIMESWT+TFYN   T  PP      DQF  S LL+R  
Sbjct: 1014 KNIALYMTQFWYVLYNAFSGQSIMESWTLTFYNWGGTAAPPGPPKRRDQFERSGLLNRDA 1073

Query: 1077 QLYKLGQRGQFFSVRIFWGWVINGFYHSAVTFIGSTLFYRNGNVLNSHGETADHWAWGVS 1136
            Q   +GQ+GQF+   IF G  ING YH+ +T  G  + YR G     HGETADHW WGV+
Sbjct: 1074 QSCTVGQKGQFWPATIFRGSAINGNYHNWITIDGWIMDYRYGAAGAMHGETADHWVWGVA 1133

Query: 1137 IYTCSVIIVIGKAALVTNQWTKFTAFAIPGSLVFWLVFFPIYASILPHANVSKEYYGVVS 1196
            I   S+I V+GKAAL+TNQWTKFT  AIPGSLVFWL+FFPIYA +LP  NVSKEYYG+VS
Sbjct: 1134 IQPTSIIFVLGKAALITNQWTKFTVLAIPGSLVFWLLFFPIYAYLLPGLNVSKEYYGIVS 1193

Query: 1197 HVYGSATFWLMCIVLPTFALMRDLVWKYYKRTYTPESYHVVQEMQKYNIGDYRPRIEQFQ 1256
            HVYGS TFW MC VLP  AL+RDL+WKYYKRTYTPESYHVVQEMQKY+I D RPRIEQFQ
Sbjct: 1194 HVYGSFTFWAMCYVLPVLALLRDLLWKYYKRTYTPESYHVVQEMQKYDISDNRPRIEQFQ 1253

Query: 1257 KAIXXXXXXXXXXXXXGFAFSQSETGGQDKVMRMYDTTLK 1296
            KAI             GFAFSQSE  GQD+++RMYDTT K
Sbjct: 1254 KAIRKVRQVQRMKKQRGFAFSQSEEAGQDRIVRMYDTTQK 1293

>Scas_505.4
          Length = 1025

 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/429 (73%), Positives = 365/429 (85%)

Query: 868  TRKNLTEKLKAISDHQISQQDMNSLALVIDGKSLGFXXXXXXXXXXXXIGKLCKAVICCR 927
            TRKN+ +K+ A+ +H++SQ +MN+LALVIDGKSL +            +GK+CKAV+CCR
Sbjct: 534  TRKNMRDKIMALKEHKLSQHEMNTLALVIDGKSLSYALESDLEDYLLALGKICKAVVCCR 593

Query: 928  VSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIA 987
            VSPLQKALVVKMVKRKT SLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSAD A+ 
Sbjct: 594  VSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVG 653

Query: 988  QFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTF 1047
            QF++LKKLLLVHGSWSYQRIS AILYSFYKN ALYMTQFW+VFANA+SGQSIMESWTM++
Sbjct: 654  QFRFLKKLLLVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSY 713

Query: 1048 YNVFFTVLPPFVMGVFDQFVSSRLLDRYPQLYKLGQRGQFFSVRIFWGWVINGFYHSAVT 1107
            YNVFFTV PPFV+GVFDQFVSSRLL+RYPQLYKLGQ+G+FFSVRIFWGW++NGFYHSAV 
Sbjct: 714  YNVFFTVFPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVV 773

Query: 1108 FIGSTLFYRNGNVLNSHGETADHWAWGVSIYTCSVIIVIGKAALVTNQWTKFTAFAIPGS 1167
            +IG+ LFYR G  LN HGE ADHW+WG+++YT S++IV+GKAALVTNQWTKFT FAIPGS
Sbjct: 774  YIGTMLFYRYGMALNMHGEVADHWSWGIAVYTSSILIVLGKAALVTNQWTKFTLFAIPGS 833

Query: 1168 LVFWLVFFPIYASILPHANVSKEYYGVVSHVYGSATFWLMCIVLPTFALMRDLVWKYYKR 1227
             +FW++FFPIYAS+ P+AN+S+EY+GVV H YGS TFWL  IVLP FALMRD VWKYY+R
Sbjct: 834  FIFWMIFFPIYASVFPYANISREYFGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRR 893

Query: 1228 TYTPESYHVVQEMQKYNIGDYRPRIEQFQKAIXXXXXXXXXXXXXGFAFSQSETGGQDKV 1287
             Y PESYH+VQEMQK+NI D RP ++ FQ  I             GFAFSQSE GGQDK+
Sbjct: 894  MYEPESYHLVQEMQKFNISDNRPHVQHFQNEIRKVRQVQRMKKQRGFAFSQSEEGGQDKI 953

Query: 1288 MRMYDTTLK 1296
            +RMYDTT K
Sbjct: 954  IRMYDTTQK 962

 Score =  533 bits (1374), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 273/461 (59%), Positives = 344/461 (74%), Gaps = 20/461 (4%)

Query: 32  NSNNPFNEAQ--VVDSDYDLLEDVRRGH-IPQETMNLDLHSTTLPEADNIENDIVQNPFS 88
           +S  P N  Q  ++ ++ D    V   H  P+ET++LD         DNIENDI  NPF 
Sbjct: 68  DSAEPSNSTQPHIIANNRDAEARVIPPHTFPEETIDLD-------NDDNIENDIYDNPFQ 120

Query: 89  DERRA-----RSSSHN-QGVVHLTPQNGSAFQRAINKIKKGLGRSGSGNSYQGFEMHNYD 142
           DE        R  ++N Q  ++ T Q    F  + NK+K     +   +    +EM+ Y+
Sbjct: 121 DEESTTWDTNRFETNNYQPQLYPTGQRNGFFANSFNKVKNIFVFNTKPSDSGSYEMNRYN 180

Query: 143 DLGN---DDRYAKSRNKFDIKIIFKRYILRRNDYSDDDKSSPRQIYINDKEANRARGFGS 199
            + N   D RYA SRN+F+IKI+F RYILR+N  + DD  +PR+IY+ND+ AN A  +G 
Sbjct: 181 AVTNNELDGRYADSRNRFNIKILFNRYILRKNVGASDD-GTPREIYLNDRTANHAFNYGD 239

Query: 200 NHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQQVPNVTPTNRYTTIGTLLIVLIV 259
           NHISTTKYN+ATF+PKFLFQEFSKYANLFFL T+AIQQVP+V+PTNRYTT+GTL++VLIV
Sbjct: 240 NHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQQVPHVSPTNRYTTVGTLMVVLIV 299

Query: 260 SAIKEIVEDLKRAQSDSELNDSRAQVFSEQLQDFTLSKWVNISVGDIIKVNSEEAIPADV 319
           SA KE +ED+KRA SD ELN+S+ +++SE+  DF   +W++I  GD+I+V SEEAIPAD+
Sbjct: 300 SAFKESIEDIKRANSDKELNNSKTEIYSEENGDFIERRWIDIRAGDVIRVKSEEAIPADL 359

Query: 320 IVIASSEPEGLCYIETANLDGETNLKIKQARIETSKFIDKDDLAGMRGKVLSEHPNSSLY 379
           IVI+SSEPEGLCYIETANLDGETNLKIKQAR ET++ +D   L   +GKV+SE PNSSLY
Sbjct: 360 IVISSSEPEGLCYIETANLDGETNLKIKQARPETAEMMDSRKLNNFKGKVISEQPNSSLY 419

Query: 380 TYEGTMNLNGKNISLSPEQMVLRGATLRNTAWIYGLVVFTGHETKLMRNATATPIKRTAV 439
           TYEGT+  N + I LSPEQM+LRGATLRNT+W++GLV+FTGHETKLMRNATATPIKRTAV
Sbjct: 420 TYEGTLEFNNRKIPLSPEQMILRGATLRNTSWMFGLVIFTGHETKLMRNATATPIKRTAV 479

Query: 440 ERVINMQIVALFGVLIVLALISSIGNVIKVTSDAEHLTYLY 480
           ERVIN+QIVALFGVLIVL LISS+GN I  ++  +HL+YLY
Sbjct: 480 ERVINLQIVALFGVLIVLVLISSLGNAIISSTQEKHLSYLY 520

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score =  694 bits (1791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/1047 (38%), Positives = 604/1047 (57%), Gaps = 111/1047 (10%)

Query: 293  FTLSKWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIE 352
            F+   W N+ VGDI+++++ E IPAD+I++++S+ +G CY+ET NLDGETNLK++Q+   
Sbjct: 400  FSKDYWKNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKC 459

Query: 353  TSKFIDKDDLAGMRGKVLSEHPNSSLYTYEGTMNLNG------KNISLSPEQMVLRGATL 406
            TS      D+A  R  + SE P+++LY+Y+G    N       KN  ++   ++LRG TL
Sbjct: 460  TSDIRSSIDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTL 519

Query: 407  RNTAWIYGLVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNV 466
            RNT W  G+V FTG +TK+M NA  TP K++ + + +N+ ++  F +L VL  I+ + N 
Sbjct: 520  RNTKWAMGVVAFTGDDTKIMLNAGVTPTKKSRISKELNLSVLFNFALLFVLCFIAGLYNG 579

Query: 467  IKVTSDAEHLTYLYLQGTNKVGLFFKDILTYW---ILFSNLVPISLFVTVEMIKYYQAYM 523
            I          +    GT   G      +++W   IL+ +LVPISL+++VE+IK  QA  
Sbjct: 580  IYHNKHPRSRDFFDF-GTGTGGSATSGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIF 638

Query: 524  IASDLDLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIE 583
            I  D+ +Y+E  D P   ++ ++ ++LGQIEYIFSDKTGTLT+NVMEFK C+I G  Y  
Sbjct: 639  IYLDVMMYNEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 698

Query: 584  TIPEDKAATTE-DGIEI---------GFRKFDSMKETLNDTQD--PDSHIIND------- 624
               E  A   +  G+++         G ++    +E +N  Q+   +S    D       
Sbjct: 699  AYTEALAGLRKRQGVDVAHESKIEKEGIKR--DREEMINKLQNLAKNSQFYEDEVTFVSK 756

Query: 625  --------------------FLTLLATCHTVI--PEFQEDGSIKYQAASPDEGALVEGAA 662
                                F+  LA CH+V+  P  ++   ++ +A SPDE ALV  A 
Sbjct: 757  EFVDDLTGGSGSVQQKSCQHFMLALALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTAR 816

Query: 663  SLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRLP----NGEIK-- 716
             +G+ F+  K     +++E  G E+E+Q+LNI EFNS+RKRMS I ++P    NG+ K  
Sbjct: 817  DMGFSFL--KKTKEGMVLEVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKAL 874

Query: 717  LFCKGADTVILERL-KAG--ENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKD 773
            L CKGAD+VI  RL K G  E   +E T  HLE YA EGLRTLCLA R ++  EY  W  
Sbjct: 875  LICKGADSVIYSRLDKTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNK 934

Query: 774  IYDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVL 833
             YD A+  + DR ++L+  ++ IE+ L LLG TAIED+LQDGVP++I  L +AGIK+WVL
Sbjct: 935  KYDIAAAAVVDREEELEKVSDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVL 994

Query: 834  TGDRQETAVNIGMSCRLLSEDMNLLIINE-----EDKEATRKNLTEKL------------ 876
            TGD+ ETA+NIG SC LL+ DM LL+I       ED  AT K++ + L            
Sbjct: 995  TGDKVETAINIGFSCNLLNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLHDKFGMA 1054

Query: 877  -------KAISDHQISQQDMNSLALVIDGKSLGFXXXXXXXXXX-XXIGKLCKAVICCRV 928
                   KA ++H I + +    A++IDG++L +             + K CK+V+CCRV
Sbjct: 1055 GSEEELKKAKAEHDIPRGE---FAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRV 1111

Query: 929  SPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQ 988
            SP QKA VVK+VK   D + LAIGDG+NDV+MIQ+A++GVGI+G EG QA  S+D+AI Q
Sbjct: 1112 SPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQ 1171

Query: 989  FKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFY 1048
            F+YL +LLLVHG W Y+R+++ I   FYKN+   +  FW+   N Y G  + E   +TFY
Sbjct: 1172 FRYLTRLLLVHGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFY 1231

Query: 1049 NVFFTVLPPFVMGVFDQFVSSRLLDRYPQLYKLG-QRGQFFSVRIFWGWVINGFYHSAVT 1107
            N+ FT +P  ++G+FDQ VS  +   +PQLY++G  R ++   +  W ++++G Y S + 
Sbjct: 1232 NLAFTSIPVILLGIFDQDVSDTISLVFPQLYRVGILRKEWSQTKFLW-YMLDGLYQSVIA 1290

Query: 1108 FIGSTLFYRNGNVLNSHGETADHWAW------GVSIYTCSVIIVIGKAALVTNQWTKFTA 1161
            F    L YR   ++ S+G   DH  +       ++  +C++ I+I +       W  F +
Sbjct: 1291 FFFPYLLYRRHMIVTSNGLGLDHRYYVGVPVTAIACISCNLYILIQQ-----KHWDVFCS 1345

Query: 1162 FAIPGSLVFWLVFFPIYASILPHANVSKEYYGVVSHVYGSATFWLMCIVLPTFALMRDLV 1221
            F +  S++ +  +  I++S    A+ S E+Y   + V+G+ TFW +  V   F L+    
Sbjct: 1346 FFVGVSIMIFFTWTGIWSS----ASRSNEFYHGAARVFGTPTFWAVLFVGIMFCLLPRFT 1401

Query: 1222 WKYYKRTYTPESYHVVQEMQKYNIGDY 1248
               +KR + P+   +++EM  ++ GD+
Sbjct: 1402 LDVFKRYFYPKDIDIIREM--WSRGDF 1426

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 59/114 (51%), Gaps = 8/114 (7%)

Query: 182 RQIYIN--------DKEANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTS 233
           R IY N        D++      +  N I TTKY   TF+PK +  +F  +AN++FL   
Sbjct: 173 RNIYFNQPLPQDMLDEDNKPLANYPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILI 232

Query: 234 AIQQVPNVTPTNRYTTIGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVFS 287
            +        TN   +   L++++I++AIK+ +ED +R   D E+N+++  V +
Sbjct: 233 ILGAFQIFGVTNPGFSAVPLIVIIIITAIKDGIEDSRRTVLDLEVNNTKTHVLT 286

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/1088 (36%), Positives = 601/1088 (55%), Gaps = 92/1088 (8%)

Query: 242  TPTNRYTTIGTLLIVLIVSAIKEIVEDL-KRAQSDSELNDSRAQVFSEQLQDFTLSKWVN 300
            TP N   ++G+       S   E   DL +R + D  L D    V  +    F    W +
Sbjct: 392  TPRNSLDSVGSYR----NSMESEFGGDLTERGKDDLCLLDPSLPVLPDC--KFAKDYWKS 445

Query: 301  ISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKFIDKD 360
            +SVGDI++V++ + IPAD+I+++SS+ +G CY+ET NLDGETNLK++Q+   +    +  
Sbjct: 446  VSVGDIVRVHNNDEIPADIILLSSSDSDGACYVETKNLDGETNLKVRQSLKCSHMIRNSR 505

Query: 361  DLAGMRGKVLSEHPNSSLYTYEGTMNLNGKNISLSPEQ------MVLRGATLRNTAWIYG 414
            ++   + KV SE P+S+LY+Y+G +    +   L   +      ++LRG TLRNT W  G
Sbjct: 506  NITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTLRNTKWAMG 565

Query: 415  LVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNVIKVTSDAE 474
            +VVFTG +TK+M NA  TP K + + R +N+ +   F +L VL   + I N +   +D  
Sbjct: 566  IVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFMNFALLFVLCFAAGIVNGVYYRTDNT 625

Query: 475  HLTYLYLQGTNKVGLFFKDILTYW---ILFSNLVPISLFVTVEMIKYYQAYMIASDLDLY 531
               Y    G+         ++++W   IL+ ++VPISL++++E+IK  QA  I  D+ LY
Sbjct: 626  SRNYFEF-GSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQALFIYGDVALY 684

Query: 532  DEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAG----KCYIETIP- 586
            +E  D P   ++ ++ ++LGQIEYIFSDKTGTLT+NVMEFK C+I G    + Y E +  
Sbjct: 685  NERLDYPCTPKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAG 744

Query: 587  ---------EDKAATTEDGI-----------------------EIGFRKFDSMKETLNDT 614
                     E++ A  ++GI                        + F   + +++T    
Sbjct: 745  LRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTFVSKEFVQDTAGAN 804

Query: 615  QDPDSHIINDFLTLLATCHTVIPEFQEDGS--IKYQAASPDEGALVEGAASLGYKFIIRK 672
             +       +F+  LA CHTV+ E  +D    + ++A SPDE ALV  A  +G+ F+ R 
Sbjct: 805  GETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARDMGFSFVGRT 864

Query: 673  PNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRLP----NGEIK--LFCKGADTVI 726
             N V V I+  G ++EY+LLN+ EFNSTRKRMS I ++P    N E +  L CKGAD++I
Sbjct: 865  KNGVIVDIQ--GVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICKGADSII 922

Query: 727  LERL-KAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDR 785
              RL K  +   +E T  HLE YA EGLRTLC+A R ++  EY EW + ++ A+  L DR
Sbjct: 923  YSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAAAALVDR 982

Query: 786  AQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIG 845
              +++  A++IE++L LLG TAIED+LQDGVP++I TL +AGIK+WVLTGD+ ETA+NIG
Sbjct: 983  EDEMEKVADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKVETAINIG 1042

Query: 846  MSCRLLSEDMNLLIIN--------------EEDKEATRKNLTEKLKAISDHQ-------I 884
             SC LL+ +M LL+I               E  K    K L EK +    ++       +
Sbjct: 1043 FSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEELEEAKKV 1102

Query: 885  SQQDMNSLALVIDGKSLGFXXXXXXXXXX-XXIGKLCKAVICCRVSPLQKALVVKMVKRK 943
             +    +  ++IDG +L               + K CKAV+CCRVSP QKA VVK+VK  
Sbjct: 1103 HEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAVVKLVKNT 1162

Query: 944  TDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWS 1003
             D + LAIGDG+NDV+MIQ+A +GVGI+G EG QA  S+D+AI QF+YL +L+LVHG WS
Sbjct: 1163 LDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLVLVHGRWS 1222

Query: 1004 YQRISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVF 1063
            Y+R+++ I   FYKN+   ++ FWY   N Y G  + E   +T +N+ FT LP   +G+ 
Sbjct: 1223 YKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTSLPVIFLGIL 1282

Query: 1064 DQFVSSRLLDRYPQLYKLGQRGQFFSVRIFWGWVINGFYHSAVTFIGSTLFYRNGNVLNS 1123
            DQ V+  +    PQLY++G     ++   FW ++ +  Y S + F    L Y    ++  
Sbjct: 1283 DQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVICFFLPYLCYYKTGIVTQ 1342

Query: 1124 HGETADHWAW-GVSIYTCSVIIVIGKAALVTNQWTKFTAFAIPGSLVFWLVFFPIYASIL 1182
            +G   DH  W GV + T +V+       L   +W  F++  I  S +    +  I++S  
Sbjct: 1343 NGFGLDHRYWVGVFVATIAVVSCNTYVLLHQYRWDWFSSLFIALSCLCIFAWTGIWSSF- 1401

Query: 1183 PHANVSKEYYGVVSHVYGSATFWLMCIVLPTFALMRDLVWKYYKRTYTPESYHVVQEMQK 1242
                 S E+Y   +H+YG   FW +      F L+       + RTY P+   +++E  K
Sbjct: 1402 ---TSSGEFYKSAAHIYGQPVFWAIMFAGILFCLLPRFAADTFLRTYMPKDIDIIRECWK 1458

Query: 1243 YNIGDYRP 1250
                D+ P
Sbjct: 1459 RGDFDHYP 1466

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 68/150 (45%), Gaps = 15/150 (10%)

Query: 137 EMHNYDDLGNDDRYAKSRNKFDIKIIFKRYILRRNDYSDDDKSSPRQIYINDKEANRARG 196
           E H+ DD  ND+ Y KS  + + + I+    L            P  I   D++ N    
Sbjct: 195 EGHSSDD-DNDENYDKSHRQRETRTIYYNLPL------------PEDIL--DEDGNSTIY 239

Query: 197 FGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQQVPNVTPTNRYTTIGTLLIV 256
           +  N I TTKY   TF PK +  +F   AN++FL    +         N       L+++
Sbjct: 240 YPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVI 299

Query: 257 LIVSAIKEIVEDLKRAQSDSELNDSRAQVF 286
           +++++ K+ +ED +R   D E+N++   + 
Sbjct: 300 VVLTSFKDAIEDSRRTILDMEVNNAPTHIL 329

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score =  672 bits (1734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/1048 (38%), Positives = 587/1048 (56%), Gaps = 106/1048 (10%)

Query: 293  FTLSKWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIE 352
            F    W ++ VGDI+++++ + IPAD+I++++S+ +G CY+ET NLDGETNLK++QA   
Sbjct: 389  FARDYWKSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKC 448

Query: 353  TSKFIDKDDLAGMRGKVLSEHPNSSLYTYEGTM------NLNGKNISLSPEQMVLRGATL 406
            + K     D+A  R  + SE P+++LY+Y+G +      N   +N  ++   M+LRG TL
Sbjct: 449  SYKIKTSRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTL 508

Query: 407  RNTAWIYGLVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNV 466
            RNT W  G+VVFTG +TK+M NA  TP K++ + R +N  ++  F VL +L  IS + N 
Sbjct: 509  RNTKWAMGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANG 568

Query: 467  IKVTSDAEHLTYLYLQGTNKVGLFFKDILTYW---ILFSNLVPISLFVTVEMIKYYQAYM 523
            I          +    GT          +++W   IL+ +LVPISL+++VE+IK  QA  
Sbjct: 569  IDYDKHPRSRDFFEF-GTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAF 627

Query: 524  IASDLDLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIE 583
            I  D+ LY+   D P   ++ ++ ++LGQIEYIFSDKTGTLT+NVMEFK C+I G  Y  
Sbjct: 628  IYGDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 687

Query: 584  TIPEDKAATTE-DGIEI---GFRK-----------FDSMKETLNDTQ-DPD------SHI 621
               E  A   +  GI++   G R+            + ++   N+TQ  PD        I
Sbjct: 688  AYTEALAGLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEI 747

Query: 622  IND---------------FLTLLATCHTVI--PEFQEDGSIKYQAASPDEGALVEGAASL 664
            + D               F+  LA CH+V+  P       ++ +A SPDE ALV  A  L
Sbjct: 748  VQDFKGRNGDIQKKCCEHFMLALALCHSVLTEPSPTNPNKLEMKAQSPDEAALVTTARDL 807

Query: 665  GYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRL----PNGEIK--LF 718
            G+ F+ +    + V I+  G ++E+++LNI EFNS RKRMS I ++    PN E +  L 
Sbjct: 808  GFCFMGKTKTGMVVEIQ--GIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLI 865

Query: 719  CKGADTVILERL--KAGEN--PYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDI 774
            CKGAD+VI  RL  KAGEN    +E T  HLE YA EGLRTLCLA R +T SEY EW   
Sbjct: 866  CKGADSVIYSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNAR 925

Query: 775  YDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLT 834
            YD A+ +L +R ++L+  ++ IE+DL LLG TAIED+LQDGVPE+I  L +AGIK+WVLT
Sbjct: 926  YDIAAASLTNREEQLEIVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLT 985

Query: 835  GDRQETAVNIGMSCRLLSEDMNLLII----------NEEDKEATR----KNLTEKL---- 876
            GD+ ETA+NIG SC LL+ DM LL++           E+  E       K L EK     
Sbjct: 986  GDKVETAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSG 1045

Query: 877  ------KAISDHQISQQDMNSLALVIDGKSLGFXXXXXXXXXX-XXIGKLCKAVICCRVS 929
                   A  DH   + D    A+VIDG +L               + K CKAV+CCRVS
Sbjct: 1046 SEMELDNAKGDHSFPKGD---FAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVS 1102

Query: 930  PLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQF 989
            P QKA VVK+VK   D + LAIGDG+NDV+MIQ+A VG+GI+G EG QA   +D+AI QF
Sbjct: 1103 PAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQF 1162

Query: 990  KYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYN 1049
            +YL +LLLVHG WSY+R+S+ I   FYKN+   +  FWY   N + G  + E   + FYN
Sbjct: 1163 RYLTRLLLVHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYN 1222

Query: 1050 VFFTVLPPFVMGVFDQFVSSRLLDRYPQLYKLG-QRGQFFSVRIFWGWVINGFYHSAVTF 1108
            + FT +P  ++G+ DQ V+  +    PQLY++G  R ++   +  W ++ +G Y S + F
Sbjct: 1223 LAFTSIPVILLGILDQDVNDTISLVVPQLYRVGILRLEWNQTKFLW-YMFDGLYQSVICF 1281

Query: 1109 IGSTLFYRNGNVLNSHGETADHWAW------GVSIYTCSVIIVIGKAALVTNQWTKFTAF 1162
                L Y+   V+  +G   +H  +       ++++ C++ I+I +      +W  F+ F
Sbjct: 1282 FFPYLLYKRNGVVTKNGMGLEHRYYVGIIVTTIAVFACNLYILIHQY-----RWDWFSGF 1336

Query: 1163 AIPGSLVFWLVFFPIYASILPHANVSKEYYGVVSHVYGSATFWLMCIVLPTFALMRDLVW 1222
             I  S +  + +  I+ S       S + +     +Y S +FW +  +   F L+    W
Sbjct: 1337 FIFLSCIVVIGWTGIWTSSF----TSLDLWKAGERIYDSPSFWAVFFIGVFFCLLPRFTW 1392

Query: 1223 KYYKRTYTPESYHVVQEMQKYNIGDYRP 1250
              Y + + P    +++EM K    D+ P
Sbjct: 1393 DCYTQFFNPSDVQIIREMWKRGDYDHYP 1420

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 72/148 (48%), Gaps = 13/148 (8%)

Query: 149 RYAKS--RNKFDIKIIFKRYILRRNDYSDDDKSSPRQIYIN--------DKEANRARGFG 198
           ++AK   +N FD    F R     ND S +     R +Y N        D+E N    + 
Sbjct: 129 KWAKKNIKNPFDD---FSRDEEEENDRSTNRADQLRTVYHNLPLPEEMLDEEGNPIMEYP 185

Query: 199 SNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQQVPNVTPTNRYTTIGTLLIVLI 258
            N I TTKY   +F PK L  +F  +AN++FL    +        TN   +   L++++I
Sbjct: 186 RNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQIFGVTNPGLSAVPLIVIVI 245

Query: 259 VSAIKEIVEDLKRAQSDSELNDSRAQVF 286
           ++AIK+ +ED +R   D E+N++R  + 
Sbjct: 246 ITAIKDGIEDSRRTILDLEVNNTRTHIL 273

>Scas_636.16
          Length = 1554

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/1077 (37%), Positives = 599/1077 (55%), Gaps = 117/1077 (10%)

Query: 269  LKRAQSDSELNDSRAQVFSEQLQDFTLSK-----WVNISVGDIIKVNSEEAIPADVIVIA 323
            L+++  DS   +    V    L     SK     W N+ VGDI+++++ + IPADVI+++
Sbjct: 343  LEQSNIDSTFENGEISVLDPSLPPMANSKFANDFWKNVRVGDIVRIHNNDEIPADVILLS 402

Query: 324  SSEPEGLCYIETANLDGETNLKIKQARIETSKFIDKDDLAGMRGKVLSEHPNSSLYTYEG 383
            +S+ +G CY+ET NLDGE+NLK++Q+   T+   +  D+   +  V SE P+++LY Y+G
Sbjct: 403  TSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRNSRDICRTKFWVESEGPHANLYVYQG 462

Query: 384  TM----NLNGK--NISLSPEQMVLRGATLRNTAWIYGLVVFTGHETKLMRNATATPIKRT 437
             +    +L+G+  N  ++   M+LRG TLRNT W  G+VVFTG +TK M NA  TP K++
Sbjct: 463  NLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWAMGIVVFTGDDTKTMINAGVTPTKKS 522

Query: 438  AVERVINMQIVALFGVLIVLALISSIGN---VIKVTSDAEHLTYLYLQGTNKVGLFFKDI 494
             + R +N  ++  F  L +L LI+ + N     K     +   +  + G      F    
Sbjct: 523  RISRELNFSVLINFVFLFILCLIAGVANGAYYRKKPRSRDFFEFGTIAGNPTTNGF---- 578

Query: 495  LTYW---ILFSNLVPISLFVTVEMIKYYQAYMIASDLDLYDEASDSPTVVRTSSLVEELG 551
            +++W   IL+ +LVPISL+++VE+IK  QA  I  D+ LY+E  D P   ++ S+ ++LG
Sbjct: 579  VSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVLLYNERLDYPCTPKSWSISDDLG 638

Query: 552  QIEYIFSDKTGTLTRNVMEFKSCSIAG----KCYIETIP----------EDKAATTEDGI 597
            QIEYIFSDKTGTLT+NVMEFK C+I G    + Y E +           E +     +GI
Sbjct: 639  QIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALAGLRKRQGIDTEKEGRIEREGI 698

Query: 598  -----------------------EIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHT 634
                                   E+ F   +  ++ L +  +        F+  LA CH+
Sbjct: 699  AQDREIMIDDLRKISNNSQFYPEELTFVSKEFSQDLLGNNGEVQQKRCQHFMLALALCHS 758

Query: 635  VI--PEFQEDGSIKYQAASPDEGALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLL 692
            V+  P+  +   ++  A SPDE ALV  A  +G+ FI +    +  L+E  G ++E+Q+L
Sbjct: 759  VLVEPDKNDPNKLELTAQSPDETALVTTARDMGFSFIGKTKQGL--LVEVQGIQKEFQIL 816

Query: 693  NICEFNSTRKRMSAIFRLPNGEIK------LFCKGADTVILERL--KAGEN--PYIEATL 742
            NI EFNS+RKRMS I +LP    K      L CKGAD+VI  RL  K G N    +E T 
Sbjct: 817  NILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGADSVIYSRLSRKPGYNDETLLEKTA 876

Query: 743  RHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFL 802
             HLE YA EGLRTLC+  R ++ SEY EW + Y+ A+ +L  R ++LD  A+LIE+DL L
Sbjct: 877  LHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIAAASLAGREEELDHVADLIERDLVL 936

Query: 803  LGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIIN- 861
            LG TAIED+LQDGVP++I  L +AGIK+WVLTGD+ ETA+NIG SC LL+ DM LL+I  
Sbjct: 937  LGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAINIGFSCNLLNTDMELLVIKT 996

Query: 862  --EEDKE-----------ATRKNLTEKLK----------AISDHQISQQDMNSLALVIDG 898
              E+ KE              K L EK            A  DH   Q +    A++IDG
Sbjct: 997  TGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEEELAAAKKDHSPPQGE---FAIIIDG 1053

Query: 899  KSLGFXXXXXXXXXX-XXIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGAND 957
            ++L               + K CKAV+CCRVSP QKA VVK+VK   D + LAIGDG+ND
Sbjct: 1054 EALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAAVVKLVKDTLDVMTLAIGDGSND 1113

Query: 958  VSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQRISQAILYSFYK 1017
            V+MIQ+A VGVGI+G EG QA   +D+AI QF+Y+ +L+LVHG W Y+R+++ I   FYK
Sbjct: 1114 VAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHGKWCYKRLAEMIPQFFYK 1173

Query: 1018 NIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQFVSSRLLDRYPQ 1077
            N+   +  FWY   N + G  + E   +TFYN+ FT LP   +G+ DQ VS+ +    PQ
Sbjct: 1174 NVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSLPVIFLGILDQDVSATVSMIVPQ 1233

Query: 1078 LYKLGQRGQFFSVRIFWGWVINGFYHSAVTFIGSTLFYRNGNVLNSHGETADHWAW---- 1133
            LY+ G   Q ++   F  ++ +G Y S + +    L YR  N++  +G   DH  +    
Sbjct: 1234 LYRSGILRQEWNQTKFLWYMFDGIYQSVICYFFPYLIYRKTNIITQNGLGLDHRYYVGIP 1293

Query: 1134 --GVSIYTCSVIIVIGKAALVTNQWTKFTAFAIPGSLVFWLVFFPIYASILPHANVSKEY 1191
              G+++ +C+  +++ +      +W  FT F    S + +  +  I++S +     S E+
Sbjct: 1294 VTGIAVTSCNFYVLMEQY-----RWDWFTTFFAFLSTIVYFGWTGIWSSSI----ASYEF 1344

Query: 1192 YGVVSHVYGSATFWLMCIVLPTFALMRDLVWKYYKRTYTPESYHVVQEMQKYNIGDY 1248
            +   S +YG+ +FW +  V   F ++    +  + +   P    +++EM ++  GD+
Sbjct: 1345 WKGASRMYGTPSFWAVYFVGFLFCILPRFTYDVFMKYLYPSDVEIIREMWQH--GDF 1399

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 50/90 (55%)

Query: 197 FGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQQVPNVTPTNRYTTIGTLLIV 256
           +  N I TTKY   TF PK +  +F+ +AN++FL    +        TN       L+++
Sbjct: 168 YPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGVTNPGLAAVPLIVI 227

Query: 257 LIVSAIKEIVEDLKRAQSDSELNDSRAQVF 286
           +I++AIK+ +ED +R   D E+N++R  + 
Sbjct: 228 IILTAIKDAIEDSRRTLLDMEVNNTRTHIL 257

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/1032 (38%), Positives = 568/1032 (55%), Gaps = 98/1032 (9%)

Query: 293  FTLSKWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIE 352
            F  S W +I VGDI+++++ + IPAD+I++++S+ +G CY+ET NLDGETNLK++Q+   
Sbjct: 400  FGKSHWKDIRVGDIVRIHNNDEIPADIILLSTSDADGACYVETKNLDGETNLKVRQSLKC 459

Query: 353  TSKFIDKDDLAGMRGKVLSEHPNSSLYTYEGTMNLNGK------NISLSPEQMVLRGATL 406
            + +  +  D++  +  V SE P+++LY+Y+G             N  ++   M+LRG +L
Sbjct: 460  SHRIRNSKDISRCKFWVESEGPHANLYSYQGNFKWVDSETGVMHNEPVNINNMLLRGCSL 519

Query: 407  RNTAWIYGLVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNV 466
            RNT W  G+V+FTG +TK+M NA  TP KR+ + R +N  ++  F  L VL L + + N 
Sbjct: 520  RNTKWAMGIVMFTGTDTKIMLNAGVTPTKRSRISRELNYSVILNFVFLFVLCLAAGLVNG 579

Query: 467  IKVTSDAEHLTYLYLQGTNKVGLFFKDILTYW---ILFSNLVPISLFVTVEMIKYYQAYM 523
            I    DA   T+    GT     F   IL ++   IL+ +LVPISL++++E+IK  QA  
Sbjct: 580  IYYRRDATSRTFFEF-GTVAGTPFANGILAFFVALILYQSLVPISLYISIEIIKTAQAAF 638

Query: 524  IASDLDLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAG----K 579
            I  D+ LY+   D P   RT ++ ++LGQIEYIFSDKTGTLT+NVMEFK C+I G    +
Sbjct: 639  IYGDVLLYNPKLDYPCTPRTWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 698

Query: 580  CYIET----------------------IPEDKAATTEDGIEIGFR-KFDSM------KET 610
             Y E                       I EDK    E  +++G   + D        KE 
Sbjct: 699  AYTEALAGLRKRQGVDIEEEGARERAEIEEDKKQMVELLLKLGKNSQLDPHTVTFVSKEL 758

Query: 611  LNDTQDPDSH----IINDFLTLLATCHTVIPEFQEDGSIKY--QAASPDEGALVEGAASL 664
            + D    +S      +  F+  LA CH+V+ E  ++   K   +A SPDE ALVE A  +
Sbjct: 759  VQDLGGANSQEQKEAVEHFMLSLALCHSVVVEENKNNPEKLDIKAQSPDEAALVETARDM 818

Query: 665  GYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRLP----NGEIK--LF 718
            G+ F+ R  N V  +IE  G ++E+++LN+ EFNSTRKRMS I ++P    N + K  L 
Sbjct: 819  GFSFVGRTKNGV--IIEIQGVQKEFRILNVLEFNSTRKRMSCIVKIPAADENSKPKALLL 876

Query: 719  CKGADTVILERLKAGEN--PYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYD 776
            CKGAD+VI  RL    N    +E T  HLE +A EGLRTLC+A R +   EY  W +  +
Sbjct: 877  CKGADSVIYSRLDRSRNDPKLLERTALHLEQFATEGLRTLCVAQREIDWDEYLNWNERRE 936

Query: 777  AASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGD 836
             A+ +LD+R + L+  A+ IE+ L LLG TAIED+LQDGVP++I  L DAGIK+WVLTGD
Sbjct: 937  LAAASLDNREEALERVADAIERQLVLLGGTAIEDRLQDGVPDSISILADAGIKLWVLTGD 996

Query: 837  RQETAVNIGMSCRLLSEDMNLLII----------NEEDKEAT-------------RKNLT 873
            + ETA+NIG SC LL  DM LL+I           E+D +                K   
Sbjct: 997  KVETAINIGFSCNLLGSDMELLVIKSSGEDVEHLGEKDSDVVLALIDKYLETHFNMKGSP 1056

Query: 874  EKLKAI-SDHQISQQDMNSLALVIDGKSLGFXXXXXXXXXX-XXIGKLCKAVICCRVSPL 931
            E+L A   DH   Q   ++  +VIDG +L               + K CKAV+CCRVSP 
Sbjct: 1057 EELAAARKDHTPPQ---SAFGVVIDGDALKLALHGEDIRRKFLLLCKNCKAVLCCRVSPS 1113

Query: 932  QKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKY 991
            QKA VVK+VK   D + LAIGDG+NDV+MIQAA VG+GI+G EG QA  SAD+AI QF+Y
Sbjct: 1114 QKAAVVKLVKESLDVVTLAIGDGSNDVAMIQAADVGIGIAGEEGRQAVMSADYAIGQFRY 1173

Query: 992  LKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVF 1051
            L +L+LVHG WSY+R+++ I   FYKNI   +  FW+   + Y G  + E   + FYN+ 
Sbjct: 1174 LTRLVLVHGRWSYKRLAEMIPQFFYKNITFTLALFWFGICSNYDGSYLFEYTYLMFYNLA 1233

Query: 1052 FTVLPPFVMGVFDQFVSSRLLDRYPQLYKLGQRGQFFSVRIFWGWVINGFYHSAVTFIGS 1111
            FT LP   +G+ DQ  S  L    PQLYK+G     ++   FW +  +G Y S + F   
Sbjct: 1234 FTSLPVIFLGIMDQDASDVLSVVVPQLYKVGILRTEWTQNKFWWYCFDGVYQSIICFFFP 1293

Query: 1112 TLFYRNGNVLNSHGETADH-WAWGVSIYTCSVIIVIGKAALVTNQWTKFTAFAI---PGS 1167
             L Y    ++  +    DH + +GV + + +V+       +   +W  FT   I    G 
Sbjct: 1294 YLCYYRTGLITKNAYGLDHRYTFGVFVTSIAVVSCNLYVLIHQYRWDWFTTLFIFLSCGI 1353

Query: 1168 LVFWLVFFPIYASILPHANVSKEYYGVVSHVYGSATFWLMCIVLPTFALMRDLVWKYYKR 1227
            L FW         +   A  S E+Y     +Y    FW +  V   F L+    W   ++
Sbjct: 1354 LFFW-------TGVWSSATYSGEFYKTAVRLYAQPVFWAVLFVGVIFCLLPRFTWDAVQK 1406

Query: 1228 TYTPESYHVVQE 1239
             + P    +V+E
Sbjct: 1407 LFFPRDIDIVRE 1418

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 47/90 (52%)

Query: 197 FGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQQVPNVTPTNRYTTIGTLLIV 256
           +  N I TTKY   +F+PK L  +F   AN++FL    +  V     TN       L+ +
Sbjct: 203 YPRNKIRTTKYTPLSFLPKNLAYQFKNAANIYFLLLVCLSFVSIFGVTNPALAAIPLIAI 262

Query: 257 LIVSAIKEIVEDLKRAQSDSELNDSRAQVF 286
           ++++ +K+  ED +R   D E+N+ R+ + 
Sbjct: 263 VVITGLKDAFEDSRRTILDLEVNNMRSHIL 292

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/1042 (37%), Positives = 584/1042 (56%), Gaps = 94/1042 (9%)

Query: 293  FTLSKWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIE 352
            F  + W  + VGDI+++++ + IPAD+I++++S+ +G CY+ET NLDGETNLK++Q+   
Sbjct: 393  FAKNYWKGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKC 452

Query: 353  TSKFIDKDDLAGMRGKVLSEHPNSSLYTYEGTM---NLNGKNISLSP---EQMVLRGATL 406
            T+      D+A  +  + SE P+S+LYTY+G M   NL    I   P     ++LRG TL
Sbjct: 453  TNTIRTSKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTL 512

Query: 407  RNTAWIYGLVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNV 466
            RNT W  G+V+FTG +TK+M N+  TP K++ + R +N  +V  F +L +L  +S I N 
Sbjct: 513  RNTKWAMGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANG 572

Query: 467  IKVTSDAEHLTYLYLQGTNKVGLFFKDILTYW---ILFSNLVPISLFVTVEMIKYYQAYM 523
            +          + Y  GT          +++W   IL+ +LVPISL+++VE+IK  QA  
Sbjct: 573  VYYDKKGRS-RFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAF 631

Query: 524  IASDLDLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIE 583
            I  D+ LY+   D P   ++ ++ ++LGQ+EYIFSDKTGTLT+NVMEFK C+I G  Y  
Sbjct: 632  IYGDVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGR 691

Query: 584  TIPEDKAATTE-DGIEI---GFRK-------FDSM----------------------KET 610
               E  A   +  GI++   G R+        D+M                      KE 
Sbjct: 692  AYTEALAGLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEF 751

Query: 611  LNDTQDPDSHI----INDFLTLLATCHTVIPEFQEDGSIKY--QAASPDEGALVEGAASL 664
            + D +     +       F+  LA CH+V+ E   D   K   +A SPDE ALV  A  +
Sbjct: 752  VRDLKGASGEVQQRCCEHFMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARDV 811

Query: 665  GYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRLPN------GEIKLF 718
            G+ F+ +    +  +IE  G ++E+++LNI EFNS+RKRMS I ++P           L 
Sbjct: 812  GFSFVGKTKKGL--IIEMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLI 869

Query: 719  CKGADTVILERL--KAGEN--PYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDI 774
            CKGAD++I  RL  ++G N    +E T  HLE YA EGLRTLC+A R ++ SEY +W + 
Sbjct: 870  CKGADSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEK 929

Query: 775  YDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLT 834
            YD A+ +L +R  +L+  A+ IE++L LLG TAIED+LQDGVP+ I  L +AGIK+WVLT
Sbjct: 930  YDIAAASLANREDELEVVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLT 989

Query: 835  GDRQETAVNIGMSCRLLSEDMNLLII----------NEEDKEATRKNLTEKLK------- 877
            GD+ ETA+NIG SC LL+ +M LL+I            E  E     L++ LK       
Sbjct: 990  GDKVETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTG 1049

Query: 878  -------AISDHQISQQDMNSLALVIDGKSLGFXXXXXXXXXX-XXIGKLCKAVICCRVS 929
                   A  DH+  +    + A+VIDG +L               + K C+AV+CCRVS
Sbjct: 1050 SEEEIFEAKKDHEFPK---GNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVS 1106

Query: 930  PLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQF 989
            P QKA VVK+VK   D + LAIGDG+NDV+MIQ+A VG+GI+G EG QA   +D+AI QF
Sbjct: 1107 PSQKAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQF 1166

Query: 990  KYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYN 1049
            +YL +L+LVHG WSY+R+++ I   FYKN+   +  FWY   N + G  + E   M FYN
Sbjct: 1167 RYLARLVLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYN 1226

Query: 1050 VFFTVLPPFVMGVFDQFVSSRLLDRYPQLYKLGQRGQFFSVRIFWGWVINGFYHSAVTFI 1109
            + FT LP   +G+ DQ V+  +    PQLY++G   + ++ R F  ++++G Y S + F 
Sbjct: 1227 LAFTSLPVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSIICFF 1286

Query: 1110 GSTLFYRNGNVLNSHGETADH-WAWGVSIYTCSVIIVIGKAALVTNQWTKFTAFAIPGSL 1168
               L Y    ++ S+G   DH +  GV + T +VI       L   +W  F+   I  S 
Sbjct: 1287 FPYLVYHKNMIVTSNGLGLDHRYFVGVYVTTIAVISCNTYVLLHQYRWDWFSGLFIALSC 1346

Query: 1169 VFWLVFFPIYASILPHANVSKEYYGVVSHVYGSATFWLMCIVLPTFALMRDLVWKYYKRT 1228
            +    +  I++S    A  S+E++   + +YG+ +FW +  V   F L+    +  +++ 
Sbjct: 1347 LVVFAWTGIWSS----AIASREFFKAAARIYGAPSFWAVFFVAVLFCLLPRFTYDSFQKF 1402

Query: 1229 YTPESYHVVQEMQKYNIGDYRP 1250
            + P    +V+EM ++   D+ P
Sbjct: 1403 FYPTDVEIVREMWQHGHFDHYP 1424

 Score = 60.8 bits (146), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 55/99 (55%)

Query: 188 DKEANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQQVPNVTPTNRY 247
           D+E N    +  N I TTKY   TF+PK +  +F  +AN++FL    +        TN  
Sbjct: 182 DEEGNPIMQYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTNPG 241

Query: 248 TTIGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVF 286
            +   L++++I++AIK+ +ED +R   D E+N+++  + 
Sbjct: 242 LSAVPLVVIVIITAIKDAIEDSRRTVLDLEVNNTKTHIL 280

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/1060 (37%), Positives = 588/1060 (55%), Gaps = 109/1060 (10%)

Query: 293  FTLSKWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIE 352
            F    W N+ VGDI++V++ + IPAD+I++++S+ +G CY+ET NLDGETNLK++Q+ ++
Sbjct: 438  FAKDYWKNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQS-LK 496

Query: 353  TSKFIDKD-DLAGMRGKVLSEHPNSSLYTYEG------TMNLNGKNISLSPEQMVLRGAT 405
             SK I    D+   +  V SE P+++LY+Y+G      T N N +N  ++   ++LRG T
Sbjct: 497  CSKIIKSSRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCT 556

Query: 406  LRNTAWIYGLVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGN 465
            LRNT W  G+V+FTG +TK+M NA  TP K++ + R +N  ++  F +L +L   + I N
Sbjct: 557  LRNTKWAMGMVIFTGDDTKIMINAGVTPTKKSRISRELNFSVILNFVLLFILCFTAGIVN 616

Query: 466  VIKVTSDAEHLTYLYLQGTNKVGLFFKDILTYW---ILFSNLVPISLFVTVEMIKYYQAY 522
             +          Y    GT          +++W   IL+ +LVPISL+++VE+IK  QA 
Sbjct: 617  GVYYKQKPRSRDYFEF-GTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAI 675

Query: 523  MIASDLDLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYI 582
             I +D+ LY+   D P   ++ ++ ++LGQIEYIFSDKTGTLT+NVMEFK C+I G  Y 
Sbjct: 676  FIYTDVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYG 735

Query: 583  ETIPEDKAATTE-DGIEI---GFRK-----------FDSMKETLNDTQ------------ 615
                E  A   +  G+++   G R+            D ++   ++TQ            
Sbjct: 736  RAYTEALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKE 795

Query: 616  ----------DPDSHIINDFLTLLATCHTVIPEFQEDGSIKY--QAASPDEGALVEGAAS 663
                      D        FL  LA CH+V+ E  +D   K   +A SPDE ALV  A  
Sbjct: 796  IVEDLKGSSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQ 855

Query: 664  LGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRLPNGEIK------L 717
            LGY F+    +   +++E  G ++E+Q+LN+ EFNS+RKRMS I ++P    K      L
Sbjct: 856  LGYSFV--GSSKSGLIVEIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALL 913

Query: 718  FCKGADTVILERLKAGEN--PYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIY 775
             CKGAD+VI  RL   +N    +E T  HLE+YA EGLRTLCLA R +T SEY  W   Y
Sbjct: 914  ICKGADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTY 973

Query: 776  DAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTG 835
            D A+ ++ +R ++LD   ++IE++L LLG TAIED+LQDGVP++I  L +AGIK+WVLTG
Sbjct: 974  DVAAASVTNREEELDKVTDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTG 1033

Query: 836  DRQETAVNIGMSCRLLSEDMNLLIINE--EDKEA------------TRKNLTEKL----- 876
            D+ ETA+NIG SC +L+ DM LL++    ED E               K L EK      
Sbjct: 1034 DKVETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGS 1093

Query: 877  -----KAISDHQISQQDMNSLALVIDGKSLGFXXXXXXXXXX-XXIGKLCKAVICCRVSP 930
                 +A  +H + Q    + A++IDG +L               + K CKAV+CCRVSP
Sbjct: 1094 EEELKEAKREHGLPQ---GNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSP 1150

Query: 931  LQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFK 990
             QKA VVK+VK+  D + LAIGDG+NDV+MIQ+A VGVGI+G EG QA   +D+AI QF+
Sbjct: 1151 AQKAAVVKLVKKTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFR 1210

Query: 991  YLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNV 1050
            Y+ +L+LVHG W Y+R+++ I   FYKN+   ++ FWY   N + G  + E   +TFYN+
Sbjct: 1211 YVTRLVLVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNL 1270

Query: 1051 FFTVLPPFVMGVFDQFVSSRLLDRYPQLYKLG-QRGQFFSVRIFWGWVINGFYHSAVTFI 1109
             FT +P  ++ V DQ VS  +    PQLY++G  R ++   +  W ++++G Y S + F 
Sbjct: 1271 AFTSVPVILLAVLDQDVSDTVSMLVPQLYRVGILRKEWNQTKFLW-YMLDGVYQSVICFF 1329

Query: 1110 GSTLFYRNGNVLNSHGETADHWAWGVSIYTCSVIIVIGKAALVTNQ--WTKFTAFAIPGS 1167
               L Y    V+  +G   DH  + V ++  ++ +      +   Q  W  F    I  S
Sbjct: 1330 FPYLAYHKNMVVTENGLGLDH-RYFVGVFVTAIAVTSCNFYVFMEQYRWDWFCGLFICLS 1388

Query: 1168 LVFWLVFFPIYASILPHANVSKEYYGVVSHVYGSATFWLMCIVLPTFALMRDLVWKYYKR 1227
            L    VF+  +  I   ++ S E+Y   + V+    +W +  V   F L+        ++
Sbjct: 1389 LA---VFYG-WTGIWTSSSSSNEFYKGAARVFAQPAYWAVLFVGVLFCLLPRFTIDCIRK 1444

Query: 1228 TYTPESYHVVQEM----------QKYNIGD-YRPRIEQFQ 1256
             + P+   +V+EM          Q Y+  D  RPRI + +
Sbjct: 1445 IFYPKDIEIVREMWLRGDFDLYPQGYDPTDPSRPRINEIR 1484

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 50/91 (54%)

Query: 197 FGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQQVPNVTPTNRYTTIGTLLIV 256
           +  N I TTKY   TF PK +  +F  +AN++FL    +        TN       L+++
Sbjct: 229 YPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVI 288

Query: 257 LIVSAIKEIVEDLKRAQSDSELNDSRAQVFS 287
           +I++AIK+ +ED +R   D E+N++R  + S
Sbjct: 289 VIITAIKDGIEDSRRTVLDLEVNNTRTHILS 319

>Scas_576.8
          Length = 1591

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/1045 (37%), Positives = 581/1045 (55%), Gaps = 99/1045 (9%)

Query: 293  FTLSKWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIE 352
            F+   W N+ VGDI+++++ + IPAD+I++++S+ +G CY+ET NLDGETNLK++++   
Sbjct: 409  FSKDYWKNVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYLETKNLDGETNLKVRESLKC 468

Query: 353  TSKFIDKDDLAGMRGKVLSEHPNSSLYTYEGTMNL------NGKNISLSPEQMVLRGATL 406
            +    +  D+A  +  V SE P+++LY+Y+G +        + KN  ++   ++LRG TL
Sbjct: 469  SHSIRNSRDIARTKFWVESEGPHANLYSYQGNVKWVDSKDGDLKNEPVTINNLLLRGCTL 528

Query: 407  RNTAWIYGLVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNV 466
            RNT W  G+VVFTG +TK+M N+ ATP K++ + R +N+ +   F  L ++  IS+I N 
Sbjct: 529  RNTKWAMGMVVFTGDDTKIMLNSGATPTKKSRISRELNLSVSLNFLFLFIICFISAIING 588

Query: 467  IKVTSDAEHLTYLYLQGTNKVGLFFKDILTYW---ILFSNLVPISLFVTVEMIKYYQAYM 523
            +          +    GT          +++W   IL+ +LVPISL+++VE+IK  QA  
Sbjct: 589  VDYDKHPRSRDFFEF-GTVAGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAF 647

Query: 524  IASDLDLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIE 583
            I  D+ LY+   D P   ++ ++ +++GQIEYIFSDKTGTLT+NVMEFK C+I G  Y  
Sbjct: 648  IYGDVLLYNAKLDYPCTPKSWNISDDMGQIEYIFSDKTGTLTQNVMEFKKCTINGISYGR 707

Query: 584  TIPEDKAATTE-DGIEIGF----------RKFDSMKETLNDTQD-----PD------SHI 621
               E  A   +  GI++            +  D+M  TL +        PD         
Sbjct: 708  AYTEALAGLRKRQGIDVEEEGRREKEEIAKDRDTMINTLRNLSHNSQFYPDDITFISKEF 767

Query: 622  IND---------------FLTLLATCHTVI--PEFQEDGSIKYQAASPDEGALVEGAASL 664
            +ND               F+  LA CH+V+  P   +   +  +A SPDE ALV  A  +
Sbjct: 768  VNDLKGASGDMQQKCCEHFMLALALCHSVLVEPNKHDSKKLDVKAQSPDEAALVCTARDV 827

Query: 665  GYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRLPNGEIK------LF 718
            G+ FI +      ++IE  G ++E+Q+LN  EFNSTRKRMS I ++P           L 
Sbjct: 828  GFSFIGK--TKTGLIIEVQGVQKEFQILNTLEFNSTRKRMSCIVKIPGANPDDEPRALLI 885

Query: 719  CKGADTVILERL--KAGENP--YIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDI 774
            CKGAD++I  RL  K G N    +E T  HLE YA EGLRTLC+A R ++  EY EW   
Sbjct: 886  CKGADSIIYSRLGTKNGANSENLLEKTALHLEQYATEGLRTLCIAQRELSWPEYLEWNKR 945

Query: 775  YDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLT 834
            YD A+ ++ +R ++L+  ++ IE++L LLG TAIED+LQDGVPE+I  L  AGIK+WVLT
Sbjct: 946  YDIAAASVTNREEQLEAVSDEIERELTLLGGTAIEDRLQDGVPESISILAQAGIKLWVLT 1005

Query: 835  GDRQETAVNIGMSCRLLSEDMNLLII--NEED------------KEATRKNLTEKL---- 876
            GD+ ETA+NIG SC LL+ DM LL++  N +D            +    K L EK     
Sbjct: 1006 GDKVETAINIGFSCNLLNNDMELLVVKTNGDDVQEFGNDPAEIAESLITKYLREKFGLTG 1065

Query: 877  ------KAISDHQISQQDMNSLALVIDGKSLGFXXXXXXXXXX-XXIGKLCKAVICCRVS 929
                   A  +H   + D    A+VIDG++L               + K CKAV+CCRVS
Sbjct: 1066 SEMELADAKKNHDFPRGD---FAVVIDGEALKLALNGESIRRKFLLLCKNCKAVLCCRVS 1122

Query: 930  PLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQF 989
            P QKA VVK+V    D + LAIGDG+NDV+MIQ+A VGVGI+G EG QA   +D+AI QF
Sbjct: 1123 PAQKAAVVKLVMTSLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQF 1182

Query: 990  KYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYN 1049
            +YL +L+LVHG WSY+R+++ I   FYKN+   +  FWY   N + G  + E   + FYN
Sbjct: 1183 RYLTRLVLVHGRWSYRRLAEMIPAFFYKNVIFTLALFWYGIYNNFDGSYLFEYTFLMFYN 1242

Query: 1050 VFFTVLPPFVMGVFDQFVSSRLLDRYPQLYKLG-QRGQFFSVRIFWGWVINGFYHSAVTF 1108
            + FT LP   MG+ DQ VS  +    PQLY+ G  R  +   +  W ++++G Y S + F
Sbjct: 1243 LAFTSLPVIFMGIMDQDVSDTVSLVMPQLYRSGILRLDWNQTKFLW-YMLDGLYQSCICF 1301

Query: 1109 IGSTLFYRNGNVLNSHGETADHWAWGVSIYTCSVIIVIGKAALVTNQ--WTKFTAFAIPG 1166
                  Y    +++++G   DH  + V +   S+ +V     ++ +Q  W  F+   I  
Sbjct: 1302 FFPYCLYHKNQIVSNNGLGLDHRFY-VGVMVTSLAVVSCNIYMLLHQYRWDWFSCLFIGL 1360

Query: 1167 SLVFWLVFFPIYASILPHANVSKEYYGVVSHVYGSATFWLMCIVLPTFALMRDLVWKYYK 1226
            S +    +  +++S L     SKE++   S +YG+ +FW +  V   + L+       ++
Sbjct: 1361 SCIILFFWTGVWSSSL----TSKEFFKAASRIYGAPSFWGVFFVGIVYCLLPRFTLDCFR 1416

Query: 1227 RTYTPESYHVVQEM-QKYNIGDYRP 1250
            + + P    +V+EM Q+ +   Y P
Sbjct: 1417 KFFYPTDVEIVREMWQRGDFSHYPP 1441

 Score = 57.0 bits (136), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 62/130 (47%), Gaps = 13/130 (10%)

Query: 170 RNDYSDD-----DKSSPRQIYIN--------DKEANRARGFGSNHISTTKYNLATFIPKF 216
           R+D  DD       S  R +Y N        D++      +  N I TTKY+   F PK 
Sbjct: 161 RDDIFDDAGLTNRASELRTVYYNMPLPKEMVDEDGKPITDYPRNKIRTTKYSPLNFFPKN 220

Query: 217 LFQEFSKYANLFFLFTSAIQQVPNVTPTNRYTTIGTLLIVLIVSAIKEIVEDLKRAQSDS 276
           +  +F  +AN++FL    +        TN       L++++I++AIK+ +ED +R   D 
Sbjct: 221 IMFQFQNFANVYFLVLIILGAFQIFGVTNPGLAAVPLIVIVIITAIKDAIEDSRRTLLDM 280

Query: 277 ELNDSRAQVF 286
           E+N++R  + 
Sbjct: 281 EVNNTRTHIL 290

>Scas_704.38
          Length = 1161

 Score =  436 bits (1121), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 329/1078 (30%), Positives = 526/1078 (48%), Gaps = 93/1078 (8%)

Query: 176  DDKSSPRQIYINDKEANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAI 235
            DD+   R+I+ +         +  N IS  KYN  TFIP  L+++F  + NL+FL  +  
Sbjct: 159  DDRHMEREIHPSTTPVYDRNRYPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALS 218

Query: 236  QQVPNVTPTNRYTTIGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVFSEQLQDFTL 295
            Q +P +      + +  L  VL V+  KE ++D++R + D+E N     V ++      L
Sbjct: 219  QAIPALRIGYLSSYVVPLAFVLTVTMSKEAMDDIQRRRRDNESNSELYHVLNQS----KL 274

Query: 296  SKWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSK 355
                ++ VGD+IK++  + +PAD++++ SSEP G  +I+T  LDGET+ K++ A   T  
Sbjct: 275  VPSKDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQN 334

Query: 356  FIDKDDLAGMRGKVLSEHPNSSLYTYEGTMNLNGKNIS-LSPEQMVLRGATLRNTAWIYG 414
              + D +   +  + +  P  +++ + G +     + + LS +  +     L +T +  G
Sbjct: 335  LTEPDLMN--KVSITASAPEKAIHNFLGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIG 392

Query: 415  LVVFTGHETKLMRNATATPIKRTAVERVIN----MQIVALFGVLIVLALISSIGNVIKVT 470
             VV+TG +T+   N T   +K   +E  IN    +   ++F + I+L + +   N     
Sbjct: 393  CVVYTGRDTRQAMNTTTATVKTGLLELEINSISKILCASVFALSIILVVFAGFHN----- 447

Query: 471  SDAEHLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDL 530
            SD                 ++ D++ Y ILFS ++P+SL V +++ K   A+ I  D D 
Sbjct: 448  SD-----------------WYLDVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHD-DT 489

Query: 531  YDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYI-ETIPEDK 589
              E     T+VRTS++ E+LG+IEY+ SDKTGTLT+N M+ K   +    Y  ET+  D 
Sbjct: 490  IPE-----TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETL--DI 542

Query: 590  AATTEDGIEIGFRKFDSMKETLNDTQDPD-SHIINDFLTLLATCHTVIPEFQEDGSIKYQ 648
             +   D +       +   +++  T   D S  + D +  LA CH V P F ED  + YQ
Sbjct: 543  VSDYVDALVNSSNSANPSGKSVPSTSRKDLSARVRDMVVTLAICHNVTPTF-EDDELTYQ 601

Query: 649  AASPDEGALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIF 708
            AASPDE A+V+   S+G     R  +S+S+L    G    Y++L +  FNS  KRM  I 
Sbjct: 602  AASPDEIAIVKFTESVGLSLFKRDRHSISLLHGHSGSILTYEILQVFPFNSDSKRMGIIV 661

Query: 709  RLPNGEIKLFC-KGADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESE 767
                 +   F  KGADTV+   ++   N ++E    ++   A EGLRTL +  + ++ + 
Sbjct: 662  HDEQKDEYWFMQKGADTVMARIVE--NNDWLEEETGNM---AREGLRTLVVGRKKLSRNI 716

Query: 768  YAEWKDIYDAASTTLDDRAQKLDDA-AELIEKDLFLLGATAIEDKLQDGVPETIHTLQDA 826
            Y ++K  YD AS ++ +R Q+++    + +E DL LLG T +EDKLQ+ V  +I  L++A
Sbjct: 717  YDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNA 776

Query: 827  GIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQ 886
            GIK+W+LTGD+ ETA  + +S +L+S    + II +  K     N  E LK         
Sbjct: 777  GIKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKV-------- 828

Query: 887  QDMNSLALVIDGKSLGFXXXXXXXXXXXXIGKLC-KAVICCRVSPLQKALVVKMVKRKTD 945
                   L+IDG+SLG             +  +C   V+ CR +P QKA V  +++  T 
Sbjct: 829  --NKGACLLIDGESLGMFLRYYKREFFDVV--ICLPTVVACRCTPQQKADVALVIREFTG 884

Query: 946  SLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQ 1005
              +  IGDG NDVSMIQ A VGVGI G EG QA+ +ADF+I +F +L +LLL HG  SY+
Sbjct: 885  KRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLTELLLWHGRNSYK 944

Query: 1006 RISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQ 1065
            R ++   +  ++ + + + Q  Y   + +    + + + M  Y   +T+ P F M   D 
Sbjct: 945  RSAKLAQFIMHRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCYTMAPVFSM-TLDH 1003

Query: 1066 FVSSRLLDRYPQLYKLGQRGQFFSVRIFWGWVINGFYHSAVTFIGSTLFYRNGNVLNSHG 1125
             +   L   YP+LYK    G+  S + F+ W     +   V    S +F     V     
Sbjct: 1004 DIEESLTKIYPELYKDLTEGKSLSYKTFFVWCALSLFQGCVIQGCSQVFSSLLEV----- 1058

Query: 1126 ETADHWAWGVSIYTCSVIIVIGKAALVTNQWTKFTAFAIPGSLVFWLVFFPIYASILPHA 1185
            +     A G +    + +I++   AL    W K   F    + + +++  P         
Sbjct: 1059 DFTKMVAIGFTALILNELIMV---ALEIYTWNKIMVFTEILTFLCYVISVPFLG------ 1109

Query: 1186 NVSKEY----YGVVSHVYGSATFWLMCIVLPTFALMRDLVWKYYKRTYTPESYHVVQE 1239
                EY    Y +    YG   F L+  V P +A       K   R   P SY  VQE
Sbjct: 1110 ----EYFDLKYMMTLRFYGELLFILLVSVFPVWAA------KAIHRRLHPPSYAKVQE 1157

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score =  434 bits (1116), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 331/1081 (30%), Positives = 523/1081 (48%), Gaps = 105/1081 (9%)

Query: 177  DKSSPRQIYINDKEANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQ 236
            D+   R+I+ +         + SN IS  KYN  TFIP  L+++F  + NL+FL  +  Q
Sbjct: 146  DQHVEREIHPDTTPIYDKNKYPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQ 205

Query: 237  QVPNVTPTNRYTTIGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVFSEQLQDFTLS 296
             +P +      + I  L  VL+V+  KE ++D++R Q D E N+   +V ++      L 
Sbjct: 206  AIPALRIGYLSSYIVPLAFVLMVTMSKEAMDDIQRRQRDKESNNELYEVLNKA----QLV 261

Query: 297  KWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKF 356
               ++ VGD+IK++    IPAD++++ SSEP G  +I+T  LDGET+ K++ A    ++ 
Sbjct: 262  PSKDLKVGDLIKIHKGTRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVA-CSLTQN 320

Query: 357  IDKDDLAGMRGKVLSEHPNSSLYTYEGTMNL-NGKNISLSPEQMVLRGATLRNTAWIYGL 415
            +  DDL   +  + +  P  S++ + G +   +  + +LS +  +     L +     G 
Sbjct: 321  LSTDDLLN-KISITASSPEKSIHRFLGKLTYKDSSSNALSVDNTMWANTVLASVGSCIGC 379

Query: 416  VVFTGHETKLMRNATATPIKRTAVERVIN----MQIVALFGVLIVLALISSIGNVIKVTS 471
            VV+TG +T+   N T + +K   +E  IN    +    +F + IVL   +  GN      
Sbjct: 380  VVYTGTDTRQAMNTTMSSVKTGLLELEINSLSKILCACVFVLSIVLVAFAGFGN------ 433

Query: 472  DAEHLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLY 531
                              ++ DI+ Y ILFS ++P+SL V +++ K   A  I  D  + 
Sbjct: 434  ----------------KDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIEHDATIP 477

Query: 532  DEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAA 591
            D      T+VRTS++ E+LG+IEY+ SDKTGTLT+N M+ K   +    Y          
Sbjct: 478  D------TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSY---------- 521

Query: 592  TTEDGIEIGFRKFDSMKETLNDTQDPDS-------HIINDFLTLLATCHTVIPEFQEDGS 644
             T D ++I       +  +   T  P S       + + D +  LA CH V P F EDG 
Sbjct: 522  -TMDTMDIVTDYVQELVSSSTTTPMPQSTAKKDLPNRVRDLVVTLAICHNVTPTF-EDGE 579

Query: 645  IKYQAASPDEGALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRM 704
            + YQAASPDE A+V+   S+G     R  +SVS+  +      EY +L +  FNS  KRM
Sbjct: 580  LTYQAASPDEIAIVKFTESVGLSLFKRDRHSVSLFHQHSATNFEYDILQVFPFNSDTKRM 639

Query: 705  SAI-FRLPNGEIKLFCKGADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTV 763
              I +    GE     KGADTV+   +++  N +++  + ++   A EGLRTL +  + +
Sbjct: 640  GIIVYDKVKGEHWFMQKGADTVMARIVQS--NDWLDEEVGNM---AREGLRTLVIGRKKL 694

Query: 764  TESEYAEWKDIYDAASTTLDDRAQKLDDA-AELIEKDLFLLGATAIEDKLQDGVPETIHT 822
            +   Y +++  Y  AS ++ +R + +     + +E +L LLG T +EDKLQ+ V  +I  
Sbjct: 695  SPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIEL 754

Query: 823  LQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDH 882
            L++AG+K+W+LTGD+ ETA  + +S +L+S    +  + +  +     N  E LK     
Sbjct: 755  LRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKI---- 810

Query: 883  QISQQDMNSLALVIDGKSLGFXXXXXXXXXXXXIGKLCKAVICCRVSPLQKALVVKMVKR 942
                    S  L+IDG+SLG             +  L  AVI CR +P QKA V  +++ 
Sbjct: 811  ------NKSSCLLIDGESLGMFLTYYKQEFFDIVVDL-PAVIACRCTPQQKADVALLIRE 863

Query: 943  KTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSW 1002
             T   +  IGDG NDVSMIQ A VGVGI G EG QA+ +ADF++ QF +L KLLL HG  
Sbjct: 864  ITGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRN 923

Query: 1003 SYQRISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGV 1062
            SY+R ++   +  ++ + + + Q  Y   + +   ++ + W M  Y   +T+ P F +  
Sbjct: 924  SYKRSAKLAQFVIHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYATCYTMAPVFSL-T 982

Query: 1063 FDQFVSSRLLDRYPQLYKLGQRGQFFSVRIFWGWVINGFYHSAVTFIGSTLFYRNGNVLN 1122
             D  +   L   YP+LYK    G   S + F+ WVI   +        S  F        
Sbjct: 983  LDHDIDESLTKIYPELYKELTAGTSLSYKTFFVWVILSLFQGCAIQGISQYF-------- 1034

Query: 1123 SHGETADHWAWGVSIYTCSVIIVIGKAALVTNQWTKFTAFAIPGSLVFWLVFFPIYASIL 1182
            +  +  D        +T  VI  +   AL    W K         ++  +V F IY   +
Sbjct: 1035 TSLDEVDFKKLVALSFTALVINELIMVALEIYTWNK-------TMVITEIVTFLIYVVSV 1087

Query: 1183 PHANVSKEYYGV--VSHV--YGSATFWLMCIVLPTFALMRDLVWKYYKRTYTPESYHVVQ 1238
            P  +   EY+ +  VS +  Y    F L   V P +A       K   R   P +Y  VQ
Sbjct: 1088 PFLS---EYFDLTFVSQLPFYAKLIFILAVSVFPVWAA------KAIHRKINPPNYAKVQ 1138

Query: 1239 E 1239
            +
Sbjct: 1139 Q 1139

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..548354)
            [3501 bp, 1166 aa]
          Length = 1166

 Score =  434 bits (1116), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 326/1074 (30%), Positives = 540/1074 (50%), Gaps = 90/1074 (8%)

Query: 177  DKSSPRQIYINDKEANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQ 236
            D+   R+I+++       R + +N IS  KYN  TF+P  L+++F  + NL+FL  S  Q
Sbjct: 168  DQHVDREIHLDTTPIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQ 227

Query: 237  QVPNVTPTNRYTTIGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVFSEQLQDFTLS 296
             +P +      + I  L  VL+V+  KE ++D++R + D E N+   +V    L +  L 
Sbjct: 228  SIPALRIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEV----LNNSQLV 283

Query: 297  KWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKF 356
               N+ VGD++K++ +  IPAD+I++ SSEP G  +++T  LDGET+ K++ A   T   
Sbjct: 284  PSKNLRVGDLVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNL 343

Query: 357  IDKDDLAGMRGKVLSEHPNSSLYTYEGTMNLNGKNISLSPEQMVLRGATLRNTAWIYGLV 416
               + L  +   + +  P  S++ + G +   G +  LS +  +     L ++      V
Sbjct: 344  TQDEMLTKVH--ITASAPEKSIHMFTGKLTYKGSSAPLSVDNTLWANTVLASSGTCVACV 401

Query: 417  VFTGHETKLMRNATATPIKRTAVERVIN----MQIVALFGVLIVLALISSIGNVIKVTSD 472
            ++TG +T+   N + + +K   +E  IN    +  + +F + I+L +I  + +       
Sbjct: 402  IYTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLDD------- 454

Query: 473  AEHLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLYD 532
                             ++ DI+ Y ILFS ++P+SL V +++ K   A  I SD  + D
Sbjct: 455  ---------------DKWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSIPD 499

Query: 533  EASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCY-IETIP--EDK 589
                  T+VRTS++ E+LG+IEY+ SDKTGTLT+N M+ +   +    Y +ET+    D 
Sbjct: 500  ------TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTMETMDMVTDY 553

Query: 590  AATTEDGIEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQEDGSIKYQA 649
              T      +G     +    +  ++   S  + D +  LATCH V P F ED  + YQA
Sbjct: 554  IQTLTSPANMG-----AAGVAVTGSRKEVSQRVRDLVVTLATCHNVTPNF-EDNELAYQA 607

Query: 650  ASPDEGALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFR 709
            ASPDE A+V+    +G     R  +S+++  E  G   +Y +L++  F S  KRM  I R
Sbjct: 608  ASPDEIAIVKFTERVGLSLFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVR 667

Query: 710  -LPNGEIKLFCKGADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEY 768
                 EI    KGADTV+ + +++  N ++E     + + A EGLRTL +A + ++   Y
Sbjct: 668  DRTKNEIWFLQKGADTVMSKIVQS--NDWLE---EEVSNMAREGLRTLVIARKKLSTRLY 722

Query: 769  AEWKDIYDAASTTLDDRAQKLDDAAEL-IEKDLFLLGATAIEDKLQDGVPETIHTLQDAG 827
             ++   Y  AS ++ +R + +++  +  +E +L LLG T +EDKLQ  V  +I  L++AG
Sbjct: 723  EQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAG 782

Query: 828  IKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQ 887
            +K+W+LTGD+ ETA  + +S +L+S    +  I +         LT +  A+S  +  + 
Sbjct: 783  VKIWMLTGDKVETARCVCVSAKLISRGQYVHTITK---------LTRRDGALSRLEYLKA 833

Query: 888  DMNSLALVIDGKSLGFXXXXXXXXXXXXIGKLC-KAVICCRVSPLQKALVVKMVKRKTDS 946
            + NS  L+IDG SL              +  +C   VI CR +P QKA V  +++  T  
Sbjct: 834  NRNS-CLLIDGDSLAIYMSHYRAEFFEIV--ICLPVVIACRCTPQQKADVALLIREMTGK 890

Query: 947  LLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQR 1006
             +  IGDG NDVSMIQ A VGVGI G EG QA+ +AD++I QF +L KLLL HG  SY+R
Sbjct: 891  RVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLWHGRNSYKR 950

Query: 1007 ISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQF 1066
             ++   +  ++ + + + Q  Y  ++     ++ + W M  Y   +T+ P F +   D  
Sbjct: 951  SAKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPVFSL-TLDHD 1009

Query: 1067 VSSRLLDRYPQLYKLGQRGQFFSVRIFWGWVINGFYHSAVTFIGSTLFYRNGNVLNSHGE 1126
            +   L   YP+LYK    G+  S + F+ WVI   +  AV    S LF          G 
Sbjct: 1010 IDESLTKTYPELYKELTEGRSLSYKTFFVWVILSLFQGAVIQGFSQLFI---------GV 1060

Query: 1127 TADHWAWGVSI-YTCSVIIVIGKAALVTNQWTKFTAFAIPGSLVFWLVFFPIYASILPHA 1185
             ++ +   V++ +T  VI  +   AL    W K  A +        +V F IY   +P  
Sbjct: 1061 GSEVFKKMVALSFTALVINELIMVALEIYTWNKTMAIS-------EIVTFAIYVLSIP-- 1111

Query: 1186 NVSKEYYGVVSHVYGSATFWLMCIVLPTFALMRDLVWKYYKRTYTPESYHVVQE 1239
             +  EY+ + S +  +  F++   ++ T ++      K   R   P S+  VQ+
Sbjct: 1112 -LLGEYFDLTSML--ALPFFIQLTIILTVSIFPVWAAKTIHRRLKPPSHAKVQQ 1162

>KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, start by similarity
          Length = 1148

 Score =  432 bits (1112), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 356/1178 (30%), Positives = 551/1178 (46%), Gaps = 116/1178 (9%)

Query: 25   PIGQRNQNSNNPFNEAQVVDSDYDLLEDVRRGHIPQETMNLDLHSTTLPE-ADNIENDIV 83
            P G +  N  +  N+ Q   +D D   D++     +++++  L S  LPE +   EN  V
Sbjct: 6    PPGSQIPNKYSKSNQHQAQSTDRDSF-DLQF----EDSLDAALESLQLPEHSHRRENSTV 60

Query: 84   QNPFSDERRARSSSHNQGVVHLTPQNGSAFQRAINKIKKGLGRSGSGNSYQGFEMHNYDD 143
               F  E ++    H  G++H             N      GR                 
Sbjct: 61   FEDF--EMKSMHGDHQTGMLHSDADTAPLITNHSNN-----GRM---------------- 97

Query: 144  LGNDDRYAKSRNKFDI----KIIFKRYILRRND-------YSDDDKSSPRQIYINDKEAN 192
            L N DR A++ N   +    K  F+    +          YS  +     +I +ND    
Sbjct: 98   LSNSDRNAQNTNNITVWSKAKSWFEHSFTKAKSKPSSLSVYSSTNSVDGNKIELNDHNVE 157

Query: 193  RA-----------RGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQQVPNV 241
            R            + + SN IS  KYN  TFIP  L+++F  + NL+FL  +  Q +P +
Sbjct: 158  REIHPATTPIYDRKKYPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQL 217

Query: 242  TPTNRYTTIGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVFSEQLQDFTLSKWVNI 301
                  + I  L  VL V+  KE ++D+ R + D E N+   +V ++       SK  ++
Sbjct: 218  RIGYLSSYIVPLAFVLTVTMSKEAMDDINRRKRDREANNELYEVVNKPCP--IPSK--DL 273

Query: 302  SVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKFIDKDD 361
             VGDIIK+     +PADV+V+ ++EP G  +I+T  LDGET+ K++ A   T    + D 
Sbjct: 274  KVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSLTENDL 333

Query: 362  LAGMRGKVLSEHPNSSLYTYEGTMNLNGKNIS-LSPEQMVLRGATLRNTAWIYGLVVFTG 420
            L  +   + +  P  S++ + G +       S LS +  +     L ++A     +V+TG
Sbjct: 334  LNNI--TITASAPEHSIHNFLGKITYKDSTSSPLSVDNTMWENTVLASSAACICCIVYTG 391

Query: 421  HETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNVIKVTSDAEHLTYLY 480
             ET+   N T +  K   +E  IN     L  +L     + SI               + 
Sbjct: 392  RETRQALNTTKSKAKTGLLELEIN----GLSKILCACVFLLSI-------------MLVA 434

Query: 481  LQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLYDEASDSPTV 540
              G N    ++ DI+ Y ILFS ++P+SL V +++ K   AY I  D  + D      T+
Sbjct: 435  FAGFNN-NDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIED------TI 487

Query: 541  VRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAATTEDGIEIG 600
            VRTS++ E+LG+IEY+ SDKTGTLT+N M+ K   +    Y     E     T+    + 
Sbjct: 488  VRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTN---ETMDIVTDFIQSMN 544

Query: 601  FRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQEDGSIKYQAASPDEGALVEG 660
             R  +S   T   T+   S  + D +T LA CH V P F EDG + YQAASPDE A+V+ 
Sbjct: 545  SRTSNSTPTT---TRKNISDRVIDLVTTLAICHNVTPTF-EDGELTYQAASPDEIAIVKF 600

Query: 661  AASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAI-FRLPNGEIKLFC 719
              S+G     R  +S+S+  +  G + EY +  +  FNS  KRM  I F     E     
Sbjct: 601  TESVGLSLFRRDRHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGVIIFDKLKQEYWFLQ 660

Query: 720  KGADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAAS 779
            KGADTV+   +    N ++E       + A EGLRTL +  + ++ + + +++  Y  AS
Sbjct: 661  KGADTVMSSIVV--RNDWLE---EETSNMATEGLRTLVIGRKKLSTNLFEQFEKEYSEAS 715

Query: 780  TTLDDRAQKLDDAA-ELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQ 838
             T+ DR   + +   + +E DL LLG T +EDKLQ  V  +I  L++AGIK+W+LTGD+ 
Sbjct: 716  LTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKV 775

Query: 839  ETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDG 898
            ETA  + +S +L+S    +  + + +K     +  E L      Q++Q       L+IDG
Sbjct: 776  ETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYL------QVNQNS----CLLIDG 825

Query: 899  KSLGFXXXXXXXXXXXXIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDV 958
            +SLG             +  L   V+ CR +P QKA V   +++ T   +  IGDG NDV
Sbjct: 826  ESLGLYLQYFPDEFFDIVVNL-PTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGGNDV 884

Query: 959  SMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQRISQAILYSFYKN 1018
            SMIQ A VGVGI G EG QA+ +ADF+I QF +L KLLL HG  SY+  ++   +  ++ 
Sbjct: 885  SMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQFVIHRG 944

Query: 1019 IALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQFVSSRLLDRYPQL 1078
            + + + Q  Y   + +   ++ + W M  Y   +T+ P F +   D  +   L   YP+L
Sbjct: 945  LIISVCQAVYSICSMFEPLALYQGWLMVGYATCYTMAPVFSL-TLDHDIDESLTTLYPEL 1003

Query: 1079 YKLGQRGQFFSVRIFWGWVINGFYHSAVTFIGSTLFYRNGNVLNSHGETADHWAWGVSIY 1138
            YK    G+  S + F+ WV    +   V  + S  F      LN    T    A   +  
Sbjct: 1004 YKELTLGKSLSFKTFFVWVALSVFQGCVIQMASQFF----TSLNDSDFTK-MVAISFTAL 1058

Query: 1139 TCSVIIVIGKAALVTNQWTKFTAFAIPGSLVFWLVFFP 1176
              + +I++G   L  N W K  A     +L+ +L   P
Sbjct: 1059 VLNELIMVG---LEINTWNKIMAITEVVTLLIYLGSIP 1093

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, hypothetical start
          Length = 1144

 Score =  431 bits (1109), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 301/937 (32%), Positives = 484/937 (51%), Gaps = 60/937 (6%)

Query: 177  DKSSPRQIYINDKEANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQ 236
            D+ + R+++    +      F SN +S  KYN  TF+P  L+++F  + NL+FL  +  Q
Sbjct: 144  DEHTEREVHPGTTQVYDRHRFPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQ 203

Query: 237  QVPNVTPTNRYTTIGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVFSEQLQDFTLS 296
             +P +      + +  L  VL V+  KE  +D++R + D E N    +V          S
Sbjct: 204  AIPALRIGYLSSYVVPLAFVLTVTMAKEASDDIQRRRRDRESNMELYEVLGRPRP--VAS 261

Query: 297  KWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKF 356
            K  ++ VGD+IK++    +PAD+I++ SSEP G  +I+T  LDGET+ K++ A   T   
Sbjct: 262  K--DLKVGDLIKISKGARVPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLTQN- 318

Query: 357  IDKDDLAGMRGKVLSEHPNSSLYTYEGTMNLNGKNIS-LSPEQMVLRGATLRNTAWIYGL 415
            +++DDL   +  + +  P  S++++ G +     N S L+ +  +     L ++ +  G 
Sbjct: 319  LNEDDLLE-KITITASAPEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASSGFCIGC 377

Query: 416  VVFTGHETKLMRNATATPIKRTAVERVIN----MQIVALFGVLIVLALISSIGNVIKVTS 471
            V++TG +T+   N T+  +K   +E  IN    +    +F + I+L + + + N      
Sbjct: 378  VIYTGRDTRQAMNTTSAKVKTGLLELEINDISKILCACVFILSILLVVFAGLHN------ 431

Query: 472  DAEHLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLY 531
                              ++ DI+ Y ILFS ++P+SL V +++ K   A+ I  D  + 
Sbjct: 432  ----------------DDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIP 475

Query: 532  DEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAA 591
            +      T+VRTS++ E+LG+IEY+ SDKTGTLT+N M+ K   +    Y     +  + 
Sbjct: 476  E------TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSD 529

Query: 592  TTEDGIEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQEDGSIKYQAAS 651
              +  IE       ++       +D  +H+I D +T LA CH V P F ED  + YQAAS
Sbjct: 530  YIQGMIESKNDSVTNLGPRSTTRKDAATHVI-DLITTLAICHNVTPTF-EDDELTYQAAS 587

Query: 652  PDEGALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRLP 711
            PDE A+V+   S+G     R  +S+S+L E  G    Y +L +  FNS  KRM  I    
Sbjct: 588  PDEIAIVKFTESVGLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDK 647

Query: 712  NGEIKLFC-KGADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAE 770
              +   F  KGADTV + R+ A  N ++E    ++   A EGLRTL +  + +T+  Y +
Sbjct: 648  QKDQYWFLQKGADTV-MNRIVAN-NDWLEEETGNM---AREGLRTLVIGRKKLTKKIYEQ 702

Query: 771  WKDIYDAASTTLDDRAQKLDDA-AELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIK 829
            +K  Y+  S ++ +R Q++ +  ++ +E DL LLG T +EDKLQ  V  +I  L++AGIK
Sbjct: 703  FKKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIK 762

Query: 830  VWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDM 889
            +W+LTGD+ ETA  + +S +L+S    + ++ +  K     N  E LK            
Sbjct: 763  IWMLTGDKVETARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKV----------N 812

Query: 890  NSLALVIDGKSLGFXXXXXXXXXXXXIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLL 949
             +  L+IDG+SLG             +  L   VI CR +P QKA V  +++  T   + 
Sbjct: 813  KNACLLIDGESLGMFLKYYRQEFFDVVVHL-PTVIACRCTPQQKADVALIIRELTGKRVC 871

Query: 950  AIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQRISQ 1009
             IGDG NDVSMIQ A VGVGI G EG QA+ +ADF+I QF +L +LLL HG  SY+R ++
Sbjct: 872  CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAK 931

Query: 1010 AILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQFVSS 1069
               +  ++ + + + Q  +   + +   ++ + W M  Y   +T+ P F +   D  +  
Sbjct: 932  LAQFVMHRGLIIAICQAVFSVCSQFEPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIDE 990

Query: 1070 RLLDRYPQLYKLGQRGQFFSVRIFWGWVINGFYHSAV 1106
             L   YP+LYK    G+  S + F+ WV   FY   V
Sbjct: 991  SLTKMYPELYKDLTEGKSLSYKTFFVWVALSFYQGLV 1027

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-like
            ATPases family in the superfamily of P-type ATPases,
            overproduction confers neomycin resistance [3456 bp, 1151
            aa]
          Length = 1151

 Score =  429 bits (1103), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 328/1073 (30%), Positives = 530/1073 (49%), Gaps = 85/1073 (7%)

Query: 177  DKSSPRQIYINDKEANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQ 236
            D+   R+I+ +         + SN +S  KYN  TF+P  L+++F  + NL+FL  +  Q
Sbjct: 150  DQHIEREIHPDTTPVYDRNRYVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQ 209

Query: 237  QVPNVTPTNRYTTIGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVFSEQLQDFTLS 296
             VP +      + I  L  VL V+  KE ++D++R + D E N+    V +        S
Sbjct: 210  AVPALRIGYLSSYIVPLAFVLTVTMAKEAIDDIQRRRRDRESNNELYHVITRNRS--IPS 267

Query: 297  KWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKF 356
            K  ++ VGD+IKV+  + IPAD++++ SSEP G  +I+T  LDGET+ K++ A    ++ 
Sbjct: 268  K--DLKVGDLIKVHKGDRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVA-CPLTQN 324

Query: 357  IDKDDLAGMRGKVLSEHPNSSLYTYEGTMNL-NGKNISLSPEQMVLRGATLRNTAWIYGL 415
            + ++DL   R  + +  P  S++ + G +   +  +  LS +  +     L ++ +    
Sbjct: 325  LSENDLIN-RISITASAPEKSIHKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFCIAC 383

Query: 416  VVFTGHETKLMRNATATPIKRTAVERVIN----MQIVALFGVLIVLALISSIGNVIKVTS 471
            VV+TG +T+   N T   +K   +E  IN    +    +F + I+L   +   N      
Sbjct: 384  VVYTGRDTRQAMNTTTAKVKTGLLELEINSISKILCACVFALSILLVAFAGFHN------ 437

Query: 472  DAEHLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLY 531
                              ++ DIL Y ILFS ++P+SL V +++ K   A+ I  D  + 
Sbjct: 438  ----------------DDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTIP 481

Query: 532  DEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAA 591
            +      T+VRTS++ E+LG+IEY+ SDKTGTLT+N M+ K   +    Y     +  + 
Sbjct: 482  E------TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSD 535

Query: 592  TTEDGIEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQEDGSIKYQAAS 651
              +  +       ++ K  L+ T+   S  + D +  LA CH V P F ED  + YQAAS
Sbjct: 536  YVQSLVSSKNDSLNNSKVALSTTRKDMSFRVRDMILTLAICHNVTPTF-EDDELTYQAAS 594

Query: 652  PDEGALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRLP 711
            PDE A+V+   S+G     R  +S+S+L E  G+   Y++L +  FNS  KRM  I R  
Sbjct: 595  PDEIAIVKFTESVGLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDE 654

Query: 712  N-GEIKLFCKGADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAE 770
               E     KGADTV+ + +++  N ++E    ++   A EGLRTL +  + + +  Y +
Sbjct: 655  QLDEYWFMQKGADTVMSKIVES--NDWLEEETGNM---AREGLRTLVIGRKKLNKKIYEQ 709

Query: 771  WKDIYDAASTTLDDRAQKLDDA-AELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIK 829
            ++  Y+ AS ++ +R Q++     + +E DL LLG T +EDKLQ  V  +I  L++AGIK
Sbjct: 710  FQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIK 769

Query: 830  VWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDM 889
            +W+LTGD+ ETA  + +S +L+S    +  I +  +     N  E LK          + 
Sbjct: 770  IWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKI---------NR 820

Query: 890  NSLALVIDGKSLGFXXXXXXXXXXXXIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLL 949
            N+  L+IDG+SLG             +  L   VI CR +P QKA V  ++++ T   + 
Sbjct: 821  NA-CLLIDGESLGMFLKHYEQEFFDVVVHL-PTVIACRCTPQQKADVALVIRKMTGKRVC 878

Query: 950  AIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQRISQ 1009
             IGDG NDVSMIQ A VGVGI G EG QA+ +ADF+I QF +L +LLL HG  SY+R ++
Sbjct: 879  CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAK 938

Query: 1010 AILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQFVSS 1069
               +  ++ + + + Q  Y   + +   ++ + W M  Y   +T+ P F +   D  +  
Sbjct: 939  LAQFVMHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIEE 997

Query: 1070 RLLDRYPQLYKLGQRGQFFSVRIFWGWVINGFYHSAVTFIGSTLFYRNGNVLNSHGETAD 1129
             L   YP+LYK    G+  S + F+ WV+   +  +V  + S  F    ++L++      
Sbjct: 998  SLTKIYPELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQLFSQAF---TSLLDT------ 1048

Query: 1130 HWAWGVSI-YTCSVIIVIGKAALVTNQWTKFTAFAIPGSLVFWLVFFPIYASILPHANVS 1188
             +   V+I +T  V+  +   AL    W K        +L+F++V  P            
Sbjct: 1049 DFTRMVAISFTALVVNELIMVALEIYTWNKTMLVTEIATLLFYIVSVPFLGDYFDLG--- 1105

Query: 1189 KEYYGVVSHVYGSATFWLMCIVLPTFALMRDLVW--KYYKRTYTPESYHVVQE 1239
               Y    + Y      L+  + P        VW  K   R   P SY  VQE
Sbjct: 1106 ---YMTTVNYYAGLLVILLISIFP--------VWTAKAIYRRLHPPSYAKVQE 1147

>Kwal_23.5789
          Length = 1133

 Score =  422 bits (1086), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 301/940 (32%), Positives = 483/940 (51%), Gaps = 68/940 (7%)

Query: 176  DDKSSPRQIYINDKEANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAI 235
            DD+   R+I+ +         +  N IS  KYN  TFIPK L+++F  + NL+FL  +  
Sbjct: 135  DDQQLDREIHPSTTPVYDRYKYAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALS 194

Query: 236  QQVPNVTPTNRYTTIGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVFSEQLQDFTL 295
            Q +P +      + I  L  VL V+  KE ++D++R + D E N+   +V S+      L
Sbjct: 195  QAIPALRIGYLSSYIVPLAFVLTVTMSKEALDDIQRRRRDRESNNELYEVLSKS----QL 250

Query: 296  SKWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSK 355
                ++ VGD+IK+      PAD++++ SSEP G  +I+T  LDGET+ K++ A    ++
Sbjct: 251  VPSKDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIA-CPLTQ 309

Query: 356  FIDKDDLAGMRGKVLSEHPNSSLYTYEGTMNLNG-KNISLSPEQMVLRGATLRNTAWIYG 414
             + +DDL   R  + +  P  S+  + G +     ++  LS +  +       +      
Sbjct: 310  HLSQDDLL-YRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAIA 368

Query: 415  LVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNVIKVTSDAE 474
             VV+TG +T+   N + + +K   +E  IN    +L  +L     I S+  V        
Sbjct: 369  CVVYTGADTRQAMNTSMSSVKTGLLELEIN----SLSKILCACVFILSVALVA------- 417

Query: 475  HLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLYDEA 534
                    G N    ++ DI+ Y ILFS ++P+SL V +++ K   A+ I  D      +
Sbjct: 418  ------FAGFNNND-WYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHD------S 464

Query: 535  SDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAATTE 594
            +   T+VRTS++ E+LG+IEY+ SDKTGTLT+N ME K   +    Y           T 
Sbjct: 465  TIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSY-----------TM 513

Query: 595  DGIEIGFRKFDSMKETLNDTQDPDSHI------INDFLTLLATCHTVIPEFQEDGSIKYQ 648
            D ++I      +M + LN +  P +        + D +  LA CH V P F EDG + YQ
Sbjct: 514  DTMDIVTDYVRAMSDNLNSSAVPSASKKDLPGRVRDLVLTLALCHQVTPTF-EDGELTYQ 572

Query: 649  AASPDEGALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMS-AI 707
            AASPDE A+V+   S+G     R  +S+++L +  G   EY +L++  FNS  KRM   I
Sbjct: 573  AASPDEIAIVKFTESVGLTLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVI 632

Query: 708  FRLPNGEIKLFCKGADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESE 767
            F     E     KGAD V+ + ++  +N ++E    +L   A EGLRTL +  + +++  
Sbjct: 633  FDKQKDEYWFLQKGADVVMSKIVQ--KNDWLEEETGNL---AREGLRTLVIGRKRLSKKL 687

Query: 768  YAEWKDIYDAASTTLDDRAQKLDDA-AELIEKDLFLLGATAIEDKLQDGVPETIHTLQDA 826
               +   Y+ AS  + +R   + +  ++ +E DL +LG T +EDKLQ+ V  +I  L++A
Sbjct: 688  LQTFTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNA 747

Query: 827  GIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQ 886
            GIK+W+LTGD+ ETA  + +S +L+S    +  + + +K            A++  ++ +
Sbjct: 748  GIKIWMLTGDKVETARCVSISAKLVSRGQYVHTVTKVNKPE---------GALTHLELLK 798

Query: 887  QDMNSLALVIDGKSLGFXXXXXXXXXXXXIGKLCKAVICCRVSPLQKALVVKMVKRKTDS 946
             + NS  L+IDG+SLG             +  L  AVI CR +P QKA V   ++  T  
Sbjct: 799  INTNS-CLLIDGESLGLYLEYYRQQFFEIVVNL-PAVIACRCTPQQKADVATFIREVTGK 856

Query: 947  LLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQR 1006
             +  IGDG NDVSMIQ+A VGVGI G EG QA+ +ADF+I QF +L KLLL HG  SY+R
Sbjct: 857  RVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCHLSKLLLWHGRNSYKR 916

Query: 1007 ISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQF 1066
             ++   +  ++ + + + Q  Y  ++ +   ++ + W M  Y   +T+ P F +   D  
Sbjct: 917  SAKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGWLMVGYATCYTMAPVFSL-TLDHD 975

Query: 1067 VSSRLLDRYPQLYKLGQRGQFFSVRIFWGWVINGFYHSAV 1106
            +   L   YP+LYK    G+  S + F+ WV+   +   V
Sbjct: 976  IDESLTKTYPELYKELTAGKSLSYKTFFVWVVLSLFQGCV 1015

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score =  337 bits (864), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 189/533 (35%), Positives = 307/533 (57%), Gaps = 35/533 (6%)

Query: 721  GADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAAST 780
            G+D +I     + E   +E TL  +E ++ EGLRTL  A + ++  ++ +W+  Y  A T
Sbjct: 946  GSDALI-----SNEEYVLEKTLEDIESFSTEGLRTLLFAHKWISNEDFEQWRTRYHEAKT 1000

Query: 781  TLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQET 840
            +L +R QK+D+    IE +L+LLGATAIEDKLQ+GV E I  ++ AGIK+W+LTGD++ET
Sbjct: 1001 SLSERKQKIDEVGAQIEDELYLLGATAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRET 1060

Query: 841  AVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGKS 900
            A+NIG SC+L+ +   ++I+   D+     N+  K+ AIS  ++   ++    +VIDG +
Sbjct: 1061 AINIGYSCKLIHDYSTVVILTTSDE-----NIISKMNAIS-QEVDSGNVAHCVIVIDGAT 1114

Query: 901  LG-FXXXXXXXXXXXXIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLL-LAIGDGANDV 958
            L  F            +     +V+CCR SP QKAL+V  ++    S++ LAIGDGAND+
Sbjct: 1115 LAMFEDNPTLMSVFTELCTKTDSVVCCRASPAQKALMVSNIRNTDKSIVTLAIGDGANDI 1174

Query: 959  SMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQRISQAILYSFYKN 1018
            +MIQ+A +GVGI+G EG+QA+RSAD++I QF+++ KLLLVHG ++Y R ++ IL +FYK 
Sbjct: 1175 AMIQSADIGVGIAGKEGLQASRSADYSIGQFRFILKLLLVHGRYNYIRTAKFILCTFYKE 1234

Query: 1019 IALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQFVSSRLLDRYPQL 1078
            +  Y+TQ  Y     +SG S+ E W+++ YN  FT LP   +G+F++ +    L   P+L
Sbjct: 1235 LTFYLTQLIYQRYTMFSGTSLYEPWSLSMYNTLFTSLPVLCVGMFEKDLKPVTLLTVPEL 1294

Query: 1079 YKLGQRGQFFSVRIFWGWVINGFYHS-AVTFIGSTLFYRNGNVLNSHGET--ADH--WAW 1133
            Y +G+  + F+  IF  WV  G  ++  +TF+         N++ + GET  +D+  +  
Sbjct: 1295 YSMGRLSKAFNWSIFAEWVFLGTANALIITFL---------NIV-AWGETSLSDNTLYPL 1344

Query: 1134 GVSIYTCSVIIVIGKAALV---TNQWTKFTAFAIP-GSLVFWLVFFPIYASILPHANVSK 1189
            G   ++ +V ++  KA  +      W  FT+  +  G  + W    PI        +V+ 
Sbjct: 1345 GFVNFSATVALINVKAQFIEMRNRNWLAFTSVILSCGGWLVWCCALPILNRSDGIYDVT- 1403

Query: 1190 EYYGVVSHVYGSATFWLMCIVLPTFALMRDLVWKYYKRTYTPESYHVVQEMQK 1242
              YG+  H     TFW   ++L    ++ D+V+K +K    P    +  E+++
Sbjct: 1404 --YGLYHHFGRDITFWCTSLILAVLPIIVDVVYKTFKIMLAPSDSDIFAELEQ 1454

 Score =  238 bits (607), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 149/468 (31%), Positives = 243/468 (51%), Gaps = 61/468 (13%)

Query: 176 DDKSSPRQIYINDKEAN-----RARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFL 230
           D  S+   IY  D+  N         + +N I++++Y + +F P+ L+ +FSK AN++F 
Sbjct: 97  DHSSAISDIYPVDRHGNLVDERYGYAYCNNLITSSRYTIISFFPRQLYAQFSKLANVYFF 156

Query: 231 FTSAIQQVPNVTPTNRYTTIGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRA---QVFS 287
             + +Q +P  + T  YTTI  L + + +S  +E  +D +R + D E N+      Q+  
Sbjct: 157 IVAILQMIPGWSTTGTYTTIVPLCVFMAISMAREAYDDYRRHKLDKEENNKLTKVLQILH 216

Query: 288 EQ-------------------------LQDFTL-----------SKWVNISVGDIIKVNS 311
           E+                           +F L            KW +I VGD + +  
Sbjct: 217 EREDNDLDLENNAQHSANNPESISNLYFNNFDLLAKKYNVRIVEKKWKDIRVGDFVLLQQ 276

Query: 312 EEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKFIDK-DDLAGMRGKVL 370
           ++ +PAD++++ S       +IET  LDGETNLK K    E +K       LA +  +V 
Sbjct: 277 DDWVPADILILTSDGDNSEVFIETMALDGETNLKGKVPHPEINKLTKSASGLANINAQVT 336

Query: 371 SEHPNSSLYTYEGTMNLNG-----KNISLSPEQMVLRGATLRNTAWIYGLVVFTGHETKL 425
            E PN+ LY +EG + LN      K   L P+ ++ RG+ +RNT    G+V+FTG E+K+
Sbjct: 337 VEDPNNDLYNFEGNLELNSGSSSKKKYPLGPDNVIYRGSIIRNTRNCVGMVIFTGEESKI 396

Query: 426 MRNATATP-IKRTAVERVINMQIVALFGVLIVLALISSIGNVIKVTSDAEHLTYLYL--- 481
             NA   P  K   ++R INM +V +  V+  ++L S +G+ I++     +    YL   
Sbjct: 397 RMNALRNPRTKAPKLQRKINMIVVFMVFVVACMSLFSYLGHTIQIKRYVNNNKAWYLLQE 456

Query: 482 -QGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLYDEASDSPTV 540
             GT         I+++ I+++ ++P+SL+VT+E+IK  Q+ M+  D+D+Y   SD+P  
Sbjct: 457 DAGTAPT------IMSFIIMYNTIIPLSLYVTMELIKVAQSRMMEWDIDMYHAESDTPCA 510

Query: 541 VRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPED 588
           VRT++++EELGQ+ YIFSDKTGTLT N M F+  S  G  ++    +D
Sbjct: 511 VRTATILEELGQVSYIFSDKTGTLTDNKMLFRKLSFCGTSWVHNATQD 558

 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 50/122 (40%), Positives = 73/122 (59%), Gaps = 12/122 (9%)

Query: 625 FLTLLATCHTVIPEFQEDGS-----IKYQAASPDEGALVEGAASLGYKFIIRKPNSVSVL 679
           F+  LA CH  +P+  E+G+     I+YQ++SPDE ALV  A  +GY    R  N +++ 
Sbjct: 678 FILSLAICHICLPKRTEEGNDEDDIIEYQSSSPDELALVTAARDMGYIVYNRNANILTLK 737

Query: 680 -----IEDLGQEQEYQLLNICEFNSTRKRMSAIFRLP--NGEIKLFCKGADTVILERLKA 732
                 ++L + + +++L + +FNS RKRMS I R+P     + LFCKGAD VILERL  
Sbjct: 738 TFPDGFDELPRFENFEILELVDFNSQRKRMSVIVRVPEEKDRVLLFCKGADNVILERLHN 797

Query: 733 GE 734
            E
Sbjct: 798 KE 799

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score =  333 bits (854), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 190/533 (35%), Positives = 306/533 (57%), Gaps = 24/533 (4%)

Query: 728  ERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQ 787
            E+L   E   +E TL  +++++ EGLRTL  + + +   EY  W+  Y  A T+L +R+ 
Sbjct: 927  EKLIKNEEFILEKTLNAIDEFSTEGLRTLLYSYKWIPAEEYKAWEAKYHEAKTSLTNRST 986

Query: 788  KLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGMS 847
            ++ +    IE DL LLGATAIEDKLQ+GVPE I  ++ AGIK+W+LTGD++ETA+NIG +
Sbjct: 987  QIAEVGGHIETDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYA 1046

Query: 848  CRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGKSLG-FXXX 906
            C+L+ +   ++I+ + D      NL  K+ A+ + ++    +    LVIDG SL  F   
Sbjct: 1047 CKLIYDYSTVVILKKNDD-----NLISKMTALGE-ELDTGKIAHCVLVIDGASLAVFENN 1100

Query: 907  XXXXXXXXXIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLL-LAIGDGANDVSMIQAAH 965
                     +     +VICCR SP QKAL+V  ++ K   L+ LAIGDGAND++MIQ+A 
Sbjct: 1101 PTMMSVFIELCTKTDSVICCRASPSQKALIVTNIRLKNKDLVTLAIGDGANDIAMIQSAD 1160

Query: 966  VGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQ 1025
            +GVGI+G EG+QA+RS+D++IAQF+YL KLL VHG ++Y R S+ +L +FYK +  Y+TQ
Sbjct: 1161 IGVGITGKEGLQASRSSDYSIAQFRYLLKLLFVHGRYNYVRTSKFVLCTFYKEVLFYLTQ 1220

Query: 1026 FWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQFVSSRLLDRYPQLYKLGQRG 1085
              Y     +SG S+ E W+++ +N  FT LP   +G+F++ +    L   P+LY +GQ+ 
Sbjct: 1221 MIYQRQTMFSGTSLYEPWSLSMFNTLFTSLPVICIGMFEKDLKPMTLLAVPELYTMGQKC 1280

Query: 1086 QFFSVRIFWGWVINGFYHSA-VTFIGSTLFYRNGNVLNSHGETADHWAWGVSIYTCSVII 1144
            Q F+++IF  W++     S  +TF+   ++       NS       +  GV  +T    +
Sbjct: 1281 QAFNLKIFLVWMLTAAGISVLITFLNFEIWGFTAQSDNS------IYPIGVINFTSICFL 1334

Query: 1145 VIGKAALVTNQWTKFTAFAIPGSLVFWLVFFPIYASILPHANVSKEYYGV---VSHVYG- 1200
            +  K   +  +   + AFA   SL+   + + ++  +LP        Y V   + H +G 
Sbjct: 1335 INVKCQFIETRNRNWLAFA---SLLISCIGWILWCCLLPGIYGENAIYDVLIGLYHQFGR 1391

Query: 1201 SATFWLMCIVLPTFALMRDLVWKYYKRTYTPESYHVVQEMQKYNIGDYRPRIE 1253
              T+W  C++L  F +M D+V + ++    P    +  E+++ +  D R ++E
Sbjct: 1392 DITWWASCLILIMFPMMIDIVCQTFRAMIWPTDGDIFAELEQKD--DIRKKLE 1442

 Score =  228 bits (582), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 140/449 (31%), Positives = 233/449 (51%), Gaps = 65/449 (14%)

Query: 195 RGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQQVPNVTPTNRYTTIGTLL 254
           R +  N I++++Y + +F+P+ L+ +FSK AN +FL  + +Q +P+ + T  YTTI  L 
Sbjct: 114 RPYRDNVITSSRYTVYSFLPRQLYAQFSKLANAYFLLVAILQMIPSWSTTGTYTTIVPLS 173

Query: 255 IVLIVSAIKEIVEDLKRAQSDSE------------------------------------- 277
           I L +S  +E  +D KR + D E                                     
Sbjct: 174 IFLSISMAREAWDDFKRHRLDKEENNKSTKVLTMGKDHDELESDSIYSLSNVSARSTDAI 233

Query: 278 ---------LNDSRAQVFSEQLQDFTL-----------SKWVNISVGDIIKVNSEEAIPA 317
                    LND     +++   +  L            +W ++ VG+ + +NS++ +PA
Sbjct: 234 LSDFNSMHNLNDVTEPSYTDHFTNLNLLRSQFDIHIKKKEWKDLKVGEFVLLNSDDWVPA 293

Query: 318 DVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKFIDKDDLAGMRGKVLS-EHPNS 376
           D++++++       ++ET  LDGETNLK K    E +K +       M     + E PN+
Sbjct: 294 DILLLSTDGENNEAFVETMALDGETNLKSKNPLPELAKRMTSATGLSMHSATTTLEDPNN 353

Query: 377 SLYTYEGTMNLNGKNISLSPEQMVLRGATLRNTAWIYGLVVFTGHETKLMRNATATP-IK 435
            LY +EGT+ ++G+   L  + +V RG+ LRNT  I G+V+FTG ETK+  NA   P  K
Sbjct: 354 DLYNFEGTVEIDGELYPLGSDNVVYRGSILRNTQSIVGIVIFTGEETKIRMNAIKNPRTK 413

Query: 436 RTAVERVINMQIVALFGVLIVLALISSIGNVI--KVTSDAEHLTYLYLQGTNKVGLFFKD 493
              ++  IN+ ++ +  V+  +A+ S +G  I  K   D     YL+ +           
Sbjct: 414 APKLQGKINLIVLFMVFVVAAMAMFSYLGQHILKKNYVDNNRAWYLFQEDAGTA----PT 469

Query: 494 ILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLYDEASDSPTVVRTSSLVEELGQI 553
           I+++ I+++ L+P+SL+VT E+IK  Q+ ++  D+D+Y   SD+P   RT++++EELGQ+
Sbjct: 470 IMSFIIMYNTLIPLSLYVTTEIIKAMQSKLMEWDIDMYHIESDTPCESRTATILEELGQV 529

Query: 554 EYIFSDKTGTLTRNVMEFKSCSIAGKCYI 582
            YIFSDKTGTLT N M F+  SI G  ++
Sbjct: 530 SYIFSDKTGTLTDNKMIFRKFSICGSSWL 558

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 71/119 (59%), Gaps = 9/119 (7%)

Query: 625 FLTLLATCHTVIPEFQEDG--SIKYQAASPDEGALVEGAASLGYKFIIRKPNSVSVL--- 679
           F+  LA CHT +P+   DG  SI YQ++SPDE ALV  A  +G+    R  +++S+    
Sbjct: 672 FILSLALCHTCLPKKTHDGTDSILYQSSSPDELALVTAARDMGFVVTNRNSSTLSIATYP 731

Query: 680 --IEDLGQEQEYQLLNICEFNSTRKRMSAIFRLPNGE--IKLFCKGADTVILERLKAGE 734
              +D    ++Y++L    F+S RKRMS   ++PN +  + L CKGAD VILERL+  E
Sbjct: 732 NGFDDQPIVEDYEVLEYINFDSQRKRMSVAVKMPNDDDRVLLICKGADNVILERLRNSE 790

>Kwal_23.3556
          Length = 1597

 Score =  330 bits (845), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 193/533 (36%), Positives = 308/533 (57%), Gaps = 24/533 (4%)

Query: 728  ERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQ 787
            E L   E   +E TL+ +ED++  GLRTL  + + +   +Y +W   Y AA T+L++R +
Sbjct: 947  EDLIQNEEFVLERTLQAIEDFSTSGLRTLLYSYKWIPSEDYEKWSKKYHAAKTSLENRKE 1006

Query: 788  KLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGMS 847
            K+    EL+E  L LLGATAIEDKLQ+GV + I  ++ AGIK+W+LTGD++ETA+NIG S
Sbjct: 1007 KMHSVGELVETSLHLLGATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIGYS 1066

Query: 848  CRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGKSLG-FXXX 906
            C L+ +   ++I++ +D+     N++ KL A+S  +I + ++    +VIDG +L  F   
Sbjct: 1067 CNLIHDYSTVVILSAKDE-----NISSKLTAVS-QEIERGNIAHCVVVIDGSTLTTFESN 1120

Query: 907  XXXXXXXXXIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLL--LAIGDGANDVSMIQAA 964
                     +     +VICCR SP QKAL+V  + R TD  L  LAIGDGAND++MIQ+A
Sbjct: 1121 PTLMSVFVELCTKTDSVICCRASPSQKALMVTHI-RNTDKKLVTLAIGDGANDIAMIQSA 1179

Query: 965  HVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMT 1024
             +GVGI+G EG+QA+RS+D++IAQF++L KLLLVHG ++Y R ++ +L +FYK +  Y+T
Sbjct: 1180 DIGVGIAGKEGLQASRSSDYSIAQFRFLLKLLLVHGRYNYVRTTKFVLCTFYKELLFYLT 1239

Query: 1025 QFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQFVSSRLLDRYPQLYKLGQR 1084
            Q  Y     +SG S+ E W+++ +N  FT LP   +G+F++ +    L   P+LY +G+ 
Sbjct: 1240 QMIYQRHTMFSGTSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLKPMTLLAIPELYSIGRL 1299

Query: 1085 GQFFSVRIFWGWVINGFYHSAVTFIGSTLFYRNGNVLNSHGETADHWAWGVSIYTCSVII 1144
             Q F++R+F  W+   F  +  + I + L ++   V +    T   +  GV  +T  + +
Sbjct: 1300 SQSFNLRVFLYWM---FLAALNSLIITFLNWKIWAVSSLSDNTV--YPIGVINFTAIITL 1354

Query: 1145 VIGKAALVTNQWTKFTAFAIPGSLVFWLVFFPIYASILPHANVSKEYYGVVSHVY----G 1200
            V  K  L+        A     SLV  +  + ++  +LP        Y V++ +Y     
Sbjct: 1355 VNVKCQLLETHNRNVLAIC---SLVISVGGWLLWCCLLPGIYSEDGMYDVLTGLYFQFGN 1411

Query: 1201 SATFWLMCIVLPTFALMRDLVWKYYKRTYTPESYHVVQEMQKYNIGDYRPRIE 1253
              TFW  C+VL    L+ D+V+K  K    P    +  E+++ +  + R ++E
Sbjct: 1412 DITFWCACLVLVVLPLIIDVVFKTVKIMIFPSDSEISMELEQKD--EIRKKLE 1462

 Score =  246 bits (627), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 153/493 (31%), Positives = 252/493 (51%), Gaps = 87/493 (17%)

Query: 194 ARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQQVPNVTPTNRYTTIGTL 253
            + + SN I++++Y + TF+P+ L+ +FS+ AN +F   + +Q +P  + T  YTTI  L
Sbjct: 105 GKPYISNLITSSRYTIYTFLPRQLYAQFSRLANAYFFLVAVLQMIPGWSTTGTYTTIVPL 164

Query: 254 LIVLIVSAIKEIVEDLKRAQSDSELN---------------------------------- 279
           LI + +S  +E  +D +R + D E N                                  
Sbjct: 165 LIFMGISMSREAWDDFRRHKLDREENDKTARVLVKSSSPHTEFSRPNSLYSLPQWQQSAT 224

Query: 280 ----------DSRAQVFSEQLQDFT--------------LSKWVNISVGDIIKVNSEEAI 315
                     +S A+  + Q  D T                KW +I VGD + +  +E +
Sbjct: 225 STSMLTNPTLESTAEAATSQNDDHTNWDLLKSKYGVEAVEKKWKDIKVGDYVVLEQDEWV 284

Query: 316 PADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKFID-KDDLAGMRGKVLSEHP 374
           PAD++V+  S+ +  C++ET  LDGETNLK KQ   E S+ +     L   + KV  E P
Sbjct: 285 PADMLVLTCSDEKNECFVETMALDGETNLKNKQPLTEVSEVMKTAAGLTEFKAKVTVEDP 344

Query: 375 NSSLYTYEGTMNLNGKN--ISLSPEQMVLRGATLRNTAWIYGLVVFTGHETKLMRNATAT 432
           N  L+ +EG + L G+N  +++ P+ ++ RG+ +RNT+   G+VVFTG ETK+  NA   
Sbjct: 345 NIDLHNFEGNLELLGENRKLTIGPDHIIYRGSIIRNTSNAVGMVVFTGEETKIRMNAIKN 404

Query: 433 P-IKRTAVERVINMQIVALFGVLIVLALISSIGNVI--KVTSDAEHLTYLYLQGTNKVGL 489
           P IK   ++R IN+ ++ +  V+  +AL S +G  I  K   D     YL+    N    
Sbjct: 405 PRIKAPKLQRAINLIVLFMVFVVASMALFSLLGQRIIKKKYVDNNRAWYLF----NSDAG 460

Query: 490 FFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLYDEASDSPTVVRTSSLVEE 549
               ++++ I+++ L+P+SL+VT+E+IK  Q+ ++  D+D+Y   +++P   RT++++EE
Sbjct: 461 LAPTVMSFIIMYNTLIPLSLYVTMEIIKAMQSKLMEWDIDMYHAETNTPCESRTATILEE 520

Query: 550 LGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAATTEDGIEIGFRKFDSMKE 609
           LGQ+ YIFSDKTGTLT N M F++ S+ G  +I                     FD   E
Sbjct: 521 LGQVSYIFSDKTGTLTDNKMVFRALSVCGSSWI-------------------HDFDPAAE 561

Query: 610 TLNDTQDPDSHII 622
            L  ++  DS+ +
Sbjct: 562 KLTKSESSDSNTV 574

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 53/130 (40%), Positives = 78/130 (60%), Gaps = 14/130 (10%)

Query: 615 QDPDSHI---INDFLTLLATCHTVIPE----FQEDGSIKYQAASPDEGALVEGAASLGYK 667
           Q+P++H    ++ F+  LA CH  +P+     + +  ++YQA+SPDE ALV  A  +GY 
Sbjct: 655 QNPNTHFAKKVSFFILSLALCHACLPKSSSGVEGEDCVEYQASSPDELALVTAARDMGYA 714

Query: 668 FIIRKPNSVSVLIEDLGQEQE-----YQLLNICEFNSTRKRMSAIFRLPNGE--IKLFCK 720
            + R  + +++     G + E     Y++LN  EF+S RKRMS + RLP+ E  I L CK
Sbjct: 715 VMNRNSDVLTIKTYPNGFDAEPHLDKYEILNNIEFSSHRKRMSVLVRLPHEENRILLICK 774

Query: 721 GADTVILERL 730
           GAD VILERL
Sbjct: 775 GADNVILERL 784

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score =  325 bits (832), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 193/543 (35%), Positives = 300/543 (55%), Gaps = 29/543 (5%)

Query: 723  DTVILERLKA-----GENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDA 777
            DT ILE + +      E   IE TL+ +++++ EGLRTL  A + +   +Y  W   Y  
Sbjct: 998  DTEILEHIGSDELILNEEYVIERTLQAIDEFSTEGLRTLVYAYKWIDIGQYENWNKRYHQ 1057

Query: 778  ASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDR 837
            A T+L DR  K+D+A   IE  L LLG TAIEDKLQDGV E I  ++ AGIK+W+LTGD+
Sbjct: 1058 AKTSLTDRKIKVDEAGAEIEDGLNLLGVTAIEDKLQDGVSEAIEKIRRAGIKMWMLTGDK 1117

Query: 838  QETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVID 897
            +ETA+NIG SC L+ +   ++I+   D+     N+  K+ A+S  ++   ++    +VID
Sbjct: 1118 RETAINIGYSCMLIKDYSTVVILTTTDE-----NIISKMNAVS-QEVDSGNIAHCVVVID 1171

Query: 898  GKSLG-FXXXXXXXXXXXXIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLL-LAIGDGA 955
            G ++  F            +     +VICCR SP QKAL+V  ++    +L+ LAIGDGA
Sbjct: 1172 GATMAMFEGNPTYMSVFVELCTKTDSVICCRASPSQKALMVSNIRNTDPNLVTLAIGDGA 1231

Query: 956  NDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQRISQAILYSF 1015
            ND++MIQ+A +GVGI+G EG+QA+R +D++I QF++L KLL VHG ++Y R S+ +L +F
Sbjct: 1232 NDIAMIQSADIGVGIAGKEGLQASRVSDYSIGQFRFLLKLLFVHGRYNYIRTSKFMLCTF 1291

Query: 1016 YKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQFVSSRLLDRY 1075
            YK I  Y TQ  Y     +SG S+ E W+++ +N  FT LP   +G+F++ +    L   
Sbjct: 1292 YKEITFYFTQLIYQRYTMFSGSSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLKPMTLLTV 1351

Query: 1076 PQLYKLGQRGQFFSVRIFWGWVINGFYHS-AVTFIGSTLFYRNGNVLNSHGETADHWAWG 1134
            P+LY  G+  Q F+  IF  WVI    +S  +TF+   ++  +    N+       +  G
Sbjct: 1352 PELYSYGRLSQGFNWLIFMEWVILATTNSLIITFLNVVMWGMSSLSDNT------MYPLG 1405

Query: 1135 VSIYTCSVIIVIGKAALV---TNQWTKFTAFAIP-GSLVFWLVFFPIYASILPHANVSKE 1190
            +  +T  V ++  K+  V      W  FT+  +  G  + W    PI  +     +V+  
Sbjct: 1406 LINFTAIVALINVKSQFVEMHNRNWLAFTSVVLSCGGWLVWCCALPILNNTDQIYDVA-- 1463

Query: 1191 YYGVVSHVYGSATFWLMCIVLPTFALMRDLVWKYYKRTYTPESYHVVQEMQKYNIGDYRP 1250
             YG  +H     TFW   +VL    +  D+V+K +K    P    +  E+++ +  D R 
Sbjct: 1464 -YGFYNHFGKDITFWCTSLVLALLPITLDIVYKTFKVMIWPSDSDIFAELEQKS--DIRK 1520

Query: 1251 RIE 1253
            ++E
Sbjct: 1521 KLE 1523

 Score =  233 bits (594), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 152/502 (30%), Positives = 249/502 (49%), Gaps = 79/502 (15%)

Query: 167 ILRRNDYSDDDKSSPRQIYINDKEANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYAN 226
           IL  N       ++ R  ++ D+  N+   +  N I++++Y   +F+P+ L+ +FSK AN
Sbjct: 110 ILDHNAIEYKQAATKRDGHLIDERFNKP--YCDNRITSSRYTFYSFLPRQLYAQFSKLAN 167

Query: 227 LFFLFTSAIQQVPNVTPTNRYTTIGTLLIVLIVSAIKEIVEDLKRAQSDSE--------- 277
            +F   + +Q +P  + T  YTTI  L + + +S  +E  +D +R + D E         
Sbjct: 168 TYFFIVAVLQMIPGWSTTGTYTTIIPLCVFMGISMTREAWDDFRRHRLDKEENNKPVGVL 227

Query: 278 ------------------------------------LNDSR----AQVFSEQLQDFTL-- 295
                                               LND R             +F L  
Sbjct: 228 VKDGNNDAQEVYTLPSSVVSSTAYLTKSAAAENNPPLNDDRNSSQGHFLDTHFNNFELLK 287

Query: 296 ---------SKWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKI 346
                     KW  + VGD + +  ++ +PAD++++        C++ET  LDGETNLK 
Sbjct: 288 NKYNVHIHQKKWEKLRVGDFVLLTQDDWVPADLLLLTCDGENSECFVETMALDGETNLKS 347

Query: 347 KQARIETSKFIDK-DDLAGMRGKVLSEHPNSSLYTYEGTMNL-NGKNIS-----LSPEQM 399
           KQ   E +K       LA +  +V  E PN  LY +EG + L N +N +     L P+ +
Sbjct: 348 KQPHPELNKLTKAASGLANINAQVTVEDPNIDLYNFEGNLELKNHRNDTIMKYPLGPDNV 407

Query: 400 VLRGATLRNTAWIYGLVVFTGHETKLMRNATATP-IKRTAVERVINMQIVALFGVLIVLA 458
           + RG+ LRNT  + G+V+F+G ETK+  NA   P  K   ++R INM IV +  V+  ++
Sbjct: 408 IYRGSILRNTQNVVGMVIFSGEETKIRMNALKNPRTKAPKLQRKINMIIVFMVFVVATIS 467

Query: 459 LISSIGNVI--KVTSDAEHLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMI 516
           L S +G+V+  K   D     YL+ Q    V      I+++ I+++ ++P+SL+VT+E+I
Sbjct: 468 LFSYLGHVLHKKKYIDQNKAWYLF-QADAGVA---PTIMSFIIMYNTVIPLSLYVTMEII 523

Query: 517 KYYQAYMIASDLDLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSI 576
           K  Q+ M+  D+D+Y   +++P   RT++++EELGQ+ YIFSDKTGTLT N M F+  S+
Sbjct: 524 KVVQSKMMEWDIDMYHAETNTPCESRTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSL 583

Query: 577 AGKCYIETIPEDKAATTEDGIE 598
            G  ++  +       +ED  E
Sbjct: 584 CGSSWLHNV---DLGNSEDNFE 602

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 83/155 (53%), Gaps = 25/155 (16%)

Query: 625 FLTLLATCHTVIP-----EFQEDGSIKYQAASPDEGALVEGAASLGYKFIIRKPNSVSVL 679
           F   LA CH+ +P     E   + SI+YQ++SPDE ALV  A  LGY  + R    +++ 
Sbjct: 731 FFLSLALCHSCLPKKTHNESIGEDSIEYQSSSPDELALVTAARDLGYIVLNRNAQILTIK 790

Query: 680 IEDLGQEQE-----YQLLNICEFNSTRKRMSAIFRLPN--GEIKLFCKGADTVILERLKA 732
               G + E     Y++LN  +FNS RKRMS + R+PN   ++ L CKGAD VI+ERL  
Sbjct: 791 TFPDGFDGEAKLENYEILNYIDFNSQRKRMSVLVRMPNQPNQVLLICKGADNVIMERL-- 848

Query: 733 GENPYIEATLRHLEDYAAEGLRTLCLASRTVTESE 767
                      H  + AA+ +  +C +++   ++E
Sbjct: 849 -----------HDRELAAKKMADICTSTKERKDAE 872

>Scas_669.3
          Length = 1638

 Score =  316 bits (809), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 187/517 (36%), Positives = 297/517 (57%), Gaps = 32/517 (6%)

Query: 738  IEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIE 797
            IE T++ +++++ EGLRTL  + + V   EY +W+D Y  A  +L +R  K+ +  E IE
Sbjct: 992  IEKTIQAIDEFSTEGLRTLVYSYKWVDLQEYQQWEDRYHDAKISLTNRKSKIAEVGEEIE 1051

Query: 798  KDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNL 857
            +DL LLGATAIEDKLQ+GV E I  ++ AGIK+W+LTGD++ETA+NIG SC+L+ +   +
Sbjct: 1052 QDLQLLGATAIEDKLQEGVSEAIEKIRRAGIKIWMLTGDKRETAINIGYSCKLIYDYSTV 1111

Query: 858  LIINEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGKSLG-FXXXXXXXXXXXXI 916
            +I+ + D+     N+  K+ AIS  ++   ++    ++IDG +L  F            +
Sbjct: 1112 VILAKGDE-----NIISKMNAIS-QEVDSGNVAHCVIIIDGSTLAMFEGNPTLMSVFIEL 1165

Query: 917  GKLCKAVICCRVSPLQKALVVKMVKRKTDSLL-LAIGDGANDVSMIQAAHVGVGISGMEG 975
                 +VICCR SP QK+L+V  ++    +L+ LAIGDGAND++MIQ+A +G+GI G EG
Sbjct: 1166 CTKTDSVICCRASPSQKSLMVTNIRNSNKNLVTLAIGDGANDIAMIQSADIGIGIGGKEG 1225

Query: 976  MQAARSADFAIAQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVFANAYS 1035
            +QA+R+AD++IAQF+++ KLLLVHG ++Y R ++ IL +F+K I  Y+TQ  +     +S
Sbjct: 1226 LQASRTADYSIAQFRFILKLLLVHGRYNYIRTAKFILCTFFKEITFYLTQLIFQRYTMFS 1285

Query: 1036 GQSIMESWTMTFYNVFFTVLPPFVMGVFDQFVSSRLLDRYPQLYKLGQRGQFFSVRIFWG 1095
            G S+ E W+++ +N  FT LP   +G+F++ +    L   P+LY +G+  Q F++ IF  
Sbjct: 1286 GSSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLKPMTLLTIPELYSMGRLSQGFNLIIFGE 1345

Query: 1096 WVIN-GFYHSAVTFIGSTLFYRNGNVLNSHGETA--DH--WAWGVSIYTCSVIIVIGKAA 1150
            WVI    Y   +TF+   ++          GETA  DH  +  GV  +T  V +V  K  
Sbjct: 1346 WVIQAAAYALLITFLNIIIW----------GETALSDHTMYPLGVINFTAIVALVNVKCQ 1395

Query: 1151 LV---TNQWTKFTAFAIP-GSLVFWLVFFPIYASILPHANVSKEY-YGVVSHVYGSATFW 1205
             +      W  FT+  +  G  + W    P    IL  ++V  +  YG   H     T+W
Sbjct: 1396 FIEMNNRNWVVFTSVILSCGGWLVWCCALP----ILNRSDVIYDVPYGFFYHFGKDITWW 1451

Query: 1206 LMCIVLPTFALMRDLVWKYYKRTYTPESYHVVQEMQK 1242
              C VL    +  D+V++ +K    P    +   +++
Sbjct: 1452 CSCFVLAVLPITIDIVYQTFKTMIWPSDADIFSVLEQ 1488

 Score =  238 bits (608), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 135/442 (30%), Positives = 233/442 (52%), Gaps = 58/442 (13%)

Query: 197 FGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQQVPNVTPTNRYTTIGTLLIV 256
           + +N+I++++Y + +F PK L+ +FSK AN++F   + +Q +P  + T  YTTI  L I 
Sbjct: 140 YCNNNITSSRYTIYSFFPKQLYAQFSKVANVYFFVVAILQMIPGWSTTGTYTTIVPLCIF 199

Query: 257 LIVSAIKEIVEDLKRAQSDSELNDSRAQVFSEQLQDFTL--------------------- 295
           + +S  +E  +D +R + D E N+    + +++  +  +                     
Sbjct: 200 MGISMAREAWDDFRRHRLDKEENNKTCSILTKEFSNKPMPDDAQLPSRQNIDNLSNDSNT 259

Query: 296 -----------------------SKWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCY 332
                                  + W N+ VGD + +  +  +PAD++V+ S      C+
Sbjct: 260 DYLNTKFNNFPFLEERHGVRIQETTWSNLHVGDFVLLKQDNWVPADILVLTSDGDNNECF 319

Query: 333 IETANLDGETNLKIKQARIETSKF-IDKDDLAGMRGKVLSEHPNSSLYTYEGTMNLNGKN 391
           +ET  LDGETNLK+KQ   E +K       LA +   +  E PNS LY +EG + L   N
Sbjct: 320 VETMALDGETNLKVKQPHPELNKLACSASGLANINALITVEDPNSDLYNFEGNLELTDNN 379

Query: 392 ------ISLSPEQMVLRGATLRNTAWIYGLVVFTGHETKLMRNATATP-IKRTAVERVIN 444
                   + P+ +  RG+ +RNT  + G+V++TG ETK+  NA   P  K   +++ IN
Sbjct: 380 NNSLKKYPVGPDNVAYRGSIIRNTDNVIGMVIYTGKETKIRMNALNNPRTKAPKLQKNIN 439

Query: 445 MQIVALFGVLIVLALISSIGNVI--KVTSDAEHLTYLYLQGTNKVGLFFKDILTYWILFS 502
           + I  +  V+ V++L S +G+V+  K   D     YL  +           I+++ I+++
Sbjct: 440 IIITFMVFVVAVISLFSYLGHVLQNKKAIDENQAWYLLTKDAGAA----PTIMSFIIMYN 495

Query: 503 NLVPISLFVTVEMIKYYQAYMIASDLDLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTG 562
            ++P+SL+VT+E+IK  Q+ M+  D+D+Y   +++P   RT++++EELGQ+ Y+FSDKTG
Sbjct: 496 TIIPLSLYVTMEIIKAMQSKMMEWDIDMYHSETNTPCESRTATILEELGQVSYMFSDKTG 555

Query: 563 TLTRNVMEFKSCSIAGKCYIET 584
           TLT N M F+  SI G  ++ +
Sbjct: 556 TLTDNKMIFRKFSICGSSWLHS 577

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 51/119 (42%), Positives = 72/119 (60%), Gaps = 12/119 (10%)

Query: 625 FLTLLATCHTVIPE---FQEDGS--IKYQAASPDEGALVEGAASLGYKFIIRKPNSVSVL 679
           F+  LA CHT +P+   F E G   I+YQ++SPDE ALV  A  LGY  + +  + +++ 
Sbjct: 702 FILSLALCHTCLPKKSNFPEGGEDVIEYQSSSPDELALVTAARDLGYVVLNKNADVLTIK 761

Query: 680 IEDLGQEQE-----YQLLNICEFNSTRKRMSAIFRLPN--GEIKLFCKGADTVILERLK 731
               G E E     YQ+LN  +FNS RKRMS + + P+   ++ L CKGAD +ILERL+
Sbjct: 762 TYPDGFENEPIFEDYQILNYIDFNSQRKRMSVLVKTPDEPNKVLLICKGADNMILERLQ 820

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score =  309 bits (791), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 183/486 (37%), Positives = 270/486 (55%), Gaps = 28/486 (5%)

Query: 730  LKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKL 789
            L   E   IE TL+ ++ +  EGLRTL  + + +   EY  W   Y AA   L +R +++
Sbjct: 930  LITNEEYVIERTLQDMDAFTTEGLRTLLYSFKWIGNQEYETWNSRYSAAKAALVNRREQM 989

Query: 790  DDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGMSCR 849
            D   E+IE+DL LLG   IEDKLQ+GVP+ I  L+ AGIK+W+LTGD++ETA+NIG SCR
Sbjct: 990  DTVGEIIERDLTLLGTIGIEDKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSCR 1049

Query: 850  LLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGKSLG-FXXXXX 908
            L+ +   ++I+   D+     N+  K+  I+  +I   ++    +VIDG +L  F     
Sbjct: 1050 LIHDYSTVIILAPNDE-----NMASKITTIT-QEIEAGNVAHCVVVIDGATLTIFEGNLT 1103

Query: 909  XXXXXXXIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLL--LAIGDGANDVSMIQAAHV 966
                   +     +VICCR SP QKAL+V  + RKTD  L  LAIGDGAND++MIQ+A +
Sbjct: 1104 LMTLFIELCTKTDSVICCRSSPSQKALMVTKI-RKTDKKLVTLAIGDGANDIAMIQSADI 1162

Query: 967  GVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQF 1026
            GV I+G EG+QA+RS+D++IAQF+YL KLLLVHG ++Y R S+ +L +FYK    Y+TQ 
Sbjct: 1163 GVDITGKEGLQASRSSDYSIAQFRYLLKLLLVHGRYNYIRTSKFVLCTFYKEFVFYLTQL 1222

Query: 1027 WYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQFVSSRLLDRYPQLYKLGQRGQ 1086
             +     +SG S  E W +T +N  FT LP   +G+F++ + S  L   P+LY  G++ Q
Sbjct: 1223 IFQINTMFSGTSQYEPWCLTVFNTLFTSLPVLCIGMFEKDLKSVTLLSIPELYTTGRQSQ 1282

Query: 1087 FFSVRIFWGWVINGFYHSAVTFIGS----TLFYRNGNVLNSHGETADHWAWGVSIYTCSV 1142
             F++ IF  W+      S +    +    +L  ++ N L         +  G+  YT  V
Sbjct: 1283 AFNLVIFLRWMAIAALSSVIICFTNWQCWSLTAQSDNTL---------YPIGLINYTAVV 1333

Query: 1143 IIVIGKAALV---TNQWTKFTAFAIPGSLVFWLVFFPIYASILPHANVSKEYYGVVSHVY 1199
            ++V  K  L+      W  F +F I  S+  WL +  +  +I     V     G+     
Sbjct: 1334 VLVNVKCQLLEMANRNWLAFASFFI--SVCGWLCWCLLLPAIYKETLVYDVREGLYHQFG 1391

Query: 1200 GSATFW 1205
               TFW
Sbjct: 1392 PDITFW 1397

 Score =  213 bits (543), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 134/419 (31%), Positives = 226/419 (53%), Gaps = 39/419 (9%)

Query: 200 NHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQQVPNVTPTNRYTTIGTLLIVLIV 259
           N I++++Y++ +F+P+ L  +FSK  N +F   + +Q VPN + T +YTTI  L I + +
Sbjct: 113 NAITSSRYSVYSFLPRQLCAQFSKVVNSYFFGMAILQMVPNWSTTGQYTTIVPLSIFMGI 172

Query: 260 SAIKEIVEDLKRAQSDSELNDSRAQVFSE-------------------QLQDF-TL---- 295
           S  +E  ED +R + D E N+   +V ++                      DF TL    
Sbjct: 173 SIAREGWEDFRRHKLDREENNKLVKVLAQAHDSEFGDNKDISAEARAASFTDFETLQANH 232

Query: 296 ------SKWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQA 349
                  +W ++ VG+ + +N ++ +PAD+ ++A+      CY+ET  LDGETNLK K  
Sbjct: 233 GVAVVEKQWKDVEVGEFVLLNQDDWVPADLFLLATDGDNNECYVETMALDGETNLKCKHV 292

Query: 350 RIE-TSKFIDKDDLAGMRGKVLSEHPNSSLYTYEGTMNLNGKN-----ISLSPEQMVLRG 403
             +  S+      LA  RG    E PN  LY +EG + +   +      S+  + ++ RG
Sbjct: 293 LPKIASQTRTASGLATFRGMTTVEDPNIDLYNFEGKIEVETDSGEQQAYSIGLDNVLFRG 352

Query: 404 ATLRNTAWIYGLVVFTGHETKLMRNATATP-IKRTAVERVINMQIVALFGVLIVLALISS 462
           + +RNT  + G+VVFTG ETK+  NA   P IK   ++  IN+ ++ +  V+ + + +S 
Sbjct: 353 SIIRNTQTVVGMVVFTGEETKIRMNAIKNPRIKSPKLQTQINLIVLFMILVVAIFSFLSF 412

Query: 463 IGNVIKVTSDAEHLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAY 522
                    + +     YL   +  GL    I+++ I+++ L+P+SL+VT+E+IK  Q+ 
Sbjct: 413 GLQRFFKNREVDSDRAWYLMKVD-AGLA-PTIMSFIIMYNTLIPLSLYVTMEIIKDMQSR 470

Query: 523 MIASDLDLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCY 581
           ++  D+D+Y   +++    RT++++EELGQ+ YIFSDKTGTLT N M F+  S  G  +
Sbjct: 471 LMEWDIDMYHLETNTGCTSRTATILEELGQVSYIFSDKTGTLTDNRMIFRKFSFCGTAW 529

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 46/119 (38%), Positives = 71/119 (59%), Gaps = 13/119 (10%)

Query: 625 FLTLLATCHTVIPEFQEDG------SIKYQAASPDEGALVEGAASLGYKFIIRKPNSVSV 678
           F+  LA CHT +P+ ++        S++YQ++SPDE ALV  A  +GY  + R  + +++
Sbjct: 653 FILALALCHTCLPKKRQGADSGDFDSVEYQSSSPDELALVTAARDMGYVVLNRNGDELTI 712

Query: 679 LIEDLGQE-----QEYQLLNICEFNSTRKRMSAIFRLPNG--EIKLFCKGADTVILERL 730
                G E     ++Y++LN  +F+S RKRMS + R+     ++ L CKGAD VILERL
Sbjct: 713 KTYPDGFEADCVLEKYEVLNTIDFSSDRKRMSVLVRMHQHPEKVLLICKGADNVILERL 771

>Scas_89.1
          Length = 271

 Score =  156 bits (394), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 96/264 (36%), Positives = 144/264 (54%), Gaps = 11/264 (4%)

Query: 772  KDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVW 831
            K+ +DA+ + L+          + +E +L LLG T +EDKLQ+ V  +I  L++AG+K+W
Sbjct: 7    KEYHDASLSMLNXDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIW 66

Query: 832  VLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDMNS 891
            +LTGD+ ETA  + +S +L+S    +  + +  +     N  E LK             S
Sbjct: 67   MLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKI----------NKS 116

Query: 892  LALVIDGKSLGFXXXXXXXXXXXXIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLLAI 951
              L+IDG+SLG             +  L  AVI CR +P QKA V  +++  T   +  I
Sbjct: 117  SCLLIDGESLGMFLTYYKQEFFDIVVDL-PAVIACRCTPQQKADVALLIREITGKRVCCI 175

Query: 952  GDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQRISQAI 1011
            GDG NDVSMIQ A VGVGI G EG QA+ +ADF++ QF +L KLLL HG  SY+R ++  
Sbjct: 176  GDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLA 235

Query: 1012 LYSFYKNIALYMTQFWYVFANAYS 1035
             +  ++ + + + Q  Y   +  S
Sbjct: 236  QFVIHRGLIISVCQAVYSVCSKLS 259

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
           complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 90.5 bits (223), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 170/757 (22%), Positives = 286/757 (37%), Gaps = 185/757 (24%)

Query: 300 NISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKFIDK 359
           ++ VGD++ + + + +P D I++     EG C  + + + GE++  IK+  +  S  + +
Sbjct: 200 DLLVGDLLSLQTGDVVPVDCILV-----EGKCECDESGITGESD-TIKKVSLAMSLQVYR 253

Query: 360 DDLAGMRGKVLSEHPNSSLYTYEGTMNLNGKNISLSPEQMVLRGATLRNTAWIYGLVVFT 419
                    V +++P++ + + +     NG   SL P+ M++ G+ L +    + +V   
Sbjct: 254 --------TVAADNPSADIGSSD-----NGH--SLVPDPMLISGSKLLSGIG-HAVVTAV 297

Query: 420 GHET---KLMRNATATPIKRTAVERVINMQ-------IVALFGVLIVLALISSIGNVIKV 469
           G  +   K+M    + P      ER+  +         VA F + +VL L          
Sbjct: 298 GPHSVHGKMMLALKSEPETTPLQERLNTLADDISIYGSVAAFLLFVVLFL---------- 347

Query: 470 TSDAEHLTYLY-------LQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAY 522
                 L+YL        L    K   F    +T   +    VP  L + V +   +   
Sbjct: 348 ----RFLSYLPKGRLYHDLPSARKGSRFMDIFITAVTVIVVAVPEGLPLAVTLALAFATT 403

Query: 523 MIASDLDLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYI 582
            +  D +L          VR     E +G    + SDKTGTLT+N M        G  + 
Sbjct: 404 RMTKDGNL----------VRVLRACETMGSATTVCSDKTGTLTQNKMVVVK-GFLGSSHF 452

Query: 583 ETIPEDKAATTEDGIEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHT-------- 634
           + I ED      D +                 QD   H +ND L  +A   T        
Sbjct: 453 DDISEDSNCAQSDALR----------------QDMSQHTLNDILANIALNSTAFENKQVA 496

Query: 635 --VIPE------------FQEDGSIKYQA-------------ASPDEGALVEGA-ASLGY 666
             VI E            +  +   KY A              S  E AL+  A  SLG 
Sbjct: 497 DPVITENPYHKPRRSLFPWSRNNKPKYPAPKDSSVQSAEFFIGSKTEAALLSLAKGSLGL 556

Query: 667 KFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRLPNGEIKLFCKGADTVI 726
           +       S+  L +D        ++ +  F S+RK    + RL +G  + F KGA   I
Sbjct: 557 E-------SLQALRDDPHHIGIASIVQMIPFESSRKWAGLVVRLVDGNYRFFIKGASETI 609

Query: 727 LER---LKAGENPYIE-ATLRHLE------DYAAEGLRTLCLASRTVTESEY---AEWKD 773
            +    +++  +  I+ +  +H E      + A++ LRT+ LA +  T+      AE +D
Sbjct: 610 FKSCHYMRSSNDDVIKLSPQKHGEIFGLINNLASDALRTISLAHKDFTDISSWPPAELRD 669

Query: 774 IYDAASTTLD-----DRAQKLDDAAELIEKD---LFLLGATAIEDKLQDGVPETIHTLQD 825
             D ++ + D     +      D   +I  +   L L G   I D L+ GV E++   Q 
Sbjct: 670 ASDPSTASPDLLLGDEYVPTATDRPSIITNNNSGLILDGVVGIHDPLRPGVKESVKNCQQ 729

Query: 826 AGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQIS 885
           +G+ V ++TGD   T   I  +C +LSE          D E   +    +       ++S
Sbjct: 730 SGVTVRMITGDNITTGRAIARACGILSES------EYADHECAMEGPVFR-------KLS 776

Query: 886 QQDMNSLALVIDGKSLGFXXXXXXXXXXXXIGKLCKAVICCRVSPLQKALVVKMVKRKTD 945
           ++ M   A                           K  +  R SP  K + V ++K K +
Sbjct: 777 RRQMMDAA--------------------------PKLKVLARSSPEDKRIFVDILK-KMN 809

Query: 946 SLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 982
            ++   GDG ND   +  A VG  + G+ G   AR A
Sbjct: 810 EVVAVTGDGTNDAPALTLADVGFSM-GISGTGVAREA 845

>Kwal_47.17547
          Length = 1240

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 199/943 (21%), Positives = 368/943 (39%), Gaps = 169/943 (17%)

Query: 250  IGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSR--AQVFSEQLQDFTLSKWVNISVGDII 307
            I  L+++L+ SA      D ++    S+LND +   +V   +  D  L    +I VGDI+
Sbjct: 156  IAVLVVILVGSA-----NDYQKELQFSKLNDKKNDREVIVLRNGDEHLISIHDILVGDIL 210

Query: 308  KVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKFIDKDDLAGMRG 367
             + + + +PAD I++     +G C  + + L GE+   IK+A I         D+   + 
Sbjct: 211  SLQTGDVVPADCILV-----KGSCECDESALTGESA-TIKKAAI---------DVCYEKY 255

Query: 368  KVLSEHPNSSLYTYEGTMNLNGKNISLSPEQMVLRGATLRN---TAWIYGLVVFTGHETK 424
            K LS          +  +++        P+ M++ G+ L +    A +  + V + H   
Sbjct: 256  KQLS--------ATDAAIDIGTPGAEKVPDPMLISGSKLLSGLGRAVVTSVGVNSMHGRT 307

Query: 425  LMR---NATATPIKRTAVERVINM-QIVALFG----VLIVLALISSIGNVIKVTSDAEHL 476
            LM     A  TP++    ER+ ++   ++++G    +L+   L       +K   +   L
Sbjct: 308  LMALKVEAETTPLQ----ERLDSLANSISVYGSAAALLLFFILFMRFLANLKKGGELHDL 363

Query: 477  TYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLYDEASD 536
            T    +G+  + +F   I    +     VP  L + V +   +    +A D +L      
Sbjct: 364  TPAQ-KGSRFMNIFIVGITVIVVA----VPEGLPLAVTLALAFATTRMAKDGNL------ 412

Query: 537  SPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETI---PEDKAATT 593
                VR     E +G    + SDKTGTLT N M      +    + E     P D  + T
Sbjct: 413  ----VRVLRACETMGSATAVCSDKTGTLTENRMTVVKGFLGSTFFDEAESVGPSD--SET 466

Query: 594  EDGIEIGFRKFDSMKE------TLNDTQDPDSHIINDFLTLLATCH----TVIPEFQEDG 643
            +  + I     + +K+      TLN T   +     D ++     H    ++ P  + + 
Sbjct: 467  DVDLAIANECSEELKKDVLTNITLNSTAFENKENEEDKVSNENPFHKPRKSLFPWSRNNK 526

Query: 644  SIKYQAASPDEGALVEGAASLGYKFIIRKPNSVSVLI----EDLGQEQEY---------- 689
            S K   A      LVE AA+   K       + + L+    ++LG +  +          
Sbjct: 527  SKKPATAK----ELVENAAADQPKEPFLGSKTETALLAFAQKNLGMQNLHHYRDEPDCLG 582

Query: 690  --QLLNICEFNSTRKRMSAIFRLPNGEIKLFCKGADTVILERLKAGENPYIEATLRHLED 747
              +++ I  F S+RK    + +  NG  + + KGA  ++L R         + TL   +D
Sbjct: 583  IEKIVQIIPFESSRKWGGIVVKYKNGLHRFYIKGAAELLLRRCMQKRASDSKLTLISQKD 642

Query: 748  Y----------AAEGLRTLCLASRTVTESEY---AEWKDIYDAASTTLD-------DRAQ 787
            +          AAE LR + LA R          +E +D  +  + + D        R+ 
Sbjct: 643  FDEESQTITNLAAEALRAISLAHRDYPNCPNWPPSELQDEVEPEAASPDLLFGDEVSRSD 702

Query: 788  KLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGMS 847
             + + A+ +   + L G   I+D L+ GV +++   Q AG+ V ++TGD   TA  I   
Sbjct: 703  SVSEPAQELVSPMVLDGIVGIQDPLRKGVRKSVEQCQKAGVTVRMVTGDNILTATAIAKK 762

Query: 848  CRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGKSLGFXXXX 907
            C +LSE+        E+ E++ +    + + +S+ +                        
Sbjct: 763  CSILSEE------QAENPESSMEG--PRFRKLSNKE------------------------ 790

Query: 908  XXXXXXXXIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVG 967
                    +  L    +  R SP  K ++V+ +K+  D ++   GDG ND   ++ A VG
Sbjct: 791  -------RVRILPNLRVLARSSPEDKRILVETLKKMGD-VVAVTGDGTNDAPALKLADVG 842

Query: 968  VGISGMEGMQAARSADFAIAQFKYLKKLL--LVHGSWSYQRISQAILYSFYKNIALYMTQ 1025
              + G+ G + AR A   I        ++  +  G      I + I +    N+   +  
Sbjct: 843  FSM-GIAGTEVAREASDIILMTDDFSAIVNAIKWGRCVSTSIKKFIQFQLTVNVTAVVLT 901

Query: 1026 FWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQFVSSRLLDRYPQLYKLGQRG 1085
            F    A++    S++ +  + + N+    L    +          +L+R P+    G+  
Sbjct: 902  FVSAVASSEEA-SVLTAVQLLWVNLIMDTLAALALATDKP--DENILERKPK----GREA 954

Query: 1086 QFFSVRIFWGWVINGFYHSAVTFI----GSTLFYRNGNVLNSH 1124
               +V  +   +        VTFI    G  +F+     +  H
Sbjct: 955  VLITVSTWKMILGQSTLQLIVTFILHFAGKQIFFPGKATITGH 997

>Scas_665.30
          Length = 1439

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 187/849 (22%), Positives = 331/849 (38%), Gaps = 167/849 (19%)

Query: 190 EANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQQVPNVTPTNRYTT 249
           + +R   F SN I+     +A    + LF E      +F +F+  +  +        Y  
Sbjct: 243 QEDRILAFDSNQINLRVKTVA----ELLFNEVLHPFYVFQIFSIILWSL-----DEYYYY 293

Query: 250 IGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVFSEQLQDFTLSKWVNISVGDIIKV 309
            G + ++ I+S +  +VE  +  +S ++++      F+ +++ F    W N++  D++  
Sbjct: 294 AGCIFLISILSIVDTLVETRRTQKSLADMSH-----FACEVRVFRDEFWTNVNSADLVPG 348

Query: 310 NSEE-------AIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKFIDKDDL 362
           +  E         P D ++++     G C +  + L GE+        +  SKF  + + 
Sbjct: 349 DIYEISDPSLTVFPCDSLLLS-----GDCIVNESMLTGES--------VPVSKFPAEPE- 394

Query: 363 AGMRGKVLSEHPNSSLYTY-EGTMNLNGKNISLSPEQMVLRGATLRNTAWIYGLVVFTGH 421
                ++L +  N+ + +Y   +   NG  I        +R       +    +VV TG 
Sbjct: 395 --TMLQLLDDFQNTQISSYLSKSFLFNGTTI--------IRARIPYGQSAALAMVVRTGF 444

Query: 422 ET---KLMRN-----ATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNVIKVTSDA 473
            T    L+R+      T       + + +  M ++ALFG  I      S    IK+  D 
Sbjct: 445 STTKGSLVRSMVFPKPTGFKFYEDSFKYIGVMALIALFGFSI------SCIQFIKIGLDK 498

Query: 474 EHLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLYDE 533
             +    L           DI+T       +VP +L  T+ +   +      S L     
Sbjct: 499 RTMILRAL-----------DIITI------VVPPALPATLTIGTGFAL----SRLKKKGI 537

Query: 534 ASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAATT 593
              SPT V         G+I+ +  DKTGTLT N ++     +   C   +    + A  
Sbjct: 538 FCISPTRVNIG------GKIDILCFDKTGTLTENGLDVLGVQL---CVPSSHNSFQFADL 588

Query: 594 EDGIEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVI----------------- 636
              +   F KF     +LND   P  +   +F   L TCH++                  
Sbjct: 589 VQDVHKLFPKF-----SLNDCSSPRDYRAKNFFISLLTCHSLRVVDNELIGDPLDFKMFQ 643

Query: 637 -------PEFQEDGSIKYQAASPDEGALVEGAASLGYKFIIRKPNSV---SVLIEDLGQE 686
                   +FQE            + AL E    +     +  PNS    +  I++    
Sbjct: 644 FTKWSYEEDFQEKEFHSTYEERRHDNALPENIDIIP---AVVHPNSADPENTFIDN---- 696

Query: 687 QEYQLLNIC---EFNSTRKRMSAIFRLPNGEIK-LFCKGADTVILERLKAGENPY-IEAT 741
             +  L I    EF S  +RMS I +  N ++   F KGA  VI +       P   E  
Sbjct: 697 DPHNFLGIIRSFEFLSELRRMSVIVKPSNEDVYWAFTKGAPEVITQICNKATLPANFEEM 756

Query: 742 LRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLF 801
           L +   Y  +G R +  A R +  + +     +Y          +QK+  + E +E ++ 
Sbjct: 757 LNY---YTHKGYRVIACAGRVLPRNTW-----LY----------SQKV--SREEVESNME 796

Query: 802 LLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIIN 861
            LG    E+KL+    +T+ TLQ+A I+  + TGD   TA+++G  C L+ +   + + +
Sbjct: 797 FLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGRQCNLI-KSKKVYVPS 855

Query: 862 EEDKEATRK---------NLTEKLKAISDHQISQQDMNSLALVIDGK--SLGFXXXXXXX 910
            E+ ++T +         N+ + L + +   I+     S  L I G    + F       
Sbjct: 856 LEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSI 915

Query: 911 XXXXXIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGI 970
                   L K  I  R+SP +K  +++ ++R   ++    GDGAND   ++AA VG+ +
Sbjct: 916 SEDYINTVLLKGTIYARMSPDEKHELMEQLQRLNYTVGFC-GDGANDCGALKAADVGISL 974

Query: 971 SGMEGMQAA 979
           S  E   AA
Sbjct: 975 SEAEASVAA 983

>Kwal_26.9207
          Length = 1469

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 123/479 (25%), Positives = 198/479 (41%), Gaps = 75/479 (15%)

Query: 537  SPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAATTEDG 596
            +PT V  S      G+I+ +  DKTGTLT + ++     +A     +        T   G
Sbjct: 771  APTRVNVS------GKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITNVRG 824

Query: 597  IEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHT---VIPEFQEDGSIKYQAASPD 653
            +   F K+     +LND   P      +FL  L TCH+   V  E   D  + ++     
Sbjct: 825  L---FNKY-----SLNDCGSPIDFKSRNFLVSLLTCHSLRVVDGELLGD-PLDFKMFQFT 875

Query: 654  EGALVEGAASLGYKFIIRKPNSVSVLIEDLG------------------QEQEYQLLNIC 695
              +  E      +  +  + N+ S L E+ G                  +   + LL + 
Sbjct: 876  NWSYAEDFQDFKFHSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLLGVI 935

Query: 696  ---EFNSTRKRMSAIFRLPNGEIKL--FCKGADTVILERLKAGENPYIEATLRHLEDYAA 750
               EF S  +RMS I + P GE     F KGA  VI E       P     +  L+ Y  
Sbjct: 936  RSFEFVSELRRMSVIVK-PYGENVFWGFTKGAPEVISEICNKSTLPANYEQI--LQQYTH 992

Query: 751  EGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIED 810
             G R +  A +T+ +     W+             AQK+  + E +E ++  LG    E+
Sbjct: 993  NGYRVIACAGKTLPKRT---WR------------FAQKV--SREEVESNMEFLGFVVFEN 1035

Query: 811  KLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRK 870
            KL+     T+ +LQDAGI+  + TGD   TA+++G    L++E  ++ +    D     +
Sbjct: 1036 KLKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITES-HVFVPQINDNMDPNE 1094

Query: 871  NL-----TEKLKAISDHQISQQDMN-----SLALVIDGKSLGFXXXXXXXXXXXXIGKLC 920
            +L      +    I D  ++ + MN     ++A+  D   L F            +  L 
Sbjct: 1095 DLIIWRDVDDCDLILD-GVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINM-VLL 1152

Query: 921  KAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAA 979
            K+ I  R+SP +K  +V  ++   D ++   GDGAND   ++AA VGV +S  E   AA
Sbjct: 1153 KSSIYARMSPDEKHELVGQLQ-GLDYVVGFCGDGANDCGALKAADVGVSLSEAEASVAA 1210

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 116/480 (24%), Positives = 190/480 (39%), Gaps = 98/480 (20%)

Query: 551  GQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAATTEDGIEIGFRKFDSMKET 610
            G+I+ +  DKTGTLT + ++     ++  C         +    D  +I F KF     +
Sbjct: 761  GKIDVMCFDKTGTLTEDGLDVLGVRVS--CAATRNKASFSDLISDTHDI-FPKF-----S 812

Query: 611  LNDTQDPDSHIINDFLTLLATCHTV-------------IPEFQ------EDGSIKYQAAS 651
            L D  +PD +   +FL  L TCH++                FQ      E+    +Q  S
Sbjct: 813  LKDCSNPDDYKRRNFLISLLTCHSLRVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFHS 872

Query: 652  -----------PDEGALVEGAASLG-----YKFIIRKPNSVSVLIEDLGQEQEYQLLNIC 695
                       P+   ++             KF+   PN++  +I               
Sbjct: 873  LYEERHEGQNFPENNDIIPAIVHPNDSDERNKFVQNDPNNILGIIRSF------------ 920

Query: 696  EFNSTRKRMSAIFRLPNGE--IKLFCKGADTVILERLKAGENPYIEATLRHLEDYAAEGL 753
            EF S  +RMS I + PN E     + KGA  VI++       P     +  L  Y   G 
Sbjct: 921  EFLSELRRMSVIVK-PNNENVYWAYTKGAPEVIIDICNPATLPSDYDDI--LNFYTHSGY 977

Query: 754  RTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQ 813
            R +  A +T+ ++ +     +Y          +QK+    E +E ++  LG    ++KL+
Sbjct: 978  RVIACAGKTLPKNTW-----LY----------SQKV--RREEVESNMEFLGFIIFQNKLK 1020

Query: 814  DGVPETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSED-------------MNLLII 860
            D    T+  L+ A I+  + TGD   TA+++G  C+L++ED             +  +I 
Sbjct: 1021 DATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIH 1080

Query: 861  NEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGKSLGFXXXXXXXXXXXXIGK-L 919
              E   A     T  L+ I D+           L I G+                + + L
Sbjct: 1081 WNEISNAEHILDTFTLQPIDDYS------GPYTLAITGEVFRIIFSNQDNYSEEYVNEIL 1134

Query: 920  CKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAA 979
             K  I  R+SP +K  +V+ ++ K D  +   GDGAND   ++AA VG+ +S  E   AA
Sbjct: 1135 LKGSIFARMSPDEKHELVEQLQ-KMDYTVGFCGDGANDCGALKAADVGISLSEAEASVAA 1193

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
            Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
            P-type ATPase, start by similarity
          Length = 1280

 Score = 81.3 bits (199), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 180/894 (20%), Positives = 327/894 (36%), Gaps = 184/894 (20%)

Query: 300  NISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETN----LKIKQARIETSK 355
            ++ VGD+I + + + +PAD ++I+     G C  + + L GE++    + +K A  +  +
Sbjct: 256  DLLVGDVISLQTGDVVPADAVLIS-----GSCECDESALTGESDTIKKVALKPALEKYKQ 310

Query: 356  FIDKDDLAGMRGKVLSEH-PNSSLYTYEGTMNLNGKNISLSPEQMVLRGATLRNTAWIYG 414
              +KD    +    + E  P+  L +    ++  G  +  S  +  + G  +        
Sbjct: 311  IFEKDPTIDIGSHGVGEKVPDPLLISGSKLLSGIGNAVITSVGENSVNGRIM-------- 362

Query: 415  LVVFTGHETKLMRNATATPIKRTAVERVINM-QIVALFGVLIVLALISSIGNVIKVTSDA 473
                      L   + +TP++    ER+ N+   ++++G +  L L         +    
Sbjct: 363  --------MALKTESESTPLQ----ERLSNLADNISIYGCMAALVLF--------IILFI 402

Query: 474  EHLTYLY-------LQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIAS 526
              LTYL        L    K   F    +T   +    VP  L + V +   +    +  
Sbjct: 403  RFLTYLPNGKKYHDLPPAQKGSKFMNIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTK 462

Query: 527  DLDLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIP 586
            D +L          VR     E +G    I SDKTGTLT N M         K +   + 
Sbjct: 463  DGNL----------VRVLRACETMGSATAICSDKTGTLTENRM------TVVKGFAGNLG 506

Query: 587  EDKAATTEDGIEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQEDGSIK 646
             D     E+           +K  +    + D+ ++ D L+ ++   T      E+   +
Sbjct: 507  FDDTTHAEN---------KEIKSAVVLRSNCDASLLTDILSNISLNSTAF----ENKESQ 553

Query: 647  YQAASPDEGALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLL-------------- 692
            ++    DE    +   SL   F   + N  S LI D  +E + Q L              
Sbjct: 554  HKDKDVDENPYHKSRKSL---FPWSRNNRTSQLIADAMKENDEQFLGSKTETALLAFAQK 610

Query: 693  -----------------------NICEFNSTRKRMSAIFRLP-NGEIKLFCKGADTVILE 728
                                    +  F S+RK  +   +L  N   + + KGA  ++L+
Sbjct: 611  SLGMKDVHKLRTKPSDLGIDKVVQVIPFESSRKWGAIAVQLADNKGYRFYAKGAAEILLK 670

Query: 729  RLKAGENP----------YIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAA 778
                  N             + + + ++D A+  LRT+ L  R   E    E+ D  D +
Sbjct: 671  VCSNQRNSDNSIVPMNQDLYDESFKKIQDMASHALRTISLVHRDFKEWPPKEFADSTDPS 730

Query: 779  STTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQ 838
              + D       D   L  + + L     ++D L++GV E++   Q AG+ V ++TGD  
Sbjct: 731  IASPDLVMGHELDHKNLSSEGMTLDAMVGLQDPLREGVKESVEQCQRAGVTVRMVTGDNI 790

Query: 839  ETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDG 898
             TA  I  +C +LSE+         D E   +  T +       ++  + M         
Sbjct: 791  LTARAISRNCNILSEE------GYNDPECAMEGPTFR-------KLPYKKM--------- 828

Query: 899  KSLGFXXXXXXXXXXXXIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDV 958
                             +  + K  +  R SP  K ++V+ +K K   ++   GDG ND 
Sbjct: 829  -----------------LRVIPKLRVLARSSPEDKRILVETLK-KMGEVVAVTGDGTNDA 870

Query: 959  SMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLL--LVHGSWSYQRISQAILYSFY 1016
              ++ A VG  + G+ G + AR A   I        ++  +  G      I + I +   
Sbjct: 871  PALKLADVGFSM-GISGTEVAREASDIILMTDDFTAIVNAIKWGRCVSVSIKKFIQFQLT 929

Query: 1017 KNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGV--FDQFVSSRLLDR 1074
             NI   +  F    A+A    S++ +  + + N+    L    +     D+F+    LDR
Sbjct: 930  VNITAVILTFVSAVASAEE-TSVLTAVQLLWVNLIMDTLAALALATDKPDEFI----LDR 984

Query: 1075 YPQLYKLGQRGQFFSVRIFWGWVINGFYHSAVTFI----GSTLFYRNGNVLNSH 1124
             P+    G+     +V  +   +        VTF+    G  +F+ N   + +H
Sbjct: 985  KPK----GRDAPLIAVSTWKMILGQAALQLTVTFVLHFRGKEIFFPNKRTITAH 1034

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 121/473 (25%), Positives = 194/473 (41%), Gaps = 78/473 (16%)

Query: 551  GQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAATTEDGIEIGFRKFDSMKET 610
            G+++ +  DKTGTLT   ++      A      TI +     T D  E+        K T
Sbjct: 760  GKVDMMCFDKTGTLTEEGLDVLGIHFAKPEGSSTILQLSDLIT-DCDEV------LQKHT 812

Query: 611  LNDTQDPDSHIINDFLTLLATCHTV---------------IPEFQ----EDG--SIKYQA 649
            L+D    +     +FL  L TCH++               + EF     E+G  S K++ 
Sbjct: 813  LSDCNSAEEFKAKNFLVSLLTCHSLKHIDGELLGDPLDLKMFEFTKWAYEEGYESWKFKN 872

Query: 650  ASPDEG---ALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSA 706
            A    G   A+V   ++    FI   P+++  +I               EF S  +RMS 
Sbjct: 873  AEDKTGISPAVVHPTSNCN--FIENDPDNLIGVIRSF------------EFLSELRRMSV 918

Query: 707  IFR-LPNGEIKLFCKGADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTE 765
            I +         F KGA  VI +       P     L H   Y   G R +  A +T+ +
Sbjct: 919  IVKGFKENTYWSFTKGAPEVIADICNPATIPKDFHELLH--HYTHNGFRIIACAGKTLPK 976

Query: 766  SEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQD 825
            S +     +Y          +QK+  + E +E +L  LG    E+KL+      +  LQ+
Sbjct: 977  SSW-----LY----------SQKV--SREEVEDNLEFLGFIVFENKLKSRTKAALKELQN 1019

Query: 826  AGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEK--------LK 877
            A I+  + TGD   TAV++G    L+S +   +    ++ E +R  L+ +        L 
Sbjct: 1020 ANIRTVMCTGDNVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLD 1079

Query: 878  AISDHQISQQDMNSLALVIDGKSLGFXXXXXXXXXXXXIGK-LCKAVICCRVSPLQKALV 936
            A++   ++  +  S  L I G                 I   L K  I  R+SP +K  +
Sbjct: 1080 AVTLKPLNDPE-KSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYARMSPDEKHEL 1138

Query: 937  VKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAA--RSADFAIA 987
            V+ ++ K D  +   GDGAND   ++AA++G+ +S  E   AA   SA F I+
Sbjct: 1139 VEQLQ-KLDYNVGFCGDGANDCGALKAANIGISLSEAEASVAAPFTSAVFDIS 1190

>Kwal_23.3160
          Length = 1100

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 224/1051 (21%), Positives = 404/1051 (38%), Gaps = 229/1051 (21%)

Query: 309  VNSEEAIPADVIVIASSE--PEGLCYIETAN-------LDGETNLKIKQAR-----IETS 354
            + S++ +P D+ V+ + +  P  L  IE  N       L GE+    K+A       E +
Sbjct: 147  IPSKQLVPGDLCVVKAGDTVPADLRLIECVNFETDEALLTGESLPIAKEASQVYPATEDT 206

Query: 355  KFIDKDDLAGM-----RGKVLSEHPNSSLYTYEGTM--NLNGKNISLSPEQMVLRGATLR 407
               D+ +LA       +G+       + L T  G +  +L G N  +S ++         
Sbjct: 207  PVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKGDNSLISKDE--------N 258

Query: 408  NTAWIYGLVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNVI 467
             T W    +         +   T TP+ R   +  + +  +A+   ++V+A    + N  
Sbjct: 259  KTFWANAGITLAATIGSFLGTTTGTPLHRKLSKLAVLLFFIAVVFAIVVMATQKFVVN-- 316

Query: 468  KVTSDAEHLTYLYLQGTNKVGLFFKDILTYWILFS-NLVPISLFVTVEMIKYYQAYMIAS 526
                                    K++  Y I  + +++P SL V + +     A ++A+
Sbjct: 317  ------------------------KEVAIYAICVAVSMIPSSLVVVLTITMSVGAKIMAT 352

Query: 527  DLDLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVM--------EFKSCSIAG 578
                         VVR    +E LG +  + SDKTGTLT+  M         F + +++ 
Sbjct: 353  ----------RNVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQAWVPSFGTITVSN 402

Query: 579  KCY--------IETIP-----EDKAATTED-GIEIGFR-KF--DSMKETLNDTQDPDSHI 621
                       IE IP     + K  +TED GI   F+ KF  D +   LN      S +
Sbjct: 403  SSNPFDPTDGGIELIPRFSPHQYKHDSTEDVGIITSFKNKFYNDKLPAGLN------SKL 456

Query: 622  INDFLTLLATCHTVIPEFQEDGSIKYQA-ASPDEGALVEGAASLGY--KFIIRKPNSVSV 678
              ++L   A  + +   +Q+  + +++A   P E A+   A  L      +  +  S S 
Sbjct: 457  FLNWLKTAALAN-IAHVYQDPETEEWKAHGDPTEIAIQVFAHKLDMPRNALTAEDKSDSE 515

Query: 679  LIED--LGQ-----EQEYQLLNICEFNSTRKRMSAIFRL--PNGEIKLFCKGADTVILER 729
              ED  LG+     E  Y+ +    F+S+ KRMSA++     +   ++F KGA   +L+ 
Sbjct: 516  SDEDAALGEKTSSVEPHYKHIAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDC 575

Query: 730  ----LKAGEN-----PYIEA----TLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYD 776
                L  G N     P  E       +++E  ++EGLR L  A+++ TES+         
Sbjct: 576  CTKWLPDGCNESDAKPMTEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQ--------- 626

Query: 777  AASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGD 836
            A   + D R  +     + +E DL   G   I D  +      +     AGI V +LTGD
Sbjct: 627  ALKVSEDLRKNR-----DFVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGD 681

Query: 837  RQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVI 896
               TA  I     +L  ++         KE     +   + A    Q++ +++++L L+ 
Sbjct: 682  FPGTAKAIAQEVGILPRNL-----YHYPKEVVDSMV---MTAAQFDQLTDEEIDNLLLL- 732

Query: 897  DGKSLGFXXXXXXXXXXXXIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGAN 956
                                      ++  R +P  K  ++  + R+ +      GDG N
Sbjct: 733  -------------------------PLVIARCAPQTKVRMIDALHRR-EKFCAMTGDGVN 766

Query: 957  DVSMIQAAHVGVGISGMEGMQAARSA-DFAIAQFKYLKKLLLV-HGSWSYQRISQAILYS 1014
            D   ++ A+VG+ + G+ G   A+ A D  ++   +   L  V  G      I + +L  
Sbjct: 767  DSPSLKKANVGIAM-GINGSDVAKDASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQL 825

Query: 1015 FYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVL-----PPFVMGVFDQFVSS 1069
              +N+A      + +    +  +  +  + ++   V + ++     P   MG+  +  + 
Sbjct: 826  LAENVA---QALYLMIGLCFLDEDRLSVFPLSPVEVLWIIVVTSCFP--AMGLGLEKSAP 880

Query: 1070 RLLDRYPQLYKLGQRGQFFSVRIFWGWVINGFYHSAV---TFIGSTLFYRNG------NV 1120
             ++++ PQ  K G     F+  I    +I G + +A     FI  T+ Y  G      N 
Sbjct: 881  DIMEKEPQDSKAG----IFTWEIILDMLIYGTWMAACCLACFI--TVIYGKGNGELGINC 934

Query: 1121 LNSHGETADHWAWG-----VSIYTCSVI----IVIGKAALVTNQ------WTKFTAFAIP 1165
             NS+ E+ D+   G      S+  C++I    ++  + +    Q      +T++      
Sbjct: 935  NNSYSESCDNVYHGRAATFASMTWCALILAWEVIDMRRSFFKMQPETDTPYTQWMKDIWS 994

Query: 1166 GSLVFWLVFFPIYASILPHANVSKEYYGVVSHVYGSATFWLMCIVLPTFALMRDLVWKYY 1225
               +FW V F  + S+ P   +      V  H  G    W + +       +   ++KY+
Sbjct: 995  NQFLFWSVIFG-FVSVFPVVYIPVINKDVFKH-KGIGYEWGLAVAYTIAFWIGAELYKYF 1052

Query: 1226 KRTY--------TP----ESYHVVQEMQKYN 1244
            KR Y         P    ES  V    +KYN
Sbjct: 1053 KRCYFKNKGRAQNPEKDLESRRVHDPFEKYN 1083

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 85/325 (26%), Positives = 142/325 (43%), Gaps = 46/325 (14%)

Query: 667  KFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRLPNGEIKL-FCKGADTV 725
            +FI R+P++V  ++               EF S  +RMS I +  +  + + F KGA  V
Sbjct: 900  RFIEREPSNVIGIVRSF------------EFLSNLRRMSVIVKPFSENVFMSFTKGAPEV 947

Query: 726  ILERLKAGENPY-IEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDD 784
            I E       P   EA L H   Y   G R +  A + +T   +     +Y         
Sbjct: 948  IFELCSKQTLPLDYEALLHH---YTHNGYRVIACAGKKLTRQSW-----LY--------- 990

Query: 785  RAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNI 844
             +QK+  + E IE +L  LG    E+KL+    ET+ +L  A I+  + TGD   TA+++
Sbjct: 991  -SQKV--SREEIESNLEFLGFIIFENKLKGTTKETLESLHRADIRTIMCTGDNVLTAISV 1047

Query: 845  GM------SCRLLSEDMNLLIINEEDKEATRKNL---TEKLKAISDHQISQQDMNSLALV 895
            G       S R+    +N +  ++E    T +N+   ++ L +++   +S  D +   L 
Sbjct: 1048 GREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSVTLRPLS-GDTDDYTLA 1106

Query: 896  IDGKSLGFXXXXXXXXXXXXIGK-LCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDG 954
            + G+                I   L K  I  R+SP +K  +V+ ++     +    GDG
Sbjct: 1107 VTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQSIGYQVGFC-GDG 1165

Query: 955  ANDVSMIQAAHVGVGISGMEGMQAA 979
            AND   ++AA +G+ +S  E   AA
Sbjct: 1166 ANDCGALKAADIGISLSEAEASVAA 1190

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 185/843 (21%), Positives = 321/843 (38%), Gaps = 149/843 (17%)

Query: 190  EANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAIQQVPNVTPTNRYTT 249
            + +R   FG N I+      +    + LF E      +F +F+  +  +        Y  
Sbjct: 467  QEDRELAFGKNQINLRMKTTS----EILFNEVLHPFYVFQVFSIILWGI-----DEYYYY 517

Query: 250  IGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVFSEQLQDFTLSKWVNISVGDIIKV 309
               + ++ ++S    + E  K +++ +E++     V   + + +T      +  GDI +V
Sbjct: 518  AACIFLISVLSIFDSLNEQKKVSRNLAEMSHFHCDVRVLRDKFWTTISSSELVPGDIYEV 577

Query: 310  NSEEA--IPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKFIDKDDLAGMRG 367
            +      +P D I+++S      C +  + L GE+    K    E + +   DD      
Sbjct: 578  SDPNITILPCDSILLSSD-----CIVNESMLTGESVPVSKFPATEETMYQLCDDFQST-- 630

Query: 368  KVLSEHPNSSLYTYEGTMNLNGKNI---SLSPEQMVLRGATLRNTAWIYGLVVFTGHETK 424
            ++ S    S LY        NG NI    ++P Q       +R      G     G   +
Sbjct: 631  QISSFVSKSFLY--------NGTNIIRARIAPGQTAALAMVVRT-----GFSTTKGSLVR 677

Query: 425  LMRNATATPIK--RTAVERVINMQIVALFGVLIVLALISSIGNVIKVTSDAEHLTYLYLQ 482
             M     T  K  R + + +  M ++A+FG  +      S    IK+  D + +    L 
Sbjct: 678  SMVFPKPTGFKFYRDSFKYIGFMSLIAIFGFCV------SCVQFIKLGLDKKTMILRAL- 730

Query: 483  GTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLYDEASDSPTVVR 542
                      DI+T       +VP +L  T+ +   +      S L        SPT + 
Sbjct: 731  ----------DIITI------VVPPALPATLTIGTNFAL----SRLKEKGIFCISPTRLN 770

Query: 543  TSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAATTEDGIEIGFR 602
             S      G+I+ +  DKTGTLT + ++     I+       +   K       I   F 
Sbjct: 771  IS------GKIDVMCFDKTGTLTEDGLDVLGVQISEP---NGVRGQKFGELLSDIRQVFP 821

Query: 603  KFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIP--------------------EFQED 642
            KF     +LND   P      +F   L TCH++                       F+ED
Sbjct: 822  KF-----SLNDCSSPLDFKSRNFFMSLLTCHSLRSVDGNLLGDPLDFKMFQFTGWSFEED 876

Query: 643  GSIK-----YQAASPDEGALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEF 697
               +     Y+    D+  +    + +    +    N+      D        ++   EF
Sbjct: 877  FQKRAFHSLYEGRHEDD--VFPENSEIIPAVVHPDSNNRENTFTDNDPHNFLGVVRSFEF 934

Query: 698  NSTRKRMSAIFRLPNGEIKL-FCKGADTVILERLKAGENPY-IEATLRHLEDYAAEGLRT 755
             S  +RMS I +  N ++   F KGA  VI E       P   E  LR    Y   G R 
Sbjct: 935  LSELRRMSVIVKTNNDDVYWSFTKGAPEVISEICNKSTLPADFEEVLRC---YTHNGYRV 991

Query: 756  LCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDG 815
            +  A +T+ +  +     +Y          +QK+  + E +E +L  LG    ++KL+  
Sbjct: 992  IACAGKTLPKRTW-----LY----------SQKV--SREEVESNLEFLGFIIFQNKLKKE 1034

Query: 816  VPETIHTLQDAGIKVWVLTGDRQETAVNIG-----MSC-RLLSEDMN--------LLI-- 859
              ET+ +LQDA I+  + TGD   TA+++G     + C R+    +N        +++  
Sbjct: 1035 TSETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVWR 1094

Query: 860  -INEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGKSLGFXXXXXXXXXXXXIGK 918
             +NE DK    K L  K   + ++ +      +  L + G                 + +
Sbjct: 1095 DVNEPDKILDTKTL--KPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNE 1152

Query: 919  -LCKAVICCRVSPLQK-ALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGM 976
             L  + I  R+SP +K  L++++  +K D  +   GDGAND   ++AA VG+ +S  E  
Sbjct: 1153 ILLNSSIYARMSPDEKHELMIQL--QKLDYTVGFCGDGANDCGALKAADVGISLSEAEAS 1210

Query: 977  QAA 979
             AA
Sbjct: 1211 VAA 1213

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
            involved in Na+ and Li+ efflux, required for Na+
            tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 202/923 (21%), Positives = 354/923 (38%), Gaps = 186/923 (20%)

Query: 309  VNSEEAIPADVIVIASSE--PEGLCYIETANLD-------GETNLKIKQARI-----ETS 354
            +NS++ +P D+ ++   +  P  L  IET N D       GE+    K A +     E +
Sbjct: 141  INSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEET 200

Query: 355  KFIDKDDLA---------GMRGKVLSEHPNSSLYTYEGTMNLNGKNISLSPEQMVLRGAT 405
               D+ +LA           +G V+    NS +     ++  +   IS  P +     + 
Sbjct: 201  SVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSK-----SW 255

Query: 406  LRNTAWIYGLVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGN 465
            L+NT WI          TK +  A       T + R ++   V LF + ++ A+I     
Sbjct: 256  LQNT-WI---------STKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQ 305

Query: 466  VIKVTSDAEHLTYLYLQGTNKVGLFFKDILTYWILFS-NLVPISLFVTVEMIKYYQAYMI 524
               V                      K +  Y I  + +++P SL V + +     A ++
Sbjct: 306  KFDVD---------------------KRVAIYAICVALSMIPSSLVVVLTITMSVGAAVM 344

Query: 525  ASDLDLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVM--------EFKSCSI 576
             S             +VR    +E LG +  I SDKTGTLT+  M         F + +I
Sbjct: 345  VS----------RNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITI 394

Query: 577  AG--------KCYIETIPEDKA---ATTEDGIEIGFRKFDSMKETLNDTQDPDSHIINDF 625
            +         +  +  IP       +  EDG ++G     + K+ L +   P+   ++ F
Sbjct: 395  SNSDDPFNPNEGNVSLIPRFSPYEYSHNEDG-DVGI--LQNFKDRLYEKDLPEDIDMDLF 451

Query: 626  LTLL--ATCHTVIPEFQEDGSIKYQA-ASPDEGALVEGAASL--------GYKFIIR-KP 673
               L  AT   +   F++D +  ++A   P E A+   A  +        G K   +   
Sbjct: 452  QKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNE 511

Query: 674  NSVSVLIEDLGQEQEYQLLNICEF--NSTRKRMSAIFRLPNGEI-KLFCKGADTVILE-- 728
            N  S L +   +    Q  +I EF  +ST KRMS+++   + E   ++ KGA   I+   
Sbjct: 512  NDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCC 571

Query: 729  ---------RLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAAS 779
                     ++    +  +E   +++   + EGLR L  AS++ T+ +            
Sbjct: 572  SSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVN---------- 621

Query: 780  TTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQE 839
               DD+ + +       E DL  LG   I D  ++     +     AGI V +LTGD   
Sbjct: 622  ---DDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVG 678

Query: 840  TAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGK 899
            TA  I     +L    NL   ++E  ++     ++    +S+ ++   D+  L LVI   
Sbjct: 679  TAKAIAQEVGILP--TNLYHYSQEIVDSMVMTGSQ-FDGLSEEEV--DDLPVLPLVI--- 730

Query: 900  SLGFXXXXXXXXXXXXIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVS 959
                                       R SP  K  +++ + R+     +  GDG ND  
Sbjct: 731  --------------------------ARCSPQTKVRMIEALHRRKKFCTMT-GDGVNDSP 763

Query: 960  MIQAAHVGVGISGMEGMQAARSA-DFAIAQFKYLKKLLLV-HGSWSYQRISQAILYSFYK 1017
             ++ A+VG+ + G+ G   ++ A D  ++   +   L  V  G      I + +L    +
Sbjct: 764  SLKMANVGIAM-GINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAE 822

Query: 1018 NI--ALYMTQFWYVFANAYSGQSIME-SWTMTFYNVFFTVLPPFVMGVFDQFVSSRLLDR 1074
            N+  ALY+     VF +  +G+S+   S     + +  T   P  MG+  +  +  L+DR
Sbjct: 823  NVAQALYLI-IGLVFRDE-NGKSVFPLSPVEVLWIIVVTSCFP-AMGLGLEKAAPDLMDR 879

Query: 1075 YPQLYKLGQRGQFFSVRIF-WGWVINGFYHSAVTFIGSTLFYRNGNVLNSHGETADHWAW 1133
             P   ++G         IF W  +I+ F +  +   GS +    G++   +     H   
Sbjct: 880  PPHDSEVG---------IFTWEVIIDTFAY-GIIMTGSCMASFTGSLYGINSGRLGHDCD 929

Query: 1134 GVSIYTCSVIIVIGKAALVTNQW 1156
            G    +C  +     AA  T  W
Sbjct: 930  GTYNSSCRDVYRSRSAAFATMTW 952

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 202/923 (21%), Positives = 354/923 (38%), Gaps = 186/923 (20%)

Query: 309  VNSEEAIPADVIVIASSE--PEGLCYIETANLD-------GETNLKIKQARI-----ETS 354
            +NS++ +P D+ ++   +  P  L  IET N D       GE+    K A +     E +
Sbjct: 141  INSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEET 200

Query: 355  KFIDKDDLA---------GMRGKVLSEHPNSSLYTYEGTMNLNGKNISLSPEQMVLRGAT 405
               D+ +LA           +G V+    NS +     ++  +   IS  P +     + 
Sbjct: 201  SVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSK-----SW 255

Query: 406  LRNTAWIYGLVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGN 465
            L+NT WI          TK +  A       T + R ++   V LF + ++ A+I     
Sbjct: 256  LQNT-WI---------STKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQ 305

Query: 466  VIKVTSDAEHLTYLYLQGTNKVGLFFKDILTYWILFS-NLVPISLFVTVEMIKYYQAYMI 524
               V                      K +  Y I  + +++P SL V + +     A ++
Sbjct: 306  KFDVD---------------------KRVAIYAICVALSMIPSSLVVVLTITMSVGAAVM 344

Query: 525  ASDLDLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVM--------EFKSCSI 576
             S             +VR    +E LG +  I SDKTGTLT+  M         F + +I
Sbjct: 345  VS----------RNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITI 394

Query: 577  AG--------KCYIETIPEDKA---ATTEDGIEIGFRKFDSMKETLNDTQDPDSHIINDF 625
            +         +  +  IP       +  EDG ++G     + K+ L +   P+   ++ F
Sbjct: 395  SNSDDPFNPNEGNVSLIPRFSPYEYSHNEDG-DVGI--LQNFKDRLYEKDLPEDIDMDLF 451

Query: 626  LTLL--ATCHTVIPEFQEDGSIKYQA-ASPDEGALVEGAASL--------GYKFIIR-KP 673
               L  AT   +   F++D +  ++A   P E A+   A  +        G K   +   
Sbjct: 452  QKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNE 511

Query: 674  NSVSVLIEDLGQEQEYQLLNICEF--NSTRKRMSAIFRLPNGEI-KLFCKGADTVILE-- 728
            N  S L +   +    Q  +I EF  +ST KRMS+++   + E   ++ KGA   I+   
Sbjct: 512  NDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCC 571

Query: 729  ---------RLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAAS 779
                     ++    +  +E   +++   + EGLR L  AS++ T+ +            
Sbjct: 572  SSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVN---------- 621

Query: 780  TTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQE 839
               DD+ + +       E DL  LG   I D  ++     +     AGI V +LTGD   
Sbjct: 622  ---DDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVG 678

Query: 840  TAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGK 899
            TA  I     +L    NL   ++E  ++     ++    +S+ ++   D+  L LVI   
Sbjct: 679  TAKAIAQEVGILP--TNLYHYSQEIVDSMVMTGSQ-FDGLSEEEV--DDLPVLPLVI--- 730

Query: 900  SLGFXXXXXXXXXXXXIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVS 959
                                       R SP  K  +++ + R+     +  GDG ND  
Sbjct: 731  --------------------------ARCSPQTKVRMIEALHRRKKFCAMT-GDGVNDSP 763

Query: 960  MIQAAHVGVGISGMEGMQAARSA-DFAIAQFKYLKKLLLV-HGSWSYQRISQAILYSFYK 1017
             ++ A+VG+ + G+ G   ++ A D  ++   +   L  V  G      I + +L    +
Sbjct: 764  SLKMANVGIAM-GINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAE 822

Query: 1018 NI--ALYMTQFWYVFANAYSGQSIME-SWTMTFYNVFFTVLPPFVMGVFDQFVSSRLLDR 1074
            N+  ALY+     VF +  +G+S+   S     + +  T   P  MG+  +  +  L+DR
Sbjct: 823  NVAQALYLI-IGLVFRDE-NGKSVFPLSPVEVLWIIVVTSCFP-AMGLGLEKAAPDLMDR 879

Query: 1075 YPQLYKLGQRGQFFSVRIF-WGWVINGFYHSAVTFIGSTLFYRNGNVLNSHGETADHWAW 1133
             P   ++G         IF W  +I+ F +  +   GS +    G++   +     H   
Sbjct: 880  PPHDSEVG---------IFTWEVIIDTFAY-GIIMTGSCMASFTGSLYGINSGRLGHDCD 929

Query: 1134 GVSIYTCSVIIVIGKAALVTNQW 1156
            G    +C  +     AA  T  W
Sbjct: 930  GTYNSSCRDVYRSRSAAFATMTW 952

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
           Ca2+-transporting P-type ATPase of Golgi membrane
           involved in Ca2+ and Mn2+ import into Golgi [2853 bp,
           950 aa]
          Length = 950

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 160/693 (23%), Positives = 268/693 (38%), Gaps = 170/693 (24%)

Query: 304 GDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQAR-IETSKFIDKDDL 362
           GD++     + IPAD+ +I + +      I+ +NL GE     K ++ IE S F D+   
Sbjct: 172 GDLVHFRIGDRIPADIRIIEAID----LSIDESNLTGENEPVHKTSQTIEKSSFNDQ--- 224

Query: 363 AGMRGKVLSEHPNSSLYTYEGTMNLNGKNISLSPEQMVLRGATLRNTAWIYGLVVFTGHE 422
                      PNS               + +S    +    TL       G+VV TG  
Sbjct: 225 -----------PNSI--------------VPISERSCIAYMGTLVKEGHGKGIVVGTGTN 259

Query: 423 T------KLMRN--ATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNVIKVTSDAE 474
           T      ++M N     TP++ T  +   ++ +V+     IV+ +I  +G          
Sbjct: 260 TSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSF----IVIGMICLVG---------- 305

Query: 475 HLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLYDEA 534
                 +QG + + +F   +          +PI + VT+ +     A   A         
Sbjct: 306 -----IIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKA--------- 351

Query: 535 SDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKS--C--SIAGKCYIETIPEDKA 590
                +VR    VE LG +  I SDKTGTLT N M      C  S++ K  + ++ ++K 
Sbjct: 352 -----IVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKK 406

Query: 591 ATTEDGIEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQEDGSIKYQAA 650
               +G         ++K  L  T+D     + + LT+   C+     F ++ +I     
Sbjct: 407 TKNSNG---------NLKNYL--TED-----VRETLTIGNLCNNA--SFSQEHAIFL--G 446

Query: 651 SPDEGALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRL 710
           +P + AL+E  A+     I    N+V          Q+ Q L    FNS RK M+     
Sbjct: 447 NPTDVALLEQLANFEMPDI---RNTV----------QKVQEL---PFNSKRKLMATKILN 490

Query: 711 P-NGEIKLFCKGADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEYA 769
           P + +  ++ KGA     ER+      Y+++  +  E        T+         S  +
Sbjct: 491 PVDNKCTVYVKGA----FERILEYSTSYLKSKGKKTEKLTEAQKATI----NECANSMAS 542

Query: 770 EWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIK 829
           E   ++  A  TL D +  L    E + KDL   G   + D  +  V   I  L   G+ 
Sbjct: 543 EGLRVFGFAKLTLSDSSTPL---TEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVH 599

Query: 830 VWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDM 889
           + ++TGD + TAVNI     +   D  L +++            +KL  +SD Q      
Sbjct: 600 IIMITGDSENTAVNIAKQIGIPVIDPKLSVLS-----------GDKLDEMSDDQ------ 642

Query: 890 NSLALVIDGKSLGFXXXXXXXXXXXXIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLL 949
             LA VID  +                       I  R +P  K  +V+ ++++ D + +
Sbjct: 643 --LANVIDHVN-----------------------IFARATPEHKLNIVRALRKRGDVVAM 677

Query: 950 AIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 982
             GDG ND   ++ + +GV + G  G   A+ A
Sbjct: 678 T-GDGVNDAPALKLSDIGVSM-GRIGTDVAKEA 708

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 951

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 113/466 (24%), Positives = 174/466 (37%), Gaps = 139/466 (29%)

Query: 540 VVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKS--C--SIAGKCYIETIPEDKAATTED 595
           +VR    VE LG +  I SDKTGTLT N M      C  S+A K  + ++ ++K    ++
Sbjct: 360 IVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSLDKNKGGNLKN 419

Query: 596 GIEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQEDGSIKYQAASPDEG 655
            +       D +K TL                    C          G++   A+   E 
Sbjct: 420 YLT------DDVKTTL-------------------LC----------GNLCNNASYSQEH 444

Query: 656 ALVEGAASLGYKFIIRKPNSVSVLIEDLGQ------EQEYQLLNICEFNSTRKRMSAIFR 709
           A   G            P  V+ L+E L +        EY  +    FNS RK M+   +
Sbjct: 445 AKYLG-----------NPTDVA-LLEQLQKFELADVRSEYTKVKELSFNSKRKMMATKIQ 492

Query: 710 LPNGEIKLFCKGADTVIL-------------ERLKAGENPYIEATLRHLEDYAAEGLRTL 756
               +  LF KGA   IL             E+L AG     E  +      A+EGLR L
Sbjct: 493 DNEKKTTLFIKGAFERILDKSSSYLTEKGKIEKLTAGHR---ETIIDCANTLASEGLRVL 549

Query: 757 CLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGV 816
             A R +T           D++S  ++D              DL   G   + D  +  V
Sbjct: 550 AFAKRAMT-----------DSSSKLVEDDIS-----------DLVFTGLIGMNDPPRSSV 587

Query: 817 PETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKL 876
              I      GI + ++TGD + TAVNI       +  + + +I+             KL
Sbjct: 588 KFAIDQFLQGGIHIIMITGDSENTAVNI-------ARQIGIPVID------------PKL 628

Query: 877 KAISDHQISQQDMNSLALVIDGKSLGFXXXXXXXXXXXXIGKLCKAVICCRVSPLQKALV 936
             +S  ++++   + LA VID  +                       I  R +P  K  +
Sbjct: 629 SVLSGDKLNEMTDDQLANVIDHVN-----------------------IFARATPEHKLNI 665

Query: 937 VKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 982
           V+ ++R+ D + +  GDG ND   ++ A +GV +  M G   A+ A
Sbjct: 666 VRALRRRGDVVAMT-GDGVNDAPALKLADIGVSMGRM-GTDVAKEA 709

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
            Na[+]-transporting ATPases family in the superfamily of
            P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 70.9 bits (172), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 202/923 (21%), Positives = 354/923 (38%), Gaps = 186/923 (20%)

Query: 309  VNSEEAIPADVIVIASSE--PEGLCYIETANLD-------GETNLKIKQARI-----ETS 354
            +NS++ +P D+ ++   +  P  L  IET N D       GE+    K A +     E +
Sbjct: 141  INSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEET 200

Query: 355  KFIDKDDLA---------GMRGKVLSEHPNSSLYTYEGTMNLNGKNISLSPEQMVLRGAT 405
               D+ +LA           +G V+    NS +     ++  +   IS  P +     + 
Sbjct: 201  SVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLISRDPSK-----SW 255

Query: 406  LRNTAWIYGLVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGN 465
            L+NT WI          TK +  A       T + R ++   V LF + ++ A+I     
Sbjct: 256  LQNT-WI---------STKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQ 305

Query: 466  VIKVTSDAEHLTYLYLQGTNKVGLFFKDILTYWILFS-NLVPISLFVTVEMIKYYQAYMI 524
               V                      K +  Y I  + +++P SL V + +     A ++
Sbjct: 306  KFDVD---------------------KRVAIYAICVALSMIPSSLVVVLTITMSVGAAVM 344

Query: 525  ASDLDLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVM--------EFKSCSI 576
             S             +VR    +E LG +  I SDKTGTLT+  M         F + +I
Sbjct: 345  VS----------RNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITI 394

Query: 577  AG--------KCYIETIPEDKA---ATTEDGIEIGFRKFDSMKETLNDTQDPDSHIINDF 625
            +         +  +  IP       +  EDG ++G     + K+ L +   P+   ++ F
Sbjct: 395  SNSDDPFNPNEGNVSLIPRFSPYEYSHNEDG-DVGI--LQNFKDRLYEKDLPEDIDMDLF 451

Query: 626  LTLL--ATCHTVIPEFQEDGSIKYQA-ASPDEGALVEGAASL--------GYKFIIR-KP 673
               L  AT   +   F++D +  ++A   P E A+   A  +        G K   +   
Sbjct: 452  QKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNE 511

Query: 674  NSVSVLIEDLGQEQEYQLLNICEF--NSTRKRMSAIFRLPNGEI-KLFCKGADTVILE-- 728
            N  S L +   +    Q  +I EF  +ST KRMS+++   + E   ++ KGA   I+   
Sbjct: 512  NDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCC 571

Query: 729  ---------RLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAAS 779
                     ++    +  +E   +++   + EGLR L  AS++ T+ +            
Sbjct: 572  SSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVN---------- 621

Query: 780  TTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQE 839
               DD+ + +       E DL  LG   I D  ++     +     AGI V +LTGD   
Sbjct: 622  ---DDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVG 678

Query: 840  TAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGK 899
            TA  I     +L    NL   ++E  ++     ++    +S+ ++   D+  L LVI   
Sbjct: 679  TAKAIAQEVGILP--TNLYHYSQEIVDSMVMTGSQ-FDGLSEEEV--DDLPVLPLVI--- 730

Query: 900  SLGFXXXXXXXXXXXXIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVS 959
                                       R SP  K  +++ + R+     +  GDG ND  
Sbjct: 731  --------------------------ARCSPQTKVRMIEALHRRKKFCAMT-GDGVNDSP 763

Query: 960  MIQAAHVGVGISGMEGMQAARSA-DFAIAQFKYLKKLLLV-HGSWSYQRISQAILYSFYK 1017
             ++ A+VG+ + G+ G   ++ A D  ++   +   L  V  G      I + +L    +
Sbjct: 764  SLKMANVGIAM-GINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAE 822

Query: 1018 NI--ALYMTQFWYVFANAYSGQSIME-SWTMTFYNVFFTVLPPFVMGVFDQFVSSRLLDR 1074
            N+  ALY+     VF +  +G+S+   S     + +  T   P  MG+  +  +  L+DR
Sbjct: 823  NVAQALYLI-IGLVFRDE-NGKSVFPLSPVEVLWIIVVTSCFP-AMGLGLEKAAPDLMDR 879

Query: 1075 YPQLYKLGQRGQFFSVRIF-WGWVINGFYHSAVTFIGSTLFYRNGNVLNSHGETADHWAW 1133
             P   ++G         IF W  +I+ F +  +   GS +    G++   +     H   
Sbjct: 880  PPNDSEVG---------IFTWEVIIDTFAY-GIIMTGSCMASFTGSLYGINSGRLGHDCD 929

Query: 1134 GVSIYTCSVIIVIGKAALVTNQW 1156
            G    +C  +     AA  T  W
Sbjct: 930  GTYNSSCRDVYRSRSAAFATMTW 952

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
           cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
           efflux, start by similarity
          Length = 1082

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 130/550 (23%), Positives = 217/550 (39%), Gaps = 145/550 (26%)

Query: 492 KDILTYWILFS-NLVPISLFVTVEMIKYYQAYMIASDLDLYDEASDSPTVVRTSSLVEEL 550
           K +  Y I  + +++P SL V + +     A ++A+             +VR    +E L
Sbjct: 311 KQVAIYAICVAISMIPSSLVVVLTITMSAGAKVMAT----------RNVIVRKLDSLEAL 360

Query: 551 GQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAATTEDGIE-----IG----F 601
           G +  I SDKTGTLT+  M      IA + +I   P+    T ++  E     IG     
Sbjct: 361 GAVNDICSDKTGTLTQGKM------IAKQVWI---PQFGTITVQESNEPFNPTIGEIHLI 411

Query: 602 RKFDSMKETLNDTQDPDSHIINDF-------------LTLL------ATCHTVIPEFQED 642
            KF   +   +D +D    II DF             ++L       AT   +   FQ+ 
Sbjct: 412 PKFSPYQYKHDDEED--VGIIPDFKSKYLAGELGPLNVSLFDQWLYTATLANIATVFQDS 469

Query: 643 GSIKYQA-ASPDEGALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQE------YQLLNIC 695
            +  ++A   P E A+   A  +        P  V +  ED   E++      ++ +   
Sbjct: 470 ETQDWKAHGDPTEIAIQVFATRMDL------PRHV-LTGEDKDDEKDARANSSFEHVAEF 522

Query: 696 EFNSTRKRMSAIFRL---PNGEI-KLFCKGADTVILERLKA-------GENPY----IEA 740
            F+S+ KRMSAI++    P   I ++F KGA   +L+   +         +P     +E 
Sbjct: 523 PFDSSVKRMSAIYKNTEDPATPIYEVFTKGAFERVLQCCDSWYTTPDGKPSPLSKEDLET 582

Query: 741 TLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDL 800
             ++++  ++EGLR L  A ++  ESE+   KD              KL    + +E  L
Sbjct: 583 IQKNVDTLSSEGLRVLAFAKKSFNESEFNANKD--------------KLLKERDFVECKL 628

Query: 801 FLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDM----- 855
             LG   I D  +      +     AGI V +LTGD   TA +I     +L  ++     
Sbjct: 629 TFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPK 688

Query: 856 ---NLLIINEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGKSLGFXXXXXXXXX 912
              N +++   D             A+SD +I   D+  L LVI                
Sbjct: 689 EVVNFMVMAATD-----------FDALSDQEI--DDLRVLPLVI---------------- 719

Query: 913 XXXIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISG 972
                         R +P  K  +++ + R++    +  GDG ND   ++ A+VG+ + G
Sbjct: 720 -------------ARCAPQTKVRMIEALHRRSKFCAMT-GDGVNDSPSLKIANVGIAM-G 764

Query: 973 MEGMQAARSA 982
           + G   A+ A
Sbjct: 765 INGSDVAKDA 774

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
            complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 122/540 (22%), Positives = 214/540 (39%), Gaps = 120/540 (22%)

Query: 540  VVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKS--C--SIAGKCYIETIPEDKAATTED 595
            +VR    VE LG +  I SDKTGTLT N M      C  S+A K  + ++ E K++    
Sbjct: 358  IVRRLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSL-EAKSSGGLP 416

Query: 596  GIEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQEDGSIKYQAASPDEG 655
            G      K  ++K  L+D        +   L + + C+     F  +   KY   +P + 
Sbjct: 417  G------KLPNLKNYLSDD-------VKATLRIGSICNNA--SFSHEHG-KY-LGNPTDI 459

Query: 656  ALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRLP--NG 713
            AL+E    +  KF +      +  +++L             FNS RK M+     P  +G
Sbjct: 460  ALLE----VLQKFDLVDERPTTTRVDEL------------TFNSKRKYMAVKVDSPANSG 503

Query: 714  EIKLFCKGADTVILERLK-----AGENPYIEATLRHL-----EDYAAEGLRTLCLASRTV 763
            +  ++ KGA   ILER       AG+   +  + + L     +  A+EGLRTL  A    
Sbjct: 504  KHIIYVKGAFERILERSASFIGGAGKVEKLSDSHKSLINDCAKSLASEGLRTLAFA---- 559

Query: 764  TESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTL 823
             + E +  K + D+                    ++L  +G   ++D  +  V   I  L
Sbjct: 560  -QLECSTNKPMNDSTI------------------QNLTFVGLIGMKDPPRSTVRPAIEEL 600

Query: 824  QDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQ 883
               G+ V ++TGD + TAVNI       +  + + +IN E            +  ++  +
Sbjct: 601  LQGGVHVIMITGDAENTAVNI-------ARQIGIPVINPE------------ISVLTGDR 641

Query: 884  ISQQDMNSLALVIDGKSLGFXXXXXXXXXXXXIGKLCKAVICCRVSPLQKALVVKMVKRK 943
            + Q   + LA VID  +                       I  R +P  K  +V+ ++++
Sbjct: 642  LDQMTDDQLAGVIDHVN-----------------------IFARATPEHKLNIVRALQKR 678

Query: 944  TDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLV-HGSW 1002
             D ++   GDG ND   ++ A +GV +  M    A  ++D  +    +   L  +  G  
Sbjct: 679  GD-IVAMTGDGVNDAPALKLADIGVAMGHMGTDVAKEASDMVLTDDDFSTILTAIEEGKG 737

Query: 1003 SYQRISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGV 1062
             +  I   + +    ++A          A A+  Q+ + +  + + N+     P   +GV
Sbjct: 738  IFNNIQSFLTFQLSTSVAALS---LVAIATAFKLQNPLNAMQILWINILMDGPPAQSLGV 794

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
           cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 156/743 (20%), Positives = 284/743 (38%), Gaps = 152/743 (20%)

Query: 300 NISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKFIDK 359
           N+ VGD++K+ + + +PAD +++      G C  + + L GE+N   K    +  ++   
Sbjct: 174 NLLVGDLLKLQTGDVVPADCVLV-----RGECETDESALTGESNTIKKLPLADALEY--- 225

Query: 360 DDLAGMRGKVLSEHPNSSLYTYEGTMNLNGKNISLSPEQMVLRGATLRNTAWIYGLV--V 417
                      S H    +     +      + S  P+ M++ G+ +     + GL   +
Sbjct: 226 ----------HSAHGGRDIGDTSASGASGAADDSRCPDCMLISGSRV-----LSGLASAI 270

Query: 418 FTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNVIKVTSDAEHLT 477
            T      +   T   +K  + +  + M++  L   + V   +++I   + V   A +L+
Sbjct: 271 VTNVGVNSVHGKTMASLKEDSEDTPLQMRLSQLTDNISVYGCVAAI--TLFVVLFARYLS 328

Query: 478 YLYLQGTN-------KVGLFFKDI-LTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLD 529
           Y+   G         + G  F DI +T   +    VP  L + V +   +    +  D +
Sbjct: 329 YILPSGGKYHDLPPAEKGSKFMDIFITAITVIVVAVPEGLPLAVTLALAFATTRMTKDGN 388

Query: 530 LYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDK 589
           L          VR     E +G    + SDKTGTLT N+M     ++ G+   + I  D 
Sbjct: 389 L----------VRVLRSCETMGSATAVCSDKTGTLTENIMTVVRGTL-GRAGFDDIGADP 437

Query: 590 AATT---------------EDGIEIGFRKFDSMKETLNDTQDPDSH-IIND------FLT 627
           + +                 D I +    F++      D +DP+++  I+D         
Sbjct: 438 SKSNLVFKKKCSDLLRTVIYDNIVLNSTAFEN-----KDYKDPNNYNSIDDSQPRRLIRR 492

Query: 628 LLATCHTVIPEFQE-------DGSIKYQAASPDEGALVEGA-ASLGYKFIIRKPNSVSVL 679
           +  T     P+ +E       +G  +    S  E AL+  A  S G KF          L
Sbjct: 493 ITQTLQKKKPDDEENLLAHAAEGRQEPYIGSKTETALLSLARKSFGLKF--------GAL 544

Query: 680 IEDLGQEQEYQ----LLNICEFNSTRKRMSAIFRLPNG------EIKLFCKGADTVILE- 728
               G  ++      ++ I  F S+RK  + + +L +       + +L+ KGA  ++ + 
Sbjct: 545 QSFRGHPEKLPTVETIVQIIPFESSRKWSAIVVKLNSNKENEGKKFRLYVKGAAEIVAKA 604

Query: 729 -RLKAGENPYIEATLRHLED--------YAAEGLRTLCLASRTVTESEYAEWKDIYDAAS 779
             LK   N  I    +  +D         A + LR + LA      +E+   K++ D  +
Sbjct: 605 CTLKNVCNEGISEIDQKSKDDIEEQIFSLAKDALRAISLAHMDFDVNEWPP-KELADPEN 663

Query: 780 TTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQE 839
           +  +  A KL D  +   + L L     I+D L++ V  ++   Q AG+ V ++TGD   
Sbjct: 664 SH-EALAVKLIDPKKPHLEGLTLDAIVGIQDPLRENVKNSVAQCQKAGVTVRMVTGDNLL 722

Query: 840 TAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGK 899
           TA  I  +C +L                                 S + +N  A  ++G 
Sbjct: 723 TAKAIARNCGIL---------------------------------SSKSLNDSACAMEGP 749

Query: 900 SLGFXXXXXXXXXXXXIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVS 959
           +                  L K  +  R SP  K ++V+ +K +   ++   GDG ND  
Sbjct: 750 AFRKLSDSERKRI------LPKLRVLARSSPEDKKILVRALK-EMGEVVAVTGDGTNDAP 802

Query: 960 MIQAAHVGVGISGMEGMQAARSA 982
            ++ A VG  + G+ G + AR A
Sbjct: 803 ALKLADVGFSM-GITGTEVAREA 824

>Scas_707.48*
          Length = 741

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 117/461 (25%), Positives = 174/461 (37%), Gaps = 120/461 (26%)

Query: 540 VVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAATTEDGIEI 599
           +VR    VE LG +  I SDKTGTLT N M       A K +      D  A   + + +
Sbjct: 352 IVRRLPSVETLGSVNVICSDKTGTLTSNHM------TASKIWCL----DSMANKANVLSL 401

Query: 600 GFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEF-QEDGSIKYQAASPDEGALV 658
              K  S+K  L  T+D     +   LT+   C+     F QE G  KY   +P + AL+
Sbjct: 402 EKSKSGSLKNYL--TED-----VKSTLTIGNICNNA--SFSQEHG--KY-LGNPTDIALL 449

Query: 659 EGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRLPNGEIKLF 718
           E  +      I  +P               ++ +    FNS RK M+       G+  L 
Sbjct: 450 EQLSKFDLSDI--RPT--------------FKKVQEIPFNSKRKFMAVKIVNSEGKYSLC 493

Query: 719 CKGADTVIL-------------ERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTE 765
            KGA   +L             E+L  G+   I  T   L   A+EGLR L  A      
Sbjct: 494 VKGAFEKVLSQCSHYLNQKGKTEKLTQGQRDVIIETANSL---ASEGLRMLAFAK----- 545

Query: 766 SEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQD 825
                         TTL D    L + +     DL   G   + D  +  V   I  L  
Sbjct: 546 --------------TTLPDSPTLLTEESV---GDLIFTGLIGMNDPPRPTVKPAIEQLLQ 588

Query: 826 AGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQIS 885
            G+ + ++TGD + TAVNI     +   D  L +++            +KL  +SD Q  
Sbjct: 589 GGVHIIMITGDSENTAVNIARQIGIPVLDPKLSVLS-----------GDKLNEMSDDQ-- 635

Query: 886 QQDMNSLALVIDGKSLGFXXXXXXXXXXXXIGKLCKAVICCRVSPLQKALVVKMVKRKTD 945
                 LA VID  +                       I  R +P  K  +V+ ++++ D
Sbjct: 636 ------LANVIDHVN-----------------------IFARATPEHKLNIVRALRKRGD 666

Query: 946 SLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAI 986
            + +  GDG ND   ++ A +GV +  M    A  ++D  +
Sbjct: 667 VVAMT-GDGVNDAPALKLADIGVSMGRMGTDVAKEASDMVL 706

>CAGL0J01870g 181666..184506 highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1, hypothetical
           start
          Length = 946

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 104/451 (23%), Positives = 174/451 (38%), Gaps = 117/451 (25%)

Query: 540 VVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAATTEDGIEI 599
           +VR    VE LG +  I +DKTGTLT N M          C       D + T E+ I  
Sbjct: 359 IVRRLPSVETLGSVNVICTDKTGTLTTNHMTVSKLF----CL------DSSGTYENAIS- 407

Query: 600 GFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQEDGSIKYQAASPDEGALVE 659
                   +++  D  D D   + + LT+   C+    ++ E+ ++     +P + AL+E
Sbjct: 408 ------PEEDSEFDVHDND---VKETLTIANICNNA--KYSEEHNLYI--GNPTDVALIE 454

Query: 660 GAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIFRLPNGEIKLFC 719
                G              I D  Q   ++ +    FNS RK M+      +GE  L+ 
Sbjct: 455 VLTKFG--------------IPD--QRDSHEKMEELSFNSKRKYMAIKSSKESGEHVLYI 498

Query: 720 KGADTVILERL-----KAGENPYIE-----ATLRHLEDYAAEGLRTLCLASRTVTESEYA 769
           KGA   IL++      KAGE    +       L      A++GLRT+  A +        
Sbjct: 499 KGAFERILDKSSYYLDKAGEVREFDEHSKVMVLEAAHSCASDGLRTIACAFKPTDSDNVI 558

Query: 770 EWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIK 829
              DI                         L   G   + D  +  V  +I  L   G+ 
Sbjct: 559 SEDDI-----------------------NGLTFTGLFGLADPPRPNVKASIEKLHRGGVH 595

Query: 830 VWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQQDM 889
           + ++TGD   TAV+I       +E + L +   +D+E++          ++  ++S+   
Sbjct: 596 IIMITGDSVNTAVSI-------AEKIGLSV---QDRESS---------VMTGDKVSELTE 636

Query: 890 NSLALVIDGKSLGFXXXXXXXXXXXXIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLL 949
           + L+ VID                       K  I  R +P  K  +VK ++++ D ++ 
Sbjct: 637 DELSKVID-----------------------KVNIFARATPENKLNIVKALRKRGD-IVA 672

Query: 950 AIGDGANDVSMIQAAHVGVGISGMEGMQAAR 980
             GDG ND   ++ A +G+ + G+ G   A+
Sbjct: 673 MTGDGVNDAPALKLADIGIAM-GISGTDVAK 702

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
           Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
           involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 75/309 (24%), Positives = 124/309 (40%), Gaps = 81/309 (26%)

Query: 697 FNSTRKRMSAIFR---LPNGEI-KLFCKGADTVILERLKA-------GENPYIEATL--- 742
           F+S+ KRMSAI++    P   I ++F KGA   +L+   +          P  E  L   
Sbjct: 524 FDSSVKRMSAIYKNVEEPKAPIYEVFTKGAFERVLQCCNSWYTTPDGSPQPLTEEDLETV 583

Query: 743 -RHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLF 801
            ++++  ++EGLR L  A +T  ES++   KD              KL    + +E +L 
Sbjct: 584 QKNVDTLSSEGLRVLAFAKKTFNESQFTINKD--------------KLLKERDFVENNLT 629

Query: 802 LLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDM------ 855
            LG   I D  +      +     AGI V +LTGD   TA +I     +L  ++      
Sbjct: 630 FLGLVGIYDPPRRESLAAVKKCHLAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPKE 689

Query: 856 --NLLIINEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGKSLGFXXXXXXXXXX 913
             N +++   D             A+SD +I +  +  L LVI                 
Sbjct: 690 VVNFMVMTATD-----------FDALSDKEIDE--LPVLPLVI----------------- 719

Query: 914 XXIGKLCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGM 973
                        R +P  K  +++ + R+ +      GDG ND   ++ A+VG+ + G+
Sbjct: 720 ------------ARCAPQTKVRMIEALHRR-NRFCAMTGDGVNDSPSLKIANVGIAM-GI 765

Query: 974 EGMQAARSA 982
            G   A+ A
Sbjct: 766 NGSDVAKDA 774

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
            Ca2+-transporting P-type ATPase, member of the cation
            transporting (E1-E2) P-type ATPase superfamily, functions
            to pump Ca2+ into the vacuole [3522 bp, 1173 aa]
          Length = 1173

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 96/444 (21%), Positives = 169/444 (38%), Gaps = 80/444 (18%)

Query: 697  FNSTRKRMSAIFRLPNGEIK-----LFCKGADTVILERL--KAGENPYIEA--------T 741
            F S+RK    + +   G+ K      F KGA  ++ +    K   +  +E         T
Sbjct: 615  FESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAEIVSKNCSYKRNSDDTLEEINEDNKKET 674

Query: 742  LRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELI---EK 798
               +++ A++ LR + +A +   E +    + + D  S  +         A +L+   +K
Sbjct: 675  DDEIKNLASDALRAISVAHKDFCECDSWPPEQLRDKDSPNIA--------ALDLLFNSQK 726

Query: 799  DLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLL 858
             L L G   I+D L+ GV E++   Q AG+ V ++TGD   TA  I  +C +LS D++  
Sbjct: 727  GLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILSTDIS-- 784

Query: 859  IINEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGKSLGFXXXXXXXXXXXXIGK 918
                          +E   A+   +  +   N                         I  
Sbjct: 785  --------------SEAYSAMEGTEFRKLTKNE-----------------------RIRI 807

Query: 919  LCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQA 978
            L    +  R SP  K L+V+ +K   D ++   GDG ND   ++ A VG  + G+ G + 
Sbjct: 808  LPNLRVLARSSPEDKRLLVETLKGMGD-VVAVTGDGTNDAPALKLADVGFSM-GISGTEV 865

Query: 979  ARSADFAIAQFKYLKKLL--LVHGSWSYQRISQAILYSFYKNIALYMTQFWYVFANAYSG 1036
            AR A   I        ++  +  G      I + I +    NI   +  F    A++   
Sbjct: 866  AREASDIILMTDDFSAIVNAIKWGRCVSVSIKKFIQFQLIVNITAVILTFVSSVASS-DE 924

Query: 1037 QSIMESWTMTFYNVFFTVLPPFVMGVFDQFVSSRLLDRYPQLYKLGQRGQFFSVRIFWGW 1096
             S++ +  + + N+    L    +          ++DR P+    G+     SV  +   
Sbjct: 925  TSVLTAVQLLWINLIMDTLAALALAT--DKPDPNIMDRKPR----GRSTSLISVSTWKMI 978

Query: 1097 VINGFYHSAVTFI----GSTLFYR 1116
            +        VTFI    G  LF++
Sbjct: 979  LSQATLQLIVTFILHFYGPELFFK 1002

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 68/323 (21%), Positives = 133/323 (41%), Gaps = 37/323 (11%)

Query: 253 LLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVFSEQLQDFTLSKWVNISVGDIIKVNSE 312
           + +V++VSA  +  ++L+ A+ + +  ++R  +     Q+  +S   ++ VGD+I + + 
Sbjct: 164 VFVVVLVSAANDYQKELQFAKLNKK-KENRKIIVIRNDQEILISIH-HVLVGDVISLQTG 221

Query: 313 EAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKFIDKDDLAGMRGKVLSE 372
           + +PAD ++I+     G C  + +++ GE+N           KF   + L   +     +
Sbjct: 222 DVVPADCVMIS-----GKCEADESSITGESN--------TIQKFPVDNSLRDFKKFNSID 268

Query: 373 HPNSSLYTYEGTMNLNGKNISLSPEQMVLRGATL-----RNTAWIYGLVVFTGHE-TKLM 426
             N S     G +N +G  I+   + M++ G+ +     R      G+    G   T L 
Sbjct: 269 SHNHSKPLDIGDVNEDGNKIA---DCMLISGSRILSGLGRGVITSVGINSVYGQTMTSLN 325

Query: 427 RNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNVIKVTSDAEHLTYLYLQGTNK 486
               +TP++    +   N+ +      +I+  ++ +      +  D     +  L    K
Sbjct: 326 AEPESTPLQLHLSQLADNISVYGCVSAIILFLVLFTRYLFYIIPEDGR---FHDLDPAQK 382

Query: 487 VGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLYDEASDSPTVVRTSSL 546
              F    +T   +    VP  L + V +   +    +  D +L          VR    
Sbjct: 383 GSKFMNIFITSITVIVVAVPEGLPLAVTLALAFATTRMTKDGNL----------VRVLRS 432

Query: 547 VEELGQIEYIFSDKTGTLTRNVM 569
            E +G    + SDKTGTLT NVM
Sbjct: 433 CETMGSATAVCSDKTGTLTENVM 455

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 151/699 (21%), Positives = 264/699 (37%), Gaps = 153/699 (21%)

Query: 297 KWVNISVGD--------IIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQ 348
           KWV +   +        +++   + A+P D+I++     +G C +  A L GE+   +K+
Sbjct: 261 KWVEMQTNELLPMDVVSVVRTAEDSALPCDLILV-----DGTCIVNEAMLSGESTPLLKE 315

Query: 349 ARIETSKFIDKDDLAGMRGKVLSEHPNSSLYTYEGTMNLNGKNISLSPEQMVLRGATLRN 408
           +                    +   P +     EGT  ++     L     VL+  T   
Sbjct: 316 S--------------------IRLRPGNEELQIEGTDKIS----VLHGGTKVLQVTTPEK 351

Query: 409 TAWI--------YGLVVFTGHETKLMRNATATPIKRTAVERV--INMQIVALFGVLIVLA 458
           T  +          +V  TG ET      +   +   + ERV   N + +     L++ A
Sbjct: 352 TGKVPSPPDGGAIAIVTKTGFETS---QGSLVRVMIYSSERVGVDNKEALYFILFLLIFA 408

Query: 459 LISSIGNVIKVTSDAEHLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKY 518
           +++S               Y++++GT    +  K IL   ++ +++VP  L + + M   
Sbjct: 409 VVAS--------------WYVWVEGTKMGRVQSKLILDCILIITSVVPPELPMELTMAVN 454

Query: 519 YQAYMIASDLDLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAG 578
                ++       E    P            G+I+    DKTGTLT   + F+   +AG
Sbjct: 455 SSLSALSKFYVYCTEPFRIPFA----------GRIDVCCFDKTGTLTGEDLVFEG--LAG 502

Query: 579 KCYIETIPEDKAATTEDGIEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPE 638
              + + P+D             R   S  +  N T             ++   H ++  
Sbjct: 503 ---LSSDPKD------------IRHLYSATDCPNSTS-----------LVVGAAHALVR- 535

Query: 639 FQEDGSIKYQAASPDEGALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFN 698
             EDG I         G  +E A     K+ + K + V    E  GQ     +L   +F+
Sbjct: 536 -LEDGEIV--------GDPMEKATLKALKWTVEKGDKV--FNEKNGQ---VTILRRFQFS 581

Query: 699 STRKRMSAIFRLPNGEIKLFCKGADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCL 758
           S  KR S++    +G++    KGA   I ERL      Y E      + +   G R L L
Sbjct: 582 SALKRSSSV-ATHDGKLYSAVKGAPETIRERLFTIPANYDEI----YKSFTRSGSRVLAL 636

Query: 759 ASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPE 818
           AS+ + +   ++ +D          DR        E  E+DL   G       L+    E
Sbjct: 637 ASKKLEKMSQSQIEDA---------DR--------EHFERDLEFNGFLIFHCPLKHDAIE 679

Query: 819 TIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNL--LIINEEDKEATRKNLTEKL 876
           TI  L ++  +  ++TGD   TAV++     ++  +  +  ++ N  D +   +N+ E L
Sbjct: 680 TIQMLNESAHRCVMITGDNPLTAVHVAKEVGIVKGETLIVDMVDNGNDDKLVFRNVEETL 739

Query: 877 K---AISDHQISQQDM-NSLALVIDGKSLGFXXXXXXXXXXXXIGKLCK-AVICCRVSPL 931
                +S     +  + +   L + G +L              +  L + A I  RVSP 
Sbjct: 740 SFEFVVSKDSFEKYGIFDKYDLAVTGHAL------EALKGHHQLQDLIRHAWIYARVSPA 793

Query: 932 QKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGI 970
           QK  ++  +K      L+  GDG NDV  ++ AHVGV +
Sbjct: 794 QKEFILNNLKDMGYQTLMC-GDGTNDVGALKQAHVGVAL 831

>Kwal_14.1498
          Length = 939

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 172/801 (21%), Positives = 298/801 (37%), Gaps = 205/801 (25%)

Query: 304  GDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKFIDKDDLA 363
            GD+++    + IPAD+ +I + +      IE +NL GE N  + ++    +K   K++L 
Sbjct: 167  GDVVRFRVGDRIPADLRIIEAVD----LSIEESNLTGE-NEPVHKSTATVNKEFYKENLG 221

Query: 364  GMRGKVLSEHPNSSLYTYEGTMNLNGKNISLSPEQMVLRG---ATLRNTAWIYGLVVFTG 420
             +    +SE    S   + GT+   G            RG    T +NTA+        G
Sbjct: 222  SIVP--VSER---SCIAFMGTLVREGHG----------RGIVIGTAKNTAF--------G 258

Query: 421  HETKLMRNATATPIKRTAVERVINMQIVAL-FGVLIVLALISSIGNVIKVTSDAEHLTYL 479
               ++M NA   P  +T ++  ++     L F   IV+ +I  IG               
Sbjct: 259  KVFEMM-NAIEKP--KTPLQTAMDKLGKDLSFMSFIVIGIICLIG--------------- 300

Query: 480  YLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLYDEASDSPT 539
             +QG + + +F   +          +PI + VT+ +     A   A              
Sbjct: 301  VIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRRA-------------- 346

Query: 540  VVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKS--C--SIAGKCYIETIPEDKAATTED 595
            ++R    VE LG +  I SDKTGTLT N M      C  S++ K  I  +  DKA +   
Sbjct: 347  IIRRLPSVETLGSVNVICSDKTGTLTANHMSVNKVWCLGSMSNKSNILKL--DKATSG-- 402

Query: 596  GIEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQEDGSIKYQAASPDEG 655
                 F+K        N T+D           L AT  T        G++   +    E 
Sbjct: 403  ----SFKK--------NLTED-----------LRATLRT--------GNLCNNSTYSHEH 431

Query: 656  ALVEGAASLGYKFIIRKPNSVSVL--IEDLGQEQEYQLLNICE---FNSTRKRMSAIFRL 710
            A   G            P  +++L  +   G E E   +   +   FNS RK M+   + 
Sbjct: 432  AKYLG-----------NPTDIALLEVLHKFGLEDERPQVTRSDEISFNSKRKFMAVKVKE 480

Query: 711  PNGEIKLFCKGADTVILER---LKAGENPYI--EATLRHL-----EDYAAEGLRTLCLAS 760
             NG+  +  KGA   ILE+       EN  +  ++ LR       +  A++GLRTL  A 
Sbjct: 481  ANGKFVVHVKGAYEKILEKSTHFINAENKVVKLDSNLRQAITDSADALASDGLRTLAFAQ 540

Query: 761  RTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKD---LFLLGATAIEDKLQDGVP 817
              ++                          ++ +L E D   L   G   + D  +  V 
Sbjct: 541  LELSNG------------------------NSKKLTEDDINGLTFAGLLGMNDPPRPSVK 576

Query: 818  ETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLK 877
              +  L +  + + ++TGD + TAV+I       +  + + ++N E    T   L     
Sbjct: 577  AAVERLSEGSVHIIMITGDAENTAVSI-------ARQIGIPVVNPETAVLTGDKL----- 624

Query: 878  AISDHQISQQDMNSLALVIDGKSLGFXXXXXXXXXXXXIGKLCKAVICCRVSPLQKALVV 937
               DH    Q    LA +ID  +                       I  R +P  K  +V
Sbjct: 625  ---DHMSEDQ----LASIIDHVN-----------------------IFARATPEHKLNIV 654

Query: 938  KMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLL 997
            + ++++ D ++   GDG ND   ++ A +GV +  M    A  ++D  +    +   L  
Sbjct: 655  RALQKRGD-IVAMTGDGVNDAPALKLADIGVSMGKMGTDVAKEASDMVLTDDDFSTILTA 713

Query: 998  V-HGSWSYQRISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLP 1056
            +  G   +  I   + +    ++A          A A+   + + +  + + N+     P
Sbjct: 714  IEEGKGIFNNIQNFLTFQLSTSVAALS---LVAIATAFKLPNPLNAMQILWINILMDGPP 770

Query: 1057 PFVMGVFDQFVSSRLLDRYPQ 1077
               +GV  + V   ++ + P+
Sbjct: 771  AQSLGV--EPVDHEVMKKPPR 789

>Scas_583.14*
          Length = 875

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 122/288 (42%), Gaps = 36/288 (12%)

Query: 690 QLLNICEFNSTRKRMSAIFRLPNGEIKLF--CKGADTVILERLKAGENPYIEATLRHLED 747
           Q+L   +F+S  KR S++    + + KLF   KGA   I ERL      Y E      + 
Sbjct: 229 QILRRFQFSSALKRSSSV---ASHKDKLFTAVKGAPETIRERLAVVPKNYDEI----YKS 281

Query: 748 YAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATA 807
           +   G R L LAS+++            + +S  LDD    LD   + IE  L   G   
Sbjct: 282 FTRSGSRVLALASKSLP-----------NLSSKQLDD----LD--RDEIETGLTFNGFLV 324

Query: 808 IEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEA 867
               L+    ETI  L ++  +  ++TGD   TAV++     +++ +   LI+++ +   
Sbjct: 325 FHCPLKPDAVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAIVTGET--LILDKSETVG 382

Query: 868 TRK----NLTEKLKAISDHQISQQDMNSLALVIDGKSLGFXXXXXXXXXXXXIGKLCKAV 923
             K    N+ E +K   D    + D   L    D    G+            +  L +  
Sbjct: 383 DGKLLFFNVEETIKIPFDPASDKFDHRELFDKYDIAVTGYALNLLEDHSQ--LKDLIRHT 440

Query: 924 -ICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGI 970
            +  RVSP QK  ++  +K      L+  GDG NDV  ++ AHVGV +
Sbjct: 441 WVYARVSPSQKEFILNNLKEMGYQTLMC-GDGTNDVGALKQAHVGVAL 487

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 150/719 (20%), Positives = 271/719 (37%), Gaps = 155/719 (21%)

Query: 293 FTLSKWVNISVG--------DIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNL 344
           F   KWV +            I +   + AIP D+++I     +G C +  A L GE+  
Sbjct: 258 FRDGKWVEMQTDKLFPMDLVSITRTAEDSAIPCDLLLI-----DGSCIVNEAMLSGESTP 312

Query: 345 KIKQARIETSKFIDKDDLAGMRGKVLSEHPNSSLYTYEGTMNLNGKNISLSPEQMVLRGA 404
            +K++ I+     D+  L G+         + +   + GT  L       +PE     G 
Sbjct: 313 LLKES-IKLRPANDQLQLDGV---------DKNAVLHGGTKALQ----VTAPENRT--GV 356

Query: 405 TLRNTAWIYGLVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVL--ALISS 462
                     +V  TG ET      +   +   + ERV      AL+ +L +L  A+++S
Sbjct: 357 ITPPDGGALAVVTKTGFETS---QGSLVRVMIFSAERVDVGNKEALYFILFLLIFAIVAS 413

Query: 463 IGNVIKVTSDAEHLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAY 522
                          Y++ +GT    +  K IL   ++ +++VP  L + + M       
Sbjct: 414 --------------WYVWKEGTRMGRIQSKLILDCILIITSVVPPELPMELTMAVNSSLA 459

Query: 523 MIASDLDLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYI 582
            ++       E    P            G+I+    DKTGTLT   + F+          
Sbjct: 460 ALSKFYVYCTEPFRIPYA----------GRIDVCCFDKTGTLTAEDLVFEGL-------- 501

Query: 583 ETIPEDKAATTEDGIEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQED 642
                   A   DG +I          TL    D    +    L+ +   H ++    +D
Sbjct: 502 --------AGLHDGSDI---------RTLKSANDASQEV----LSAIGAAHALVK--LDD 538

Query: 643 GSIKYQAASPDEGALVEGAA-SLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTR 701
           G I      P E A ++ ++ ++ +K ++++  + ++           ++L   +F+S+ 
Sbjct: 539 GEI---VGDPMEKATLKASSWTVDFKDVVKRAGADNI-----------RILRRFQFSSSL 584

Query: 702 KRMSAIFRLPNGEIKLFC--KGADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLA 759
           KR ++I    N   + F   KGA   I ERL +  + Y +      + +   G R L LA
Sbjct: 585 KRSASIASQSN---RFFAAVKGAPETIRERLNSVPSDYDDI----YKSFTRSGSRVLALA 637

Query: 760 SRTVTESEYAEWKDIYDAASTTLD--DRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVP 817
                      +KD+   +++ +D  DR +        IE  L           L+D   
Sbjct: 638 -----------YKDLPKMSNSQIDNIDRDE--------IETGLTFGAFLVFHCPLKDDAI 678

Query: 818 ETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATR-------- 869
           ETI  L ++  +  ++TGD   TAV++     ++  D   LI++E    ++         
Sbjct: 679 ETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIV--DRETLILDEPIDGSSHALVMRDVN 736

Query: 870 KNLTEKLKAISDHQISQQDMNSLALVIDGKSLGFXXXXXXXXXXXXIGKLCKAVICCRVS 929
           + + +     +D    ++      L + G +L                 +    I  RVS
Sbjct: 737 ETIVKPFNPDADTFDEKEIFQKYDLAVTGHALKLLQGHKQLRDV-----IRHTWIYARVS 791

Query: 930 PLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGI-----SGMEGMQAARSAD 983
           P QK  ++  +K      L+  GDG NDV  ++ AHVG+ +       ++ +Q  R  D
Sbjct: 792 PSQKEFILITLKDMGYQTLMC-GDGTNDVGALKQAHVGIALLNGTEDSLKKLQEQRKID 849

>Kwal_56.23467
          Length = 280

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 69/150 (46%), Gaps = 7/150 (4%)

Query: 1093 FWGWVINGFYHSAVTFIGSTLFYRNGNVLNSHGETADHWAWGVSIYTCSVIIVIGKAALV 1152
            FW ++++G Y S ++F    L Y    +++ +G   DH  W V I   S+  V     ++
Sbjct: 10   FWLYMVDGLYQSVISFFFPFLAYYKTGMVSPNGLGLDHRYW-VGILVGSIASVSCNLYIL 68

Query: 1153 TNQ--WTKFTAFAIPGSLVFWLVFFPIYASILPHANVSKEYYGVVSHVYGSATFWLMCIV 1210
             +Q  W  F+   I  S    LV +  +  I      S E+Y   +HVYGS  +W +  V
Sbjct: 69   IHQFRWDWFSTLFIALSC---LVVYG-WTGIWSTFTTSGEFYKSAAHVYGSPIYWAIFFV 124

Query: 1211 LPTFALMRDLVWKYYKRTYTPESYHVVQEM 1240
               F L+    +  +++ + P+   +++E 
Sbjct: 125  GVLFCLLPRFTFDVFQKMFFPKDIDIIREF 154

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
           (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 75/301 (24%), Positives = 122/301 (40%), Gaps = 66/301 (21%)

Query: 697 FNSTRKRMSAIF---RLPNGEIKLFCKGADTVILE-----RLKAGE---NPYIEATL--- 742
           F+S+ KRMSA++   R  N    +F KGA   +L+     +L  G    +P  E  L   
Sbjct: 531 FDSSIKRMSAVYINLRDKNTR-HVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEII 589

Query: 743 -RHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLF 801
            ++++  + EGLR L  A++T+   E           + +L +R  K  D    +E DL 
Sbjct: 590 QKNVDTLSNEGLRVLAFATKTIPAEE-----------AESLGERLTKDRD---FVESDLI 635

Query: 802 LLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIIN 861
             G   I D  +      +     AGI V +LTGD   TA  I     +L    NL    
Sbjct: 636 FQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPH--NLYHYP 693

Query: 862 EEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGKSLGFXXXXXXXXXXXXIGKLCK 921
           +E  +      T+   +++D ++ Q  +  L LVI                         
Sbjct: 694 KEVVDIMVMTATQ-FDSLTDEELDQ--LPVLPLVI------------------------- 725

Query: 922 AVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARS 981
                R +P  K  ++  + R+ +      GDG ND   ++ A+VG+ + G+ G   A+ 
Sbjct: 726 ----ARCAPQTKVRMIDALHRR-EKFCAMTGDGVNDSPSLKKANVGIAM-GINGSDVAKD 779

Query: 982 A 982
           A
Sbjct: 780 A 780

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%)

Query: 540 VVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFK 572
           +VR    +E LG +  I SDKTGTLT+  M  K
Sbjct: 352 IVRRLDSLEALGAVNDICSDKTGTLTQGKMILK 384

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 70/295 (23%), Positives = 120/295 (40%), Gaps = 37/295 (12%)

Query: 696 EFNSTRKRMSAIFRLPNGEIKLFCKGADTVILERLKAGENPYIEATLRHLEDYAAEGLRT 755
           +F+S  KR S I  + N +     KGA   I ERL      Y +      + +   G R 
Sbjct: 582 QFSSALKRSSTI-AVHNKQHYSAVKGAPETIRERLSQVPTDYDQV----YKSFTRAGSRV 636

Query: 756 LCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDG 815
           L LAS+ +      +                +KL+   E +E DL   G       L+D 
Sbjct: 637 LALASKKLPSMSIKQ---------------IEKLER--EAVESDLEFKGFLVFHCPLKDD 679

Query: 816 VPETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATR----KN 871
             ETI  L ++  +  ++TGD   TAV++     ++  +   LI++E    ++     +N
Sbjct: 680 AIETIKMLNESSHRCIMITGDNPLTAVHVAKEVAIVERET--LILDEPIDGSSHALVFRN 737

Query: 872 LTEKLKAISDHQISQQDMNSLALVIDGKSLGFXXXXXXXXXXXXIGKLCKAV-ICCRVSP 930
           + E +    + +    + + L    D    G             + +L +   +  RVSP
Sbjct: 738 IEETIVNPFNPEKDTFEHSKLFAKYDIAVTG--HALQLLSGHSQLNELIRHTWVYARVSP 795

Query: 931 LQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGI-----SGMEGMQAAR 980
            QK  ++  +K      L+  GDG NDV  ++ AHVG+ +      G++ +Q  R
Sbjct: 796 AQKEFIMNSLKDMGYQTLMC-GDGTNDVGALKQAHVGIALLNGTEEGLKKLQEQR 849

>CAGL0K12034g complement(1161299..1164562) highly similar to sp|P13587
            Saccharomyces cerevisiae YDR040c ENA1 or sp|Q01896
            Saccharomyces cerevisiae YDR039c ENA2 or sp|Q12691
            Saccharomyces cerevisiae YDR038c ENA5, hypothetical start
          Length = 1087

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 84/404 (20%), Positives = 162/404 (40%), Gaps = 71/404 (17%)

Query: 697  FNSTRKRMSAIFRLPNGEI-KLFCKGADTVILERLKA--GENPY---------IEATLRH 744
            F+ST KRMS+++   + +  +++ KGA   +L       G +P          ++    +
Sbjct: 532  FDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNTATVMTDADVDTIKEN 591

Query: 745  LEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLG 804
            ++  ++EGLR L  A+++  +S+  E             ++ QK+    +  E  L  LG
Sbjct: 592  IDSMSSEGLRVLAFANKSYPKSDVNE-------------EKLQKILKERDYAETGLTFLG 638

Query: 805  ATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEED 864
               I D  ++     +     AGI V +LTGD   TA  I     +L    NL   ++E 
Sbjct: 639  LIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILP--TNLYHYSKE- 695

Query: 865  KEATRKNLTEKLKAISDHQ---ISQQDMNSLALVIDGKSLGFXXXXXXXXXXXXIGKLCK 921
                       +  ++  Q   +S+ ++++L ++                          
Sbjct: 696  --------VVDIMVMTGKQFDNLSEDEIDNLPVL-------------------------- 721

Query: 922  AVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARS 981
             ++  R SP  K  +++ + R+ +      GDG ND   ++ A+VG+ + G+ G   A+ 
Sbjct: 722  PLVIARCSPQTKVRMIEALHRR-EKFCAMTGDGVNDSPSLKMANVGIAM-GINGSDVAKD 779

Query: 982  A-DFAIAQFKYLKKLLLV-HGSWSYQRISQAILYSFYKNIALYMTQFWYVFANAYSGQSI 1039
            A D  ++   +   L  V  G      I + +L    +N+A  +     +      G+S+
Sbjct: 780  ASDIVLSDDNFASILNAVEEGRRMSDNIQKFVLQLLAENVAQALYLIVGLAFQDKEGKSV 839

Query: 1040 ME-SWTMTFYNVFFTVLPPFVMGVFDQFVSSRLLDRYPQLYKLG 1082
               +     + +  T   P  MG+  +  +  L+DR P   K G
Sbjct: 840  FPLAPVEVLWIIVVTSCFP-AMGLGLEKAAHDLMDRPPNDSKAG 882

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 76/385 (19%), Positives = 146/385 (37%), Gaps = 66/385 (17%)

Query: 247 YTTIGTLLIVLIVSAIKEIVEDLKRAQSDSEL---NDSRAQVFSEQLQDFTLSKWVNISV 303
           + T G +  V+ ++ I  ++++ K +++ + L   +   A V      +   S   ++  
Sbjct: 87  WITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAHVIRNGNSEVVDS--TDVVP 144

Query: 304 GDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKFIDKDDLA 363
           GD++ V   + IPAD+ +++    E     + A L GE+ L + +   + ++  D +   
Sbjct: 145 GDLVVVKVGDTIPADLRLVSQQNFE----TDEALLTGES-LPVSK---DANEIFDDETPV 196

Query: 364 GMRGKVLSEHPNSSLYTYEGTMNLNGKNISLSPEQMVLRGA----------TLRNTAWIY 413
           G R  +            +G     G N  +      LRG           T    AWI 
Sbjct: 197 GDRINLAFSSSTVVKGRAQGIAIKTGLNTEIGKIAKSLRGGNELISRDPAKTWYQNAWI- 255

Query: 414 GLVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNVIKVTSDA 473
                    TK    A     + T + R ++   V LF + +V A++        V    
Sbjct: 256 --------STKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVVFAIVVMASQKFDVD--- 304

Query: 474 EHLTYLYLQGTNKVGLFFKDILTYWILFS-NLVPISLFVTVEMIKYYQAYMIASDLDLYD 532
                             + +  Y +  + +++P SL V + +     A ++AS      
Sbjct: 305 ------------------RGVAIYAVCVALSMIPSSLVVVLTITMSVGAAVMAS------ 340

Query: 533 EASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAAT 592
                  ++R    +E LG +  I SDKTGTLT+  M  K   +     ++ +  ++   
Sbjct: 341 ----RNVIIRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQIWVPKFGTLQVVGSNEPLN 396

Query: 593 TEDGIEIGF-RKFDSMKETLNDTQD 616
            E G +I F       + + N+T+D
Sbjct: 397 PEKG-DINFIPNLSPYEYSHNETED 420

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative
           Ca2+-transporting ATPase, member of the P-type ATPase
           superfamily of membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 148/690 (21%), Positives = 264/690 (38%), Gaps = 127/690 (18%)

Query: 293 FTLSKWVNISVGDIIKVN--------SEEAIPADVIVIASSEPEGLCYIETANLDGETNL 344
           F   KWV +   +++ ++         E AIP D+I++     +G   +  A L GE+  
Sbjct: 259 FRNKKWVALQTNELLPMDLVSITRTAEESAIPCDLILL-----DGSAIVNEAMLSGESTP 313

Query: 345 KIKQARIETSKFIDKDDLAGMRGKVLSEHPNSSLYTYEGTMNLNGKNISLSPEQMVLRGA 404
            +K++ I+     D   L G+  K+   H  +     + T   +  +I   P+     G 
Sbjct: 314 LLKES-IKLRPSEDNLQLDGV-DKIAVLHGGTK--ALQVTPPEHKSDIPPPPD-----GG 364

Query: 405 TLRNTAWIYGLVVFTGHETKLMRNATATPIKRTAVERVI--NMQIVALFGVLIVLALISS 462
            L        +V  TG ET      +   +   + ERV   N + +     L++ A+I+S
Sbjct: 365 AL-------AIVTKTGFETS---QGSLVRVMIYSAERVSVDNKEALMFILFLLIFAVIAS 414

Query: 463 IGNVIKVTSDAEHLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAY 522
                          Y++++GT    +  K IL   ++ +++VP  L + + M       
Sbjct: 415 --------------WYVWVEGTKMGRIQSKLILDCILIITSVVPPELPMELTMAVNSSLA 460

Query: 523 MIASDLDLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYI 582
            +A       E    P            G+I+    DKTGTLT   + F           
Sbjct: 461 ALAKFYVYCTEPFRIPFA----------GRIDVCCFDKTGTLTGEDLVF----------- 499

Query: 583 ETIPEDKAATTEDGIEIGFRKFDSMKETLNDTQDPDSHIINDFLTLLATCHTVIPEFQED 642
               E  A  + D         ++++   +  + P+S I+     ++   H ++    ED
Sbjct: 500 ----EGLAGISADS--------ENIRHLYSAAEAPESTIL-----VIGAAHALVK--LED 540

Query: 643 GSIKYQAASPDEGALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRK 702
           G I      P E A ++        + + + NS     E  G+     ++   +F+S  K
Sbjct: 541 GDI---VGDPMEKATLKAVG-----WAVERKNSN--YREGTGK---LDIIRRFQFSSALK 587

Query: 703 RMSAIFRLPNGEIKLFCKGADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRT 762
           R ++I    N  +    KGA   I ERL      Y E      + +   G R L LAS++
Sbjct: 588 RSASIASH-NDALFAAVKGAPETIRERLSDIPKNYDEI----YKSFTRSGSRVLALASKS 642

Query: 763 VTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHT 822
           + +            + + +DD  +  DD    +E +L   G       L+D   ETI  
Sbjct: 643 LPK-----------MSQSKIDDLNR--DD----VESELTFNGFLIFHCPLKDDAIETIKM 685

Query: 823 LQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLL--IINEEDKEATRKNLTEKLKAIS 880
           L ++  +  ++TGD   TAV++     ++  +  +L      +D +   +++ E +    
Sbjct: 686 LNESSHRSIMITGDNPLTAVHVAKEVGIVFGETLILDRAGKSDDNQLLFRDVEETVSIPF 745

Query: 881 DHQISQQDMNSLALVIDGKSLGFXXXXXXXXXXXXIGKLCKAVICCRVSPLQKALVVKMV 940
           D      D + L    D    G+               L    +  RVSP QK  ++  +
Sbjct: 746 DPSKDTFDHSKLFDRYDIAVTGYALNALEGHSQLR-DLLRHTWVYARVSPSQKEFLLNTL 804

Query: 941 KRKTDSLLLAIGDGANDVSMIQAAHVGVGI 970
           K      L+  GDG NDV  ++ AHVG+ +
Sbjct: 805 KDMGYQTLMC-GDGTNDVGALKQAHVGIAL 833

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
           Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 71/308 (23%), Positives = 118/308 (38%), Gaps = 79/308 (25%)

Query: 692 LNICEFNSTRKRMSAIFRLPNGEIKLFCKGADTVILER-------------LKAGENPYI 738
           +N   FNS RK M+      N ++ ++ KGA   I+E+             LK  +   I
Sbjct: 460 INEIPFNSKRKFMAVKTIDANDKVVVYVKGAFEKIVEKSINYIGRDGKVHKLKPNDKAII 519

Query: 739 EATLRHLEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEK 798
                 L   A+EGLRTL  A   V               S T  D+     +  E + +
Sbjct: 520 NDAAVAL---ASEGLRTLAFAELEV---------------SATHGDK-----EFNEDMVE 556

Query: 799 DLFLLGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGMSCRLLSEDMNLL 858
            L   G  A+ D  +  V   I  L    + V ++TGD + TAV+I       +  + + 
Sbjct: 557 GLTFTGLIAMNDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSI-------ARQIGIP 609

Query: 859 IINEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGKSLGFXXXXXXXXXXXXIGK 918
           +IN E               +S  ++ Q   + LA VID  +                  
Sbjct: 610 VINPE------------YSVLSGDKLDQMTDDQLASVIDHVN------------------ 639

Query: 919 LCKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQA 978
                +  R +P  K  +V+ ++++ D ++   GDG ND   ++ A +GV +  M    A
Sbjct: 640 -----VFARATPEHKLNIVRALQKRGD-IVAMTGDGVNDAPALKLADIGVSMGKMGTDVA 693

Query: 979 ARSADFAI 986
             ++D  +
Sbjct: 694 KEASDMVL 701

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 19/30 (63%)

Query: 540 VVRTSSLVEELGQIEYIFSDKTGTLTRNVM 569
           +VR    VE LG +  I SDKTGTLT N M
Sbjct: 347 IVRRLPSVETLGSVNVICSDKTGTLTANHM 376

>Kwal_47.17522
          Length = 899

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 68/296 (22%), Positives = 112/296 (37%), Gaps = 77/296 (26%)

Query: 688 EYQLLNICEFNSTRKRMSAIFRLPNGEIKLFCKGADTVILERLKAGENPYIEATLRHLED 747
           +Y++L+   F+   K+++A+   P GE  +  KGA   +L+ ++  ++P  E    + E+
Sbjct: 423 KYKVLDFHPFDPVSKKVTAVVESPEGERIICVKGAPLFVLKTVEE-DHPIPEDVHENYEN 481

Query: 748 YAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATA 807
             AE      LASR                         + L  A +  E    +LG   
Sbjct: 482 KVAE------LASRGF-----------------------RALGVARKRGEGHWEILGVMP 512

Query: 808 IEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGM-SCRLLSEDMNLLIINEEDKE 866
             D  +D   +T+H  +  G++V +LTGD    AV I   +CR L    N  I N     
Sbjct: 513 CMDPPRDDTAQTVHEARRLGLRVKMLTGD----AVGIAKETCRQLGLGTN--IYN----- 561

Query: 867 ATRKNLTEKLKAISDHQISQQDMNSLALVIDGKSLGFXXXXXXXXXXXXIGKLCKAVICC 926
                  E+L       +   ++       DG                            
Sbjct: 562 ------AERLGLGGGGDMPGSELADFVENADG--------------------------FA 589

Query: 927 RVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 982
            V P  K  VV++++++   L+   GDG ND   ++ A  G+ + G     AARSA
Sbjct: 590 EVFPQHKYSVVEILQQR-GYLVAMTGDGVNDAPSLKKADTGIAVEG--ATDAARSA 642

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 540 VVRTSSLVEELGQIEYIFSDKTGTLTRN 567
           +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 340 IVQKLSAIESLAGVEILCSDKTGTLTKN 367

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 70/296 (23%), Positives = 111/296 (37%), Gaps = 77/296 (26%)

Query: 688 EYQLLNICEFNSTRKRMSAIFRLPNGEIKLFCKGADTVILERLKAGENPYIEATLRHLED 747
           +Y+LL    F+   K+++AI   P GE  +  KGA   +L+ ++  E+P  E    + E+
Sbjct: 423 KYKLLEFHPFDPVSKKVTAIVESPEGERIICVKGAPLFVLKTVEE-EHPIPEDVRENYEN 481

Query: 748 YAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATA 807
             AE      LASR                         + L  A +  E    +LG   
Sbjct: 482 KVAE------LASRGF-----------------------RALGVARKRGEGHWEILGVMP 512

Query: 808 IEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGM-SCRLLSEDMNLLIINEEDKE 866
             D  +D   +T++  +  G++V +LTGD    AV I   +CR L    N  I N     
Sbjct: 513 CMDPPRDDTAQTVNEARHLGLRVKMLTGD----AVGIAKETCRQLGLGTN--IYN----- 561

Query: 867 ATRKNLTEKLKAISDHQISQQDMNSLALVIDGKSLGFXXXXXXXXXXXXIGKLCKAVICC 926
                  E+L       +   ++       DG                            
Sbjct: 562 ------AERLGLGGGGDMPGSELADFVENADG--------------------------FA 589

Query: 927 RVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 982
            V P  K  VV++++++   L+   GDG ND   ++ A  G+ + G     AARSA
Sbjct: 590 EVFPQHKYNVVEILQQR-GYLVAMTGDGVNDAPSLKKADTGIAVEG--ATDAARSA 642

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 540 VVRTSSLVEELGQIEYIFSDKTGTLTRN 567
           +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 340 IVQKLSAIESLAGVEILCSDKTGTLTKN 367

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 67/296 (22%), Positives = 111/296 (37%), Gaps = 77/296 (26%)

Query: 688 EYQLLNICEFNSTRKRMSAIFRLPNGEIKLFCKGADTVILERLKAGENPYIEATLRHLED 747
           +Y++L    F+   K+++A+   P GE  +  KGA   +L+ ++  ++P  E    + E+
Sbjct: 471 KYKVLEFHPFDPVSKKVTAVVESPEGERIVCVKGAPLFVLKTVEE-DHPIPEDVHENYEN 529

Query: 748 YAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATA 807
             AE      LASR                         + L  A +  E    +LG   
Sbjct: 530 KVAE------LASRGF-----------------------RALGVARKRGEGHWEILGVMP 560

Query: 808 IEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGM-SCRLLSEDMNLLIINEEDKE 866
             D  +D   +TI+  ++ G+++ +LTGD    AV I   +CR L    N  I N     
Sbjct: 561 CMDPPRDDTAQTINEARNLGLRIKMLTGD----AVGIAKETCRQLGLGTN--IYN----- 609

Query: 867 ATRKNLTEKLKAISDHQISQQDMNSLALVIDGKSLGFXXXXXXXXXXXXIGKLCKAVICC 926
                  E+L       +   ++       DG                            
Sbjct: 610 ------AERLGLGGGGDMPGSELADFVENADG--------------------------FA 637

Query: 927 RVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 982
            V P  K  VV++++ +   L+   GDG ND   ++ A  G+ + G     AARSA
Sbjct: 638 EVFPQHKYRVVEILQNR-GYLVAMTGDGVNDAPSLKKADTGIAVEG--ATDAARSA 690

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 540 VVRTSSLVEELGQIEYIFSDKTGTLTRN 567
           +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 388 IVQKLSAIESLAGVEILCSDKTGTLTKN 415

>CAGL0D04510g 440080..447522 similar to tr|Q06116 Saccharomyces
            cerevisiae YPR117w, hypothetical start
          Length = 2480

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 49/108 (45%), Gaps = 11/108 (10%)

Query: 136  FEMHNYDDLGNDDRYAKSRNKFDIKIIFKRYILRRNDYSDDDKSSPRQIYINDKEANRAR 195
            FE  NY+ +G +DR A SR  +D+ ++    I  RN  + D  S  R  +I+        
Sbjct: 1308 FEQGNYEKIGEEDREAPSRPHYDVDLV--NPISVRNKSTHDSYSGFRSRFIH-------M 1358

Query: 196  GFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSA-IQQVPNVT 242
             FG        YN   FI    F  F ++ NLF  +TS  I+Q P  T
Sbjct: 1359 SFGVYSYGANAYN-NMFIAPNSFALFLRWWNLFHQYTSGPIRQGPLFT 1405

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score = 38.5 bits (88), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 67/296 (22%), Positives = 109/296 (36%), Gaps = 77/296 (26%)

Query: 688 EYQLLNICEFNSTRKRMSAIFRLPNGEIKLFCKGADTVILERLKAGENPYIEATLRHLED 747
           +Y++L    F+   K+++A+   P GE  +  KGA   +L+ ++  ++P  E    + E+
Sbjct: 442 KYKVLEFHPFDPVSKKVTAVVESPEGERIVCVKGAPLFVLKTVEE-DHPIPEDVHENYEN 500

Query: 748 YAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATA 807
             AE      LASR                         + L  A +  E    +LG   
Sbjct: 501 KVAE------LASRGF-----------------------RALGVARKRGEGHWEILGVMP 531

Query: 808 IEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGM-SCRLLSEDMNLLIINEEDKE 866
             D  +D   +T+   +  G++V +LTGD    AV I   +CR L    N  I N     
Sbjct: 532 CMDPPRDDTAQTVSEARHLGLRVKMLTGD----AVGIAKETCRQLGLGTN--IYN----- 580

Query: 867 ATRKNLTEKLKAISDHQISQQDMNSLALVIDGKSLGFXXXXXXXXXXXXIGKLCKAVICC 926
                  E+L       +   ++       DG                            
Sbjct: 581 ------AERLGLGGGGDMPGSELADFVENADG--------------------------FA 608

Query: 927 RVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 982
            V P  K  VV++++ +   L+   GDG ND   ++ A  G+ + G     AARSA
Sbjct: 609 EVFPQHKYRVVEILQNR-GYLVAMTGDGVNDAPSLKKADTGIAVEG--ATDAARSA 661

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 540 VVRTSSLVEELGQIEYIFSDKTGTLTRN 567
           +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 359 IVQKLSAIESLAGVEILCSDKTGTLTKN 386

>Scas_688.1
          Length = 913

 Score = 38.5 bits (88), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 67/296 (22%), Positives = 109/296 (36%), Gaps = 77/296 (26%)

Query: 688 EYQLLNICEFNSTRKRMSAIFRLPNGEIKLFCKGADTVILERLKAGENPYIEATLRHLED 747
           +Y++L    F+   K+++A+   P GE  +  KGA   +L+ ++  ++P  E    + E+
Sbjct: 437 KYKVLEFHPFDPVSKKVTAVVESPEGERIICVKGAPLFVLKTVEE-DHPIPEDIHENYEN 495

Query: 748 YAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATA 807
             AE      LASR                         + L  A +  E    +LG   
Sbjct: 496 KVAE------LASRGF-----------------------RALGVARKRGEGHWEILGVMP 526

Query: 808 IEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGM-SCRLLSEDMNLLIINEEDKE 866
             D  +D   ET+   +  G++V +LTGD    AV I   +CR L    N  + N     
Sbjct: 527 CMDPPRDDTGETVAEARRLGLRVKMLTGD----AVGIAKETCRQLGLGTN--VYN----- 575

Query: 867 ATRKNLTEKLKAISDHQISQQDMNSLALVIDGKSLGFXXXXXXXXXXXXIGKLCKAVICC 926
                  E+L       +   ++       DG                            
Sbjct: 576 ------AERLGLSGGGDMPGSELADFVENADG--------------------------FA 603

Query: 927 RVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 982
            V P  K  VV++++ +   L+   GDG ND   ++ A  G+ + G     AARSA
Sbjct: 604 EVFPQDKYRVVEILQTR-GYLVAMTGDGVNDAPSLKKADTGIAVEG--ATDAARSA 656

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 540 VVRTSSLVEELGQIEYIFSDKTGTLTRN 567
           +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 354 IVQKLSAIESLAGVEILCSDKTGTLTKN 381

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score = 38.1 bits (87), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 72/171 (42%), Gaps = 35/171 (20%)

Query: 688 EYQLLNICEFNSTRKRMSAIFRLPNGEIKLFCKGADTVILERLKAGENPYIEATLRHLED 747
           +Y+++    F+   K+++A+   P GE  +  KGA   +L+ ++  ++P  E    + E+
Sbjct: 426 KYKVIEFHPFDPVSKKVTAVVESPEGERIVCVKGAPLFVLKTVEE-DHPIPEDVHENYEN 484

Query: 748 YAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATA 807
             AE      LASR                         + L  A +  E    +LG   
Sbjct: 485 KVAE------LASRGF-----------------------RALGVARKRGEGHWEILGVMP 515

Query: 808 IEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGM-SCRLLSEDMNL 857
             D  +D   ET++  +  G++V +LTGD    AV I   +CR L    N+
Sbjct: 516 CMDPPRDDTAETVNEARRLGLRVKMLTGD----AVGIAKETCRQLGLGTNI 562

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 540 VVRTSSLVEELGQIEYIFSDKTGTLTRN 567
           +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 343 IVQKLSAIESLAGVEILCSDKTGTLTKN 370

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score = 37.7 bits (86), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 65/301 (21%), Positives = 110/301 (36%), Gaps = 87/301 (28%)

Query: 688 EYQLLNICEFNSTRKRMSAIFRLPNGEIKLFCKGADTVILERLKAGENPYIEATLRH--- 744
           +Y++L    F+   K+++AI   P GE  +  KGA   +L+ ++  EN  I   ++    
Sbjct: 423 KYKVLEFHPFDPVSKKVTAIVESPEGERIVCVKGAPLFVLKTVE--ENHLIPEDVKENYE 480

Query: 745 --LEDYAAEGLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFL 802
             + + A+ G R L +A +         W+                             +
Sbjct: 481 NKVAELASRGYRALGVARK----RGEGHWE-----------------------------I 507

Query: 803 LGATAIEDKLQDGVPETIHTLQDAGIKVWVLTGDRQETAVNIGM-SCRLLSEDMNLLIIN 861
           LG     D  +D   +T++  +  G++V +LTGD    AV I   +CR L    N  I N
Sbjct: 508 LGVMPCMDPPRDDTAQTVNEARHLGLRVKMLTGD----AVGIAKETCRQLGLGTN--IYN 561

Query: 862 EEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGKSLGFXXXXXXXXXXXXIGKLCK 921
                       E+L       +   ++       DG                       
Sbjct: 562 -----------AERLGLGGGGDMPGSELADFVENADG----------------------- 587

Query: 922 AVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARS 981
                 V P  K  VV++++++   L+   GDG ND   ++ A  G+ + G     AARS
Sbjct: 588 ---FAEVFPQHKYNVVEILQQR-GYLVAMTGDGVNDAPSLKKADTGIAVEG--ATDAARS 641

Query: 982 A 982
           A
Sbjct: 642 A 642

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 20/29 (68%)

Query: 539 TVVRTSSLVEELGQIEYIFSDKTGTLTRN 567
            +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 339 AIVQKLSAIESLAGVEILCSDKTGTLTKN 367

>Scas_710.41
          Length = 904

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 61/303 (20%), Positives = 107/303 (35%), Gaps = 91/303 (30%)

Query: 688 EYQLLNICEFNSTRKRMSAIFRLPNGEIKLFCKGADTVILERLKAGENPYIEATLRHLED 747
           +Y++L    F+   K+++A+ + P GE     KGA   +L+ ++  ++P  E    + E+
Sbjct: 429 KYKILEFHPFDPVSKKVTAVVKSPEGETITCVKGAPLFVLKTVEE-DHPVPEDVHENYEN 487

Query: 748 YAAE----GLRTLCLASRTVTESEYAEWKDIYDAASTTLDDRAQKLDDAAELIEKDLFLL 803
             AE    G R+L +A +         W+                             +L
Sbjct: 488 KVAELASRGFRSLGVARK----RGEGYWE-----------------------------IL 514

Query: 804 GATAIEDKLQDGVPETIHTLQDAGIKVWVLTGD----RQETAVNIGMSCRLLSEDMNLLI 859
           G     D  +D    TI   +  G++V +LTGD     +ET+  +G+   + +       
Sbjct: 515 GVMPCMDPPRDDTARTIAEARTLGLRVKMLTGDAVGIAKETSRQLGLGVNIYN------- 567

Query: 860 INEEDKEATRKNLTEKLKAISDHQISQQDMNSLALVIDGKSLGFXXXXXXXXXXXXIGKL 919
                         EKL       +   ++       DG                     
Sbjct: 568 -------------AEKLGLGGGGDMPGSELADFVENADG--------------------- 593

Query: 920 CKAVICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAA 979
                   V P  K  VV++++ +   L+   GDG ND   ++ A  G+ + G     AA
Sbjct: 594 -----FAEVFPQHKYKVVEILQNR-GYLVAMTGDGVNDAPSLKKADTGIAVEG--ATDAA 645

Query: 980 RSA 982
           RSA
Sbjct: 646 RSA 648

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 540 VVRTSSLVEELGQIEYIFSDKTGTLTRN 567
           +V+  S +E L  +E + SDKTGTLT+N
Sbjct: 346 IVQKLSAIESLAGVEILCSDKTGTLTKN 373

>Scas_297.1
          Length = 800

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 924 ICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 982
           +  R SP  K L+V+ +K   D ++   GDG ND   ++ A VG  + G+ G + AR A
Sbjct: 51  VMARSSPEDKRLLVETLKGMGD-VVAVTGDGTNDAPALKLADVGFSM-GISGTEVAREA 107

 Score = 35.0 bits (79), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 34/52 (65%), Gaps = 6/52 (11%)

Query: 300 NISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARI 351
           N+ VGDII + + + IPAD +++     EG C ++ +++ GE++  IK+ ++
Sbjct: 615 NLLVGDIITLQTGDVIPADGVLV-----EGQCEVDESSITGESD-TIKKVKV 660

>Scas_569.0d
          Length = 468

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 923 VICCRVSPLQKALVVKMVKRKTDSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSA 982
           ++  R SP  K  +++ + R+ D      GDG ND   ++ A+VG+ + G+ G   A+ A
Sbjct: 103 LVIARCSPQTKVRMIEALHRR-DKFCAMTGDGVNDSPSLKMANVGIAM-GINGSDVAKDA 160

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 55/113 (48%), Gaps = 12/113 (10%)

Query: 772 KDIYDAASTTLDDRAQKLDDAAELIEKDLFLLGATAIEDKLQDGVPETIHTLQDAGIKVW 831
           + + D AS+TL +    +D +         L+G   I D++++     +  LQ+ GIK  
Sbjct: 720 ESLSDIASSTLTESYVSIDGS---------LVGKFEISDRVKEDAHFVVEYLQNLGIKCC 770

Query: 832 VLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEAT---RKNLTEKLKAISD 881
           ++TGD  ++A+ +     + + D+   +  E+ ++     + N TE++  + D
Sbjct: 771 MVTGDAHQSALKVAQQLGISANDVFSEVTPEQKRDIVIQLQNNGTERVAFVGD 823

>Kwal_26.8333
          Length = 422

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 35/87 (40%)

Query: 1019 IALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQFVSSRLLDRYPQL 1078
            + +Y T   + F N  SG S+   +      +  +V  P  +G   Q V  + +      
Sbjct: 167  VQMYTTSSAFHFGNPASGSSVSHLYANVMKQIGLSVFVPLFVGQILQNVFPKQVSWCLST 226

Query: 1079 YKLGQRGQFFSVRIFWGWVINGFYHSA 1105
            +KLG+ G F  + I W      FY  A
Sbjct: 227  FKLGKVGSFCLILIMWSSFSTAFYQKA 253

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
            P-type ATPase, member of the heavy-metal transporting
            P-type ATPases in the superfamily of P-type ATPases [3015
            bp, 1004 aa]
          Length = 1004

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 64/146 (43%), Gaps = 26/146 (17%)

Query: 928  VSPLQKALVVKMVKRKT-DSLLLAIGDGANDVSMIQAAHVGVGIS-GMEGMQAARSADFA 985
            VSP  K  +VK ++ K  ++ +  +GDG ND   +  + +G+ IS G E   A  +AD  
Sbjct: 812  VSPTGKCDLVKKIQDKEGNNKVAVVGDGINDAPALALSDLGIAISTGTE--IAIEAADIV 869

Query: 986  IAQFKYLKKLLLVHGSWSYQRISQAILYSF--YKNIALYMTQFWYVFANAYS---GQSIM 1040
            I     L        + S + ++ AI  S   +K I L +  FW +  N +       ++
Sbjct: 870  ILCGNDLN-------TNSLRGLANAIDISLKTFKRIKLNL--FWALCYNIFMIPIAMGVL 920

Query: 1041 ESWTMTFYNVFFTVLPPFVMGVFDQF 1066
              W +T        LPP + G+   F
Sbjct: 921  IPWGIT--------LPPMLAGLAMAF 938

>Kwal_27.10623
          Length = 1142

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/101 (21%), Positives = 42/101 (41%), Gaps = 9/101 (8%)

Query: 691 LLNICEFNSTRKRMSAIFRLPNGEIKLFCKGADTVILERLKAGENPYIEATLRHLEDYAA 750
           L +   F+S     + +F+L +G   + C    T+  +        Y+       E Y +
Sbjct: 321 LFSALSFDSKTDAQNCVFQLADGNTTILCNHFVTLTADSPSIILQKYVGVVSSEYERYDS 380

Query: 751 -----EGLRTLCLASRT----VTESEYAEWKDIYDAASTTL 782
                E  + + L S++    + E+ + EW D+YD AS  +
Sbjct: 381 SVTNMEAAKKIALTSKSKFSELVETHHQEWIDLYDNASVDI 421

>Scas_630.14
          Length = 701

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 32/59 (54%)

Query: 510 FVTVEMIKYYQAYMIASDLDLYDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNV 568
           +V V+++++Y   M  S+ D  +E +   T+V TS ++     I YI+ DK   +  N+
Sbjct: 282 YVQVQLLRWYSLTMYPSNTDTLEEITIVNTLVSTSLMLGLHQDINYIYMDKLPNIIPNL 340

>CAGL0H08393g 821998..823836 highly similar to sp|P41815 Saccharomyces
            cerevisiae YDR046c PAP1, hypothetical start
          Length = 612

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 55/136 (40%), Gaps = 32/136 (23%)

Query: 1107 TFIGSTLFYRNGNVLNSHGETADHWAWG-VSIYTCSVIIVIGKAALVTNQWTKFTAFAIP 1165
            T IG+ L   NG  L+  G  +   A+G VS  T  +I   G+ A+        T   +P
Sbjct: 109  TGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAV--------TYPTLP 160

Query: 1166 GSLVFWLVFFPIYASILPHANVSKEYYGVVSHVYGSATFWLMCI----VLPTFALMRDLV 1221
            GS   +  FF                   +S  +G AT WL CI    VLP   +   + 
Sbjct: 161  GSFNAYTSFF-------------------ISKPFGFATTWLFCIQWLTVLPLELITAAMT 201

Query: 1222 WKYYKRTYTPESYHVV 1237
             KY+  +  P+ + ++
Sbjct: 202  IKYWNTSIDPDVFVII 217

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
           Saccharomyces cerevisiae YDR270w CCC2, start by
           similarity
          Length = 1012

 Score = 30.8 bits (68), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 55/275 (20%), Positives = 106/275 (38%), Gaps = 73/275 (26%)

Query: 301 ISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSKFIDKD 360
           + VGDI  V     IP+D IV      +G+  ++ + + GETNL +K+            
Sbjct: 432 LEVGDIAMVKPGAKIPSDGIV-----TKGISEVDESLMTGETNLVVKEI----------- 475

Query: 361 DLAGMRGKVLSEHPNSSLYTYEGTMNLNGKNISLSPEQMVLRGATLRNTAWIYGLVVFTG 420
                 G V++                               G T+  +  IY  V   G
Sbjct: 476 ------GSVVT-------------------------------GGTINGSGLIYFEVTSVG 498

Query: 421 HETKL------MRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNVIKVTSDAE 474
            +TKL      M+NA    +K+ +++R  +         +++L+L++ I     +T   +
Sbjct: 499 DDTKLANIIKVMKNAQ---LKKASIQRYTDYVASIFVPTVLILSLLTFI-VWTSLTRSEK 554

Query: 475 HLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLYDEA 534
            ++ L + G      F+  +     +     P +L +         A M+ + +     A
Sbjct: 555 IISKLSIFGETSESRFYMCLQIATSVVIVACPCALGLATP-----TAIMVGTGV-----A 604

Query: 535 SDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVM 569
           S++  +++   ++E+  ++     DKTGTLT   M
Sbjct: 605 SENGVLIKGGDVLEKFNEVNTFVFDKTGTLTTGHM 639

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.135    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 40,455,749
Number of extensions: 1787951
Number of successful extensions: 5978
Number of sequences better than 10.0: 98
Number of HSP's gapped: 5898
Number of HSP's successfully gapped: 177
Length of query: 1296
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1183
Effective length of database: 12,684,275
Effective search space: 15005497325
Effective search space used: 15005497325
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)