Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.706745745123820.0
Sklu_2164.250845119300.0
YOR323C (PRO2)45644918660.0
Scas_663.345744918220.0
KLLA0A03982g44744917610.0
CAGL0F00693g45544916990.0
ADR351C45245116220.0
CAGL0M10021g50392711.0
Scas_717.7452272701.4
Sklu_2412.499655701.6
YFR045W28577673.0
CAGL0F06061g33698663.4
YGL157W34751663.6
Sklu_1367.264448664.1
Scas_681.3295251665.7
CAGL0L07370g47252646.9
YNL071W (LAT1)482196647.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.7067
         (451 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.7067                                                          922   0.0  
Sklu_2164.2 YOR323C, Contig c2164 742-2268 reverse complement         748   0.0  
YOR323C (PRO2) [5105] chr15 complement(921530..922900) Gamma-glu...   723   0.0  
Scas_663.3                                                            706   0.0  
KLLA0A03982g 354208..355551 highly similar to sp|P54885 Saccharo...   682   0.0  
CAGL0F00693g 79324..80691 highly similar to sp|P54885 Saccharomy...   659   0.0  
ADR351C [2092] [Homologous to ScYOR323C (PRO2) - SH] (1324789..1...   629   0.0  
CAGL0M10021g 997486..998997 similar to sp|P38277 Saccharomyces c...    32   1.0  
Scas_717.74                                                            32   1.4  
Sklu_2412.4 YMR124W, Contig c2412 7729-10719                           32   1.6  
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    30   3.0  
CAGL0F06061g complement(604063..605073) similar to sp|Q04212 Sac...    30   3.4  
YGL157W (YGL157W) [1832] chr7 (209009..210052) Protein of unknow...    30   3.6  
Sklu_1367.2 YBR238C, Contig c1367 1879-3813                            30   4.1  
Scas_681.3                                                             30   5.7  
CAGL0L07370g 813821..815239 similar to sp|P43123 Saccharomyces c...    29   6.9  
YNL071W (LAT1) [4519] chr14 (491522..492970) Dihydrolipoamide S-...    29   7.3  

>Kwal_26.7067
          Length = 457

 Score =  922 bits (2382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/451 (100%), Positives = 451/451 (100%)

Query: 1   MSSNSETIAKNARLGGNVLKTISNEARSSLLYKIHDGLKANANSIKEANKKDLEIAKEAN 60
           MSSNSETIAKNARLGGNVLKTISNEARSSLLYKIHDGLKANANSIKEANKKDLEIAKEAN
Sbjct: 1   MSSNSETIAKNARLGGNVLKTISNEARSSLLYKIHDGLKANANSIKEANKKDLEIAKEAN 60

Query: 61  LADSLYRRLDLFKGDKFDTMLVGIKDVAELEDPVGKIKLARELDENLNLYQVTAPVGALL 120
           LADSLYRRLDLFKGDKFDTMLVGIKDVAELEDPVGKIKLARELDENLNLYQVTAPVGALL
Sbjct: 61  LADSLYRRLDLFKGDKFDTMLVGIKDVAELEDPVGKIKLARELDENLNLYQVTAPVGALL 120

Query: 121 VIFESRPEVIANITSLAIKSGNAAILKGGKESVHTFREISRIINTVISENEASSGIPASV 180
           VIFESRPEVIANITSLAIKSGNAAILKGGKESVHTFREISRIINTVISENEASSGIPASV
Sbjct: 121 VIFESRPEVIANITSLAIKSGNAAILKGGKESVHTFREISRIINTVISENEASSGIPASV 180

Query: 181 IQLIETRQDVSDLLQQDMYIDLVVPRGSNELVRKIKASTKIPVLGHADGICSIYLDEEAD 240
           IQLIETRQDVSDLLQQDMYIDLVVPRGSNELVRKIKASTKIPVLGHADGICSIYLDEEAD
Sbjct: 181 IQLIETRQDVSDLLQQDMYIDLVVPRGSNELVRKIKASTKIPVLGHADGICSIYLDEEAD 240

Query: 241 LQKALRITIDAKTSYPAGCNAMETLLINPKMSQWWKVLENLSKTGDVTLHVTEDVKASYF 300
           LQKALRITIDAKTSYPAGCNAMETLLINPKMSQWWKVLENLSKTGDVTLHVTEDVKASYF
Sbjct: 241 LQKALRITIDAKTSYPAGCNAMETLLINPKMSQWWKVLENLSKTGDVTLHVTEDVKASYF 300

Query: 301 AKLAESNELDDVITKKTVDANTSEDFDKEFLSLDCAVKFVSSTEDAVSHINLHSSKHTDA 360
           AKLAESNELDDVITKKTVDANTSEDFDKEFLSLDCAVKFVSSTEDAVSHINLHSSKHTDA
Sbjct: 301 AKLAESNELDDVITKKTVDANTSEDFDKEFLSLDCAVKFVSSTEDAVSHINLHSSKHTDA 360

Query: 361 IITENKSNAEYFMKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV 420
           IITENKSNAEYFMKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV
Sbjct: 361 IITENKSNAEYFMKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV 420

Query: 421 SYQYQLRGDGQIASDYVGSGGKRAFVHKNLD 451
           SYQYQLRGDGQIASDYVGSGGKRAFVHKNLD
Sbjct: 421 SYQYQLRGDGQIASDYVGSGGKRAFVHKNLD 451

>Sklu_2164.2 YOR323C, Contig c2164 742-2268 reverse complement
          Length = 508

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/451 (77%), Positives = 409/451 (90%)

Query: 1   MSSNSETIAKNARLGGNVLKTISNEARSSLLYKIHDGLKANANSIKEANKKDLEIAKEAN 60
           MSS +E IA+ ARL GN+LKT+S+E RS +LY IHDGLKANA SI++ANK DL+ AKE N
Sbjct: 52  MSSTAEKIAQKARLAGNILKTLSDEQRSKILYIIHDGLKANAESIEKANKVDLQNAKETN 111

Query: 61  LADSLYRRLDLFKGDKFDTMLVGIKDVAELEDPVGKIKLARELDENLNLYQVTAPVGALL 120
           L+DSL +RLDLFKGDKF+TML GIKDVAELEDPVGKIK+ARELDENL LYQVTAPVG LL
Sbjct: 112 LSDSLIKRLDLFKGDKFETMLQGIKDVAELEDPVGKIKMARELDENLTLYQVTAPVGVLL 171

Query: 121 VIFESRPEVIANITSLAIKSGNAAILKGGKESVHTFREISRIINTVISENEASSGIPASV 180
           VIFESRPEVIANIT+L+IKSGNAAILKGGKESV+TFRE+SRIINT+I+ENE  +G+P+  
Sbjct: 172 VIFESRPEVIANITALSIKSGNAAILKGGKESVNTFREMSRIINTIIAENEKLTGVPSGA 231

Query: 181 IQLIETRQDVSDLLQQDMYIDLVVPRGSNELVRKIKASTKIPVLGHADGICSIYLDEEAD 240
           +QLIETRQDVSDLL QD YIDLVVPRGSN LVR+IK STKIPVLGHADGICSIYLDE+AD
Sbjct: 232 VQLIETRQDVSDLLDQDAYIDLVVPRGSNALVRQIKCSTKIPVLGHADGICSIYLDEDAD 291

Query: 241 LQKALRITIDAKTSYPAGCNAMETLLINPKMSQWWKVLENLSKTGDVTLHVTEDVKASYF 300
           L+KA RIT+DAKT+YPAGCNA+ET+LINP +  WW+VLENL+  G+V +H+T+DVK +Y 
Sbjct: 292 LEKAKRITLDAKTNYPAGCNAVETILINPALKNWWEVLENLTLEGNVIVHLTKDVKEAYV 351

Query: 301 AKLAESNELDDVITKKTVDANTSEDFDKEFLSLDCAVKFVSSTEDAVSHINLHSSKHTDA 360
           +KL E+ +LD+ + +K V+AN +EDFDKEFLSLDCAVKFVSST++AV HINLHSSKHTDA
Sbjct: 352 SKLKENGKLDEALEQKIVEANEAEDFDKEFLSLDCAVKFVSSTQEAVQHINLHSSKHTDA 411

Query: 361 IITENKSNAEYFMKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV 420
           IITENK +AE+F+KGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV
Sbjct: 412 IITENKEDAEFFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV 471

Query: 421 SYQYQLRGDGQIASDYVGSGGKRAFVHKNLD 451
           SYQYQ+RG GQ+ASDY+G+GG +AF+HK+LD
Sbjct: 472 SYQYQIRGTGQVASDYLGAGGNKAFIHKDLD 502

>YOR323C (PRO2) [5105] chr15 complement(921530..922900)
           Gamma-glutamyl phosphate reductase (phosphoglutamate
           dehydrogenase), proline biosynthetic enzyme [1371 bp,
           456 aa]
          Length = 456

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/449 (76%), Positives = 396/449 (88%)

Query: 3   SNSETIAKNARLGGNVLKTISNEARSSLLYKIHDGLKANANSIKEANKKDLEIAKEANLA 62
           S+S+ IAKNAR  GN+LKTISNE RS +LYKIHD LKANA++I+EANK DL +AKE  LA
Sbjct: 2   SSSQQIAKNARKAGNILKTISNEGRSDILYKIHDALKANAHAIEEANKIDLAVAKETGLA 61

Query: 63  DSLYRRLDLFKGDKFDTMLVGIKDVAELEDPVGKIKLARELDENLNLYQVTAPVGALLVI 122
           DSL +RLDLFKGDKF+ ML GIKDVAELEDPVGK+K+ARELD+ L LYQVTAPVG LLVI
Sbjct: 62  DSLLKRLDLFKGDKFEVMLQGIKDVAELEDPVGKVKMARELDDGLTLYQVTAPVGVLLVI 121

Query: 123 FESRPEVIANITSLAIKSGNAAILKGGKESVHTFREISRIINTVISENEASSGIPASVIQ 182
           FESRPEVIANIT+L+IKSGNAAILKGGKESV+TFRE+++I+N  I++ ++ +G+P   +Q
Sbjct: 122 FESRPEVIANITALSIKSGNAAILKGGKESVNTFREMAKIVNDTIAQFQSETGVPVGSVQ 181

Query: 183 LIETRQDVSDLLQQDMYIDLVVPRGSNELVRKIKASTKIPVLGHADGICSIYLDEEADLQ 242
           LIETRQDVSDLL QD YIDLVVPRGSN LVRKIK +TKIPVLGHADGICSIYLDE+ADL 
Sbjct: 182 LIETRQDVSDLLDQDEYIDLVVPRGSNALVRKIKDTTKIPVLGHADGICSIYLDEDADLI 241

Query: 243 KALRITIDAKTSYPAGCNAMETLLINPKMSQWWKVLENLSKTGDVTLHVTEDVKASYFAK 302
           KA RI++DAKT+YPAGCNAMETLLINPK S+WW+VLENL+  G VT+H T+D+K +YF K
Sbjct: 242 KAKRISLDAKTNYPAGCNAMETLLINPKFSKWWEVLENLTLEGGVTIHATKDLKTAYFDK 301

Query: 303 LAESNELDDVITKKTVDANTSEDFDKEFLSLDCAVKFVSSTEDAVSHINLHSSKHTDAII 362
           L E  +L + I  KTVDA+  +DFDKEFLSLD A KFV+STE A+ HIN HSS+HTDAI+
Sbjct: 302 LNELGKLTEAIQCKTVDADEEQDFDKEFLSLDLAAKFVTSTESAIQHINTHSSRHTDAIV 361

Query: 363 TENKSNAEYFMKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSY 422
           TENK+NAE FMKGVDSSGVYWNASTRFADGFRYGFG EVGISTSKIHARGPVGLDGLVSY
Sbjct: 362 TENKANAEKFMKGVDSSGVYWNASTRFADGFRYGFGAEVGISTSKIHARGPVGLDGLVSY 421

Query: 423 QYQLRGDGQIASDYVGSGGKRAFVHKNLD 451
           QYQ+RGDGQ+ASDY+G+GG +AFVHK+LD
Sbjct: 422 QYQIRGDGQVASDYLGAGGNKAFVHKDLD 450

>Scas_663.3
          Length = 457

 Score =  706 bits (1822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/449 (74%), Positives = 385/449 (85%)

Query: 3   SNSETIAKNARLGGNVLKTISNEARSSLLYKIHDGLKANANSIKEANKKDLEIAKEANLA 62
           S+++ IA+ AR+ GN LKTISN+ RS++LYKI D LKA A+ I+ ANK DL+ AKE +L+
Sbjct: 2   SSAQQIAQRARMAGNSLKTISNDNRSAILYKIRDALKAGASDIEAANKLDLQNAKETHLS 61

Query: 63  DSLYRRLDLFKGDKFDTMLVGIKDVAELEDPVGKIKLARELDENLNLYQVTAPVGALLVI 122
           DSL +RLDLFKGDKF+TML GIKDVA+LEDPVGKIK+ARELDE L LYQVTAPVG LLVI
Sbjct: 62  DSLLKRLDLFKGDKFETMLQGIKDVADLEDPVGKIKMARELDEGLTLYQVTAPVGVLLVI 121

Query: 123 FESRPEVIANITSLAIKSGNAAILKGGKESVHTFREISRIINTVISENEASSGIPASVIQ 182
           FESRPEVIANIT+L IKSGNA ILKGGKESV+TFRE+SRIIN  I +NE  +G+P   +Q
Sbjct: 122 FESRPEVIANITALCIKSGNAGILKGGKESVNTFREMSRIINDTIEKNEKETGVPVGAVQ 181

Query: 183 LIETRQDVSDLLQQDMYIDLVVPRGSNELVRKIKASTKIPVLGHADGICSIYLDEEADLQ 242
           LIETRQDV+DLL QD YIDLVVPRGSN LVR IK STKIPVLGHADGICS+Y+DEEADL+
Sbjct: 182 LIETRQDVNDLLDQDEYIDLVVPRGSNALVRNIKNSTKIPVLGHADGICSVYIDEEADLE 241

Query: 243 KALRITIDAKTSYPAGCNAMETLLINPKMSQWWKVLENLSKTGDVTLHVTEDVKASYFAK 302
           KA RI  DAKT+YPAGCNAMETLLINP    WW+VLEN+++ GDVTLH   DVK +Y  K
Sbjct: 242 KAKRIVFDAKTNYPAGCNAMETLLINPSCPNWWEVLENVTRKGDVTLHCMPDVKKAYLDK 301

Query: 303 LAESNELDDVITKKTVDANTSEDFDKEFLSLDCAVKFVSSTEDAVSHINLHSSKHTDAII 362
           L +    DDVI   TVD +   DFDKEFLSLDCAVKFV+STE+A+ HIN+HSS+HTDAI+
Sbjct: 302 LTQLGTSDDVIKTHTVDVDEKHDFDKEFLSLDCAVKFVNSTEEAIKHINVHSSRHTDAIV 361

Query: 363 TENKSNAEYFMKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSY 422
           TENK +AE F+KGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSY
Sbjct: 362 TENKDSAELFLKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSY 421

Query: 423 QYQLRGDGQIASDYVGSGGKRAFVHKNLD 451
           QYQ+RG+GQIA DY+G+GG RAF+HK+LD
Sbjct: 422 QYQIRGNGQIAGDYLGAGGNRAFIHKDLD 450

>KLLA0A03982g 354208..355551 highly similar to sp|P54885
           Saccharomyces cerevisiae YOR323c PRO2 gamma-glutamyl
           phosphate reductase singleton, start by similarity
          Length = 447

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/449 (73%), Positives = 383/449 (85%), Gaps = 9/449 (2%)

Query: 3   SNSETIAKNARLGGNVLKTISNEARSSLLYKIHDGLKANANSIKEANKKDLEIAKEANLA 62
           S SE+IAK AR  GN+LKT+S+E RSS+LYKIHDGLKANA SI+ ANK DLE AK  NL+
Sbjct: 2   SVSESIAKTARAAGNILKTLSDEERSSILYKIHDGLKANAASIEAANKLDLEQAKSTNLS 61

Query: 63  DSLYRRLDLFKGDKFDTMLVGIKDVAELEDPVGKIKLARELDENLNLYQVTAPVGALLVI 122
           DSL +RLDLFKGDKF+TML GI DVA L+DPVGK+  ARE+DENL LYQ+TAPVG LLVI
Sbjct: 62  DSLVKRLDLFKGDKFETMLQGIVDVANLQDPVGKVNFAREIDENLTLYQITAPVGVLLVI 121

Query: 123 FESRPEVIANITSLAIKSGNAAILKGGKESVHTFREISRIINTVISENEASSGIPASVIQ 182
           FESRPEVIANIT+L+IKSGNAAILKGGKES++TF+E+SRI+N V+ +NE ++ +P   +Q
Sbjct: 122 FESRPEVIANITALSIKSGNAAILKGGKESLNTFKEMSRIVNDVVEQNEKTTHVPVGAVQ 181

Query: 183 LIETRQDVSDLLQQDMYIDLVVPRGSNELVRKIKASTKIPVLGHADGICSIYLDEEADLQ 242
           LIETR+DVSDLLQQD YIDLV+PRGSN LVR+IK+STKIPVLGHADGICSIY+DE AD+ 
Sbjct: 182 LIETREDVSDLLQQDEYIDLVIPRGSNALVRQIKSSTKIPVLGHADGICSIYVDESADIG 241

Query: 243 KALRITIDAKTSYPAGCNAMETLLINPKMSQWWKVLENLSKTGDVTLHVTEDVKASYFAK 302
           KA RI +DAKT+YPAGCNA+ETLLINPK+  WW+VL +L + G VTLHV+++VK  Y   
Sbjct: 242 KAKRILVDAKTNYPAGCNAVETLLINPKLQHWWEVLNSLIENG-VTLHVSKEVKKQY--- 297

Query: 303 LAESNELDDVITKKTVDANTSEDFDKEFLSLDCAVKFVSSTEDAVSHINLHSSKHTDAII 362
             E N   D I    VD + S+DFDKEFLSLD AV FV STE AV HIN HSSKHTDAI+
Sbjct: 298 -KEHNSTSDHI----VDLDESKDFDKEFLSLDIAVAFVESTEAAVLHINTHSSKHTDAIV 352

Query: 363 TENKSNAEYFMKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSY 422
           TEN  NAEYF+K VDSS VYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV+Y
Sbjct: 353 TENSENAEYFLKAVDSSSVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTY 412

Query: 423 QYQLRGDGQIASDYVGSGGKRAFVHKNLD 451
           QYQLRG+GQIASDY+G+GGK+AFVHK+LD
Sbjct: 413 QYQLRGNGQIASDYLGAGGKKAFVHKDLD 441

>CAGL0F00693g 79324..80691 highly similar to sp|P54885 Saccharomyces
           cerevisiae YOR323c PRO2 gamma-glutamyl phosphate
           reductase, start by similarity
          Length = 455

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/449 (70%), Positives = 374/449 (83%), Gaps = 1/449 (0%)

Query: 3   SNSETIAKNARLGGNVLKTISNEARSSLLYKIHDGLKANANSIKEANKKDLEIAKEANLA 62
           S++E IAK AR+ GNVLKTIS+E RS +LY+I D L    + I+ ANK+DLE A+   LA
Sbjct: 2   SSAEKIAKQARVAGNVLKTISDENRSKILYRIRDALANAKDEIESANKEDLEQARAGGLA 61

Query: 63  DSLYRRLDLFKGDKFDTMLVGIKDVAELEDPVGKIKLARELDENLNLYQVTAPVGALLVI 122
           DSL +RLDLFKGDKFD ML GI DVA+LEDPVGK+K+ARE+D  L LYQVTAPVG +LVI
Sbjct: 62  DSLVKRLDLFKGDKFDVMLQGISDVADLEDPVGKVKMAREIDNGLMLYQVTAPVGVILVI 121

Query: 123 FESRPEVIANITSLAIKSGNAAILKGGKESVHTFREISRIINTVISENEASSGIPASVIQ 182
           FESRPEVIANIT+L IKSGNA ILKGGKESV+TF+ +++++N  I + +  +G+P   +Q
Sbjct: 122 FESRPEVIANITALCIKSGNAGILKGGKESVNTFKAMAKVVNQTIEQYKDETGVPVGAVQ 181

Query: 183 LIETRQDVSDLLQQDMYIDLVVPRGSNELVRKIKASTKIPVLGHADGICSIYLDEEADLQ 242
           LIETRQDVSDLL QD YIDLVVPRGSN LVR+IK STKIPVLGHADGICSIY+D +ADL+
Sbjct: 182 LIETRQDVSDLLGQDEYIDLVVPRGSNSLVRQIKDSTKIPVLGHADGICSIYVDRDADLE 241

Query: 243 KALRITIDAKTSYPAGCNAMETLLINPKMSQWWKVLENLSKTGDVTLHVTEDVKASYFAK 302
           KA RI +DAKT+YPAGCNAME LL+NP  SQW  VL +L   G VT+H T DVK ++  K
Sbjct: 242 KAKRIVLDAKTNYPAGCNAMEGLLLNPDFSQWDDVLHHLITEGGVTIHATTDVKEAFLKK 301

Query: 303 LAESNELDDVITKKTVDANTSEDFDKEFLSLDCAVKFVSSTEDAVSHINLHSSKHTDAII 362
           L +S +L+D I  K VDA    DFDKEFLSLDCAVKF+ +T DA++HIN HSSKHTDAII
Sbjct: 302 LQDSGKLNDDIKAKIVDAKDG-DFDKEFLSLDCAVKFIPNTVDAINHINEHSSKHTDAII 360

Query: 363 TENKSNAEYFMKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVSY 422
           TE+K +AE F+KG+DSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV+Y
Sbjct: 361 TESKEDAEKFLKGIDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLVTY 420

Query: 423 QYQLRGDGQIASDYVGSGGKRAFVHKNLD 451
           QYQ+RGDGQ+ASDY+G+GG +AFVHK++D
Sbjct: 421 QYQIRGDGQVASDYLGAGGNKAFVHKDID 449

>ADR351C [2092] [Homologous to ScYOR323C (PRO2) - SH]
           (1324789..1326147) [1359 bp, 452 aa]
          Length = 452

 Score =  629 bits (1622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/451 (66%), Positives = 369/451 (81%), Gaps = 5/451 (1%)

Query: 1   MSSNSETIAKNARLGGNVLKTISNEARSSLLYKIHDGLKANANSIKEANKKDLEIAKEAN 60
           MS+ +E+IAK AR+ GNVLKT+SNE R+ +L +IHDGL A    I++AN+ DLE A + N
Sbjct: 1   MSTLAESIAKKARVAGNVLKTLSNEQRTGVLRRIHDGLLAKKEDIRKANEADLETAAQNN 60

Query: 61  LADSLYRRLDLFKGDKFDTMLVGIKDVAELEDPVGKIKLARELDENLNLYQVTAPVGALL 120
           LA +L +RL+LFKGDKF+ ML GI DVA LEDPVGK+++ RELDE L LY+VTAPVG +L
Sbjct: 61  LAPALVQRLNLFKGDKFEAMLQGILDVAALEDPVGKLQMVRELDEGLTLYKVTAPVGVML 120

Query: 121 VIFESRPEVIANITSLAIKSGNAAILKGGKESVHTFREISRIINTVISENEASSGIPASV 180
           +IFESRPEVIANI++L IKSGNA ILKGGKE+V+TFRE++ +IN V++E+E  +G+P   
Sbjct: 121 IIFESRPEVIANISALCIKSGNAGILKGGKETVNTFRELAAVINLVLAESEPETGVPVHA 180

Query: 181 IQLIETRQDVSDLLQQDMYIDLVVPRGSNELVRKIKASTKIPVLGHADGICSIYLDEEAD 240
           +QL+E+R +VSDLLQQD YIDLVVPRGSN LV++IKASTKIPVLGHADGICSIYLD +AD
Sbjct: 181 VQLVESRSEVSDLLQQDEYIDLVVPRGSNALVKQIKASTKIPVLGHADGICSIYLDADAD 240

Query: 241 LQKALRITIDAKTSYPAGCNAMETLLINPKMSQWWKVLENLSKTGDVTLHVTEDVKASYF 300
           L KA RI +D+KT+Y A CNA E+LLINP+ S W +VL +L   G+V LHVT DVK ++F
Sbjct: 241 LAKAKRIVLDSKTNYCAACNAAESLLINPRCSGWEEVLAHLIIAGNVKLHVTSDVKEAFF 300

Query: 301 AKLAESNELDDVITKKTVDANTSEDFDKEFLSLDCAVKFVSSTEDAVSHINLHSSKHTDA 360
           A   +    D  +    VDA    DF +EFLSLD AVKF+ S ++AV HIN HSSKHTDA
Sbjct: 301 AYAGD----DAALKGNVVDAEEG-DFSREFLSLDIAVKFIDSVQEAVIHINEHSSKHTDA 355

Query: 361 IITENKSNAEYFMKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV 420
           I+TE K  A++F+KG+DS+GVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV
Sbjct: 356 IVTECKQTADFFLKGIDSAGVYWNASTRFADGFRYGFGTEVGISTSKIHARGPVGLDGLV 415

Query: 421 SYQYQLRGDGQIASDYVGSGGKRAFVHKNLD 451
           +YQYQ+RG GQ+ASDY+G+GG RAFVHK+LD
Sbjct: 416 TYQYQVRGTGQVASDYIGAGGDRAFVHKDLD 446

>CAGL0M10021g 997486..998997 similar to sp|P38277 Saccharomyces
           cerevisiae YBR138c High-Dosage Reductional segregation
           defective, hypothetical start
          Length = 503

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 47/92 (51%), Gaps = 6/92 (6%)

Query: 126 RPEVIANITSLAIKSGNAAILKGGKESVHTFREISRIINTVISENEASSG--IPASVIQL 183
           +P++  +     I+S N   L   K+ VH  +E S + ++   ENEA S   I   + + 
Sbjct: 264 KPKLSLHNLKTKIRSSNTDHL-PVKKKVHYLKECSTVDSSTNEENEAGSSKCIKEVLNEF 322

Query: 184 IETRQDVSDLLQQDMYIDLVVPRGSNELVRKI 215
           +  + + +D    D+YI  ++ +G+NEL R +
Sbjct: 323 LPPKSNSADC---DLYISNLLSKGTNELKRCV 351

>Scas_717.74
          Length = 522

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 8/72 (11%)

Query: 137 AIKSGNAAILKGGKESVHTFREISRIINTVISENEASSGIPASVIQLIETRQDVSDLLQQ 196
           AI +GN+ ILK  + + HT   + RII          +G P  ++Q+++   D +  L  
Sbjct: 147 AIGAGNSVILKPSERTAHTALVMQRIIE--------EAGFPDGLVQVVQGAIDETQRLIT 198

Query: 197 DMYIDLVVPRGS 208
              +D++   GS
Sbjct: 199 SKDLDMIFYTGS 210

>Sklu_2412.4 YMR124W, Contig c2412 7729-10719
          Length = 996

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 346 AVSHINLHSSKHTDAIITENKSNAEYFMKGVDSSGVYWN--ASTRFADGFRYGFG 398
           + S  N    KH++    EN+ + E  M    SS V +N  ++ R   G +YGFG
Sbjct: 110 SASFSNFFKGKHSNGRTKENEEDEEVIMSDQSSSMVTFNDLSTLRNNGGHKYGFG 164

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 33/77 (42%), Gaps = 4/77 (5%)

Query: 223 VLGHADGICSIYLDEEADLQKALRITIDAKTSYPAGCNAMETLLINPKMSQWWK----VL 278
           + G A     + + +  D+ K   ++ +AKT Y    N M  + +   M+ +WK      
Sbjct: 199 ITGLATSFTLVAMTQPIDVVKTRMMSQNAKTEYKNTLNCMYRIFVQEGMATFWKGSIFRF 258

Query: 279 ENLSKTGDVTLHVTEDV 295
             +  +G +T  V E V
Sbjct: 259 MKVGISGGLTFTVYEQV 275

>CAGL0F06061g complement(604063..605073) similar to sp|Q04212
           Saccharomyces cerevisiae YMR041c, hypothetical start
          Length = 336

 Score = 30.0 bits (66), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 41/98 (41%), Gaps = 24/98 (24%)

Query: 27  RSSLLYKIH---DGLKANANSIKE-ANKKDLEIAKEANLADSLYRRLDLFKGDKFDTMLV 82
           RS  ++  H   D LKA      E  +K  +EI   AN       R  +F   K+   ++
Sbjct: 226 RSQGIHSFHPASDELKAKCRQAAEYTHKHGVEIQDLAN-------RYAMFNWHKYGPTVI 278

Query: 83  GIKDVAELED-------------PVGKIKLARELDENL 107
           G+ +VAEL+D             P   IKL + + E +
Sbjct: 279 GVSNVAELQDAIIDYQITEKDKLPENDIKLVKHIQEEI 316

>YGL157W (YGL157W) [1832] chr7 (209009..210052) Protein of unknown
           function, member of a family (GRE2, YGL039W, YGL157W,
           YDR541C) having similarity to plant
           dihydroflavonol-4-reductases [1044 bp, 347 aa]
          Length = 347

 Score = 30.0 bits (66), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 361 IITENKSNAEYFMKGVDSSGVYWNASTRFADGFRYGFGTEVGISTSKIHAR 411
            + ENKS+ ++ +  ++   V+      FAD  ++G  T  GI +  IH++
Sbjct: 183 FLKENKSSVKFTLSTINPGFVF--GPQMFADSLKHGINTSSGIVSELIHSK 231

>Sklu_1367.2 YBR238C, Contig c1367 1879-3813
          Length = 644

 Score = 30.0 bits (66), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 30/48 (62%), Gaps = 2/48 (4%)

Query: 6   ETIAKNARLGGNVLKT--ISNEARSSLLYKIHDGLKANANSIKEANKK 51
           E+I K   L  +++ T  ++++  S L++ +H+GL+AN N +   NKK
Sbjct: 133 ESIGKGMGLYRDLIHTPELNSDRVSKLVHLLHNGLRANRNQLTRMNKK 180

>Scas_681.3
          Length = 2952

 Score = 30.0 bits (66), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 98   KLARELDENLNLYQVTAPVGALLVIFESRPEVIANITSLAIKSGNAAILKG 148
            K +  +D N+N + + AP+G+   +FE R  ++A++T +     N + + G
Sbjct: 1922 KFSWSIDTNINYFGLLAPIGSAYFLFELR-MLLASLTKMGSDIPNQSDISG 1971

>CAGL0L07370g 813821..815239 similar to sp|P43123 Saccharomyces
           cerevisiae YDL103c QRI1 UDP-N-acetylglucosamine
           pyrophosphorylase, start by similarity
          Length = 472

 Score = 29.3 bits (64), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 2/52 (3%)

Query: 329 EFLSLDC--AVKFVSSTEDAVSHINLHSSKHTDAIITENKSNAEYFMKGVDS 378
           E L  DC  A++       A SHI    S   ++II   ++   YF KGV+S
Sbjct: 44  EKLVSDCKKAIQLAEENSKAGSHIQPLPSSSYESIIDNREAETRYFNKGVES 95

>YNL071W (LAT1) [4519] chr14 (491522..492970) Dihydrolipoamide
           S-acetyltransferase component (E2) of pyruvate
           dehydrogenase complex [1449 bp, 482 aa]
          Length = 482

 Score = 29.3 bits (64), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 45/196 (22%), Positives = 65/196 (33%), Gaps = 32/196 (16%)

Query: 241 LQKALRITIDAKTSYPA----GCNAMETLLINPKMSQWWKVLENLSKTGDVTLHVTEDVK 296
           L ++LR+ +    SYP     G  A+   +    ++ W K   +    G+V   +  D K
Sbjct: 17  LTRSLRLQLRCYASYPEHTIIGMPALSPTMTQGNLAAWTKKEGDQLSPGEVIAEIETD-K 75

Query: 297 AS---------YFAKLAESNELDDVITKKTV--------DANTSEDFDKEFLSLDCAVKF 339
           A          Y AK+       D+   K +        D    +DF  E    D     
Sbjct: 76  AQMDFEFQEDGYLAKILVPEGTKDIPVNKPIAVYVEDKADVPAFKDFKLEDSGSD----- 130

Query: 340 VSSTEDAVSHINLHSSKHTDAIITENKSNAEYFMKGVDSSGVYWNASTRFADGFRYGFGT 399
            S T          + K  +A   E K++A    K    S V       FA         
Sbjct: 131 -SKTSTKAQPAEPQAEKKQEAPAEETKTSAPEAKK----SDVAAPQGRIFASPLAKTIAL 185

Query: 400 EVGISTSKIHARGPVG 415
           E GIS   +H  GP G
Sbjct: 186 EKGISLKDVHGTGPRG 201

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.131    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,814,780
Number of extensions: 598812
Number of successful extensions: 1665
Number of sequences better than 10.0: 48
Number of HSP's gapped: 1659
Number of HSP's successfully gapped: 48
Length of query: 451
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 346
Effective length of database: 12,961,219
Effective search space: 4484581774
Effective search space used: 4484581774
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 63 (28.9 bits)