Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.706620420210661e-150
KLLA0A03960g2252202224e-22
Scas_592.152542032226e-22
YAL027W2612022191e-21
CAGL0G06292g2532012077e-20
ADR352C2542071799e-16
CAGL0L00649g70441720.23
KLLA0D10593g925112642.4
Kwal_26.935164981642.7
Scas_594.7170362633.5
AER425W40926623.8
CAGL0B01397g51477615.3
Kwal_27.12498136592616.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.7066
         (202 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.7066                                                          415   e-150
KLLA0A03960g 353119..353796 weakly similar to sp|P39735 Saccharo...    90   4e-22
Scas_592.15                                                            90   6e-22
YAL027W (YAL027W) [41] chr1 (94690..95475) Protein of unknown fu...    89   1e-21
CAGL0G06292g complement(602454..603215) similar to sp|P39735 Sac...    84   7e-20
ADR352C [2093] [Homologous to ScYAL027W - SH] (1326273..1327037)...    74   9e-16
CAGL0L00649g complement(78939..81053) highly similar to sp|Q0157...    32   0.23 
KLLA0D10593g complement(900326..903103) similar to sp|P08638 Sac...    29   2.4  
Kwal_26.9351                                                           29   2.7  
Scas_594.7                                                             29   3.5  
AER425W [2925] [Homologous to ScYNL078W (JIP1) - SH] complement(...    28   3.8  
CAGL0B01397g 127374..128918 similar to sp|Q08287 Saccharomyces c...    28   5.3  
Kwal_27.12498                                                          28   6.1  

>Kwal_26.7066
          Length = 204

 Score =  415 bits (1066), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 202/202 (100%), Positives = 202/202 (100%)

Query: 1   MLILYELTAKEIHEEVLGKIKVGNLVEMKDIMTRFPSFRHTKHSDTTSCHLTTLERSGKH 60
           MLILYELTAKEIHEEVLGKIKVGNLVEMKDIMTRFPSFRHTKHSDTTSCHLTTLERSGKH
Sbjct: 1   MLILYELTAKEIHEEVLGKIKVGNLVEMKDIMTRFPSFRHTKHSDTTSCHLTTLERSGKH 60

Query: 61  QYKLHYENNWELDIFVSDIRKLARIRSTLLQRLNFRPNSSSGLIAPIGDLSKTKVLRRVR 120
           QYKLHYENNWELDIFVSDIRKLARIRSTLLQRLNFRPNSSSGLIAPIGDLSKTKVLRRVR
Sbjct: 61  QYKLHYENNWELDIFVSDIRKLARIRSTLLQRLNFRPNSSSGLIAPIGDLSKTKVLRRVR 120

Query: 121 EEIVSKQEASSEPKLLLESDEEDVFPESGGNEKEPTSNVLPEMIDVDSEKKPKFKFSNVQ 180
           EEIVSKQEASSEPKLLLESDEEDVFPESGGNEKEPTSNVLPEMIDVDSEKKPKFKFSNVQ
Sbjct: 121 EEIVSKQEASSEPKLLLESDEEDVFPESGGNEKEPTSNVLPEMIDVDSEKKPKFKFSNVQ 180

Query: 181 MLNLGNCIDIHILKRPARAKMG 202
           MLNLGNCIDIHILKRPARAKMG
Sbjct: 181 MLNLGNCIDIHILKRPARAKMG 202

>KLLA0A03960g 353119..353796 weakly similar to sp|P39735
           Saccharomyces cerevisiae YAL027w hypothetical protein
           singleton, hypothetical start
          Length = 225

 Score = 90.1 bits (222), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 67/220 (30%), Positives = 107/220 (48%), Gaps = 29/220 (13%)

Query: 1   MLILYELTAKEIHEEVLGKIKVGNLVEMKDIM--TRFPSFRHTKHSDTTS------CHLT 52
           + +LYEL +  + E+VL K+K+   ++  D++   +  S   T+ +D  +       H+T
Sbjct: 13  LFMLYELCSPILEEKVLNKLKIDTFMDFADVLEILKKGSSLETRSTDVYNPIDGIDVHIT 72

Query: 53  TLERSGKHQYKLHYENNWELDIFVSDIRKLARIRSTLLQRLNFRPNSSSGLIAPIG-DLS 111
           ++ER+GK  YKLH+ +NW LDI + +I KL   R  L    + +  S++G   P+     
Sbjct: 73  SIERTGKKSYKLHFSHNWRLDILIENIDKLHHWRKLLTLLDSVQSVSNTGQSIPLFIPFK 132

Query: 112 KTKVLRRVREEIVSKQEASS--EPKLLLESDEEDVFPESGGNEKEPTSNVLPEMIDVD-- 167
            T VL R  + + S   +S   +P +L+E       PE  G  + P   +  EM+D D  
Sbjct: 133 STNVLVRSIKPLESDTNSSKSEDPPILIE-------PEDDGLGQVPRDEI--EMVDQDPN 183

Query: 168 -------SEKKPKFKFSNVQMLNLGNCIDIHILKRPARAK 200
                   +KKP F +    M     CI IH+L RP R K
Sbjct: 184 DIKLDTKDDKKPIFDYQYKGMRLFDKCIKIHVLGRPKRGK 223

>Scas_592.15
          Length = 254

 Score = 90.1 bits (222), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 109/203 (53%), Gaps = 27/203 (13%)

Query: 1   MLILYELTAKEIHEEVLGKIKVGNLVEMK-DIMTRFPSFRHTKHSDTTSCHLTTLERSGK 59
           +LI+Y+L++ E+ E VLGK+++G+  + + +I+ +     +T   D  +  L T+ R  K
Sbjct: 77  ILIVYDLSSPEVMETVLGKLRIGSSADFETEILPKLMD-ENTLSKDLVNVPLQTVTRVAK 135

Query: 60  HQYKLHYENNWELDIFVSDIRKLARIRSTLLQRLNFRPNSSSGLIAPIGDLSKTKVLRRV 119
            +YKL ++ NWELDIF+++++KL +IR  LL    F     S         ++T  L   
Sbjct: 136 FKYKLRFKGNWELDIFINNMKKLIKIRHFLL----FTDGHMSA--------ARTLELPPN 183

Query: 120 REEIVSKQEASSEPKLLLESDEEDVFP-ESGGNEKEPTSNVLPEMIDVDSEKKPKFKFSN 178
           R  ++++Q+ S      LES+   + P E  G+E   T+       D   + KP  K   
Sbjct: 184 RRILLTEQKTS------LESEGSPMIPLEVDGDEMIETTQ------DAVEDVKPDIKLKY 231

Query: 179 VQMLNLGNCIDIHILKRPARAKM 201
             ++NLG C+ IHIL+RP R K+
Sbjct: 232 NPIINLGECLSIHILQRPRRHKV 254

>YAL027W (YAL027W) [41] chr1 (94690..95475) Protein of unknown
           function [786 bp, 261 aa]
          Length = 261

 Score = 89.0 bits (219), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 103/202 (50%), Gaps = 33/202 (16%)

Query: 1   MLILYELTAKEIHEEVLGKIKVGNLVEMK-DIMTRFPSFRHTKHSDTTSCHLTTLERSGK 59
           +LI+YEL + EI   VL KI+VG+  + + +++ +   F      +  + H+ ++ R  K
Sbjct: 82  LLIVYELASPEIISSVLSKIRVGHSTDFQINVLPKL--FAGADTDNAVTSHIQSVTRLAK 139

Query: 60  HQYKLHYENNWELDIFVSDIRKLARIRSTLLQRLNFRPNSSSGLIAPIGDLSKTKVLRRV 119
            +YKLHY++ WELDIF++ I+K+A +R  L+    F+  + +G     G   KT + R++
Sbjct: 140 FKYKLHYKHKWELDIFINSIKKIANLRHYLM----FQTLTLNGFSLNAG--PKTLLARKI 193

Query: 120 REEIVSKQEASSEPKLLLESDEEDVFPESGGNEKEPTSNVLPEMIDVDSEKKPKFKFSNV 179
            ++          P LL+E+ + D                      V+ + KP  +F   
Sbjct: 194 EKQ-------PQVPNLLIENGDADALDTP-----------------VEEDIKPVIEFMYK 229

Query: 180 QMLNLGNCIDIHILKRPARAKM 201
            ++NLG  ID+H+L RP R K+
Sbjct: 230 PVINLGEIIDVHVLHRPRRHKV 251

>CAGL0G06292g complement(602454..603215) similar to sp|P39735
           Saccharomyces cerevisiae YAL027w, start by similarity
          Length = 253

 Score = 84.3 bits (207), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 106/201 (52%), Gaps = 25/201 (12%)

Query: 1   MLILYELTAKEIHEEVLGKIKVGNLVEM-KDIMTRFPSFRHTKHSDTTSCHLTTLERSGK 59
           +LILYEL++  + + +  KI+VG + +  +D + +FP    +        +LT+L+R GK
Sbjct: 76  ILILYELSSPAMKQNIFSKIRVGQVYDFDEDTLKKFP---QSIQGSLKESNLTSLKRVGK 132

Query: 60  HQYKLHYENNWELDIFVSDIRKLARIRSTLLQRLNFRPNSSSGLIAPIGDLSKTKVLRRV 119
            +YKL Y  NW++DIF+S+I KL  IR+ L+    F+         P   L K + L  +
Sbjct: 133 MKYKLTYRKNWDVDIFISNINKLETIRTYLI----FKDQYPQWNEYPC--LQKQQSLLVM 186

Query: 120 REEIVSKQEASSEPKLLLESDEEDVFPESGGNEKEPTSNVLPEMIDVDSEKKPKFKFSNV 179
            +++    E++++  ++L+ +EE         E +P +            +KP+  F+  
Sbjct: 187 GQKL---SESTNQDPIILQEEEELNLNYEQSAEDQPNN------------EKPEIAFTYE 231

Query: 180 QMLNLGNCIDIHILKRPARAK 200
             L+L  C+D++ILKRP R +
Sbjct: 232 PQLSLIQCLDLYILKRPKRKR 252

>ADR352C [2093] [Homologous to ScYAL027W - SH] (1326273..1327037)
           [765 bp, 254 aa]
          Length = 254

 Score = 73.6 bits (179), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 95/207 (45%), Gaps = 37/207 (17%)

Query: 1   MLILYELTAKEIHEEVLGKIKVGNLVEMKDIMTRFPSFRHTKHSDTT-------SCHLTT 53
           + I+YEL +    EE L K K+G L + +DI+      R  +  D           H  T
Sbjct: 76  LYIIYELGSPGA-EETLRKFKIGGLADFRDIV------RAAEQGDRPEQPIPGLDLHTMT 128

Query: 54  LERSGKHQYKLHYENNWELDIFVSDIRKLARIRSTLLQRLNFRPNSSSGLIAPIGDLSKT 113
            ER  K ++ LH+E+NW ++I ++DIRKLA  R  LL  +      ++   AP+   +  
Sbjct: 129 FERLDKQRFPLHFEHNWVVNIILNDIRKLAVWRRLLLCDIAPIGVPAAAAPAPMPAGAPY 188

Query: 114 KVLRRVREEIVSKQEASSEPKLLLESDEEDVFPESGGNEKEPTSNVLPEMIDVDSEKKPK 173
            +LR  R  +         P+ +L+ D  +  P  G               D++ E+KP 
Sbjct: 189 VLLRERRGRV--------SPQGMLQEDAPEGVPREG---------------DLNVEQKPV 225

Query: 174 FKFSNVQMLNLGNCIDIHILKRPARAK 200
             +    + NLG  I+IH+L+RP R +
Sbjct: 226 LDYRYKSVTNLGPGIEIHVLQRPRRVR 252

>CAGL0L00649g complement(78939..81053) highly similar to sp|Q01574
           Saccharomyces cerevisiae YAL054c ACS1 acetyl-CoA
           synthetase, start by similarity
          Length = 704

 Score = 32.3 bits (72), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 4/41 (9%)

Query: 165 DVDSEKKPKFK----FSNVQMLNLGNCIDIHILKRPARAKM 201
           DVD+  KP F+    F N Q+    NC+D H LK P +  +
Sbjct: 102 DVDNPTKPSFENNAWFLNGQLNTCYNCVDRHALKTPNKTAI 142

>KLLA0D10593g complement(900326..903103) similar to sp|P08638
           Saccharomyces cerevisiae YLR451w LEU3 transcription
           factor, hypothetical start
          Length = 925

 Score = 29.3 bits (64), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/112 (20%), Positives = 47/112 (41%), Gaps = 10/112 (8%)

Query: 12  IHEEVLGKIKVGNLVEMKDIMTRFPSFRHTKHSDTTSCHLTTLERSGKHQYKLHYENNWE 71
           IHE++   I    + +       FP++    H+   +C ++T+E S              
Sbjct: 367 IHEQIRTWICCNIVSQTISASFGFPAYVSFDHTVINTCKISTVESSTTD----------F 416

Query: 72  LDIFVSDIRKLARIRSTLLQRLNFRPNSSSGLIAPIGDLSKTKVLRRVREEI 123
           +   +  + ++A   + ++  +N  P++ SGL+A    L    VL R   E+
Sbjct: 417 IPFSIKQMLQIAHFENQIVDTMNSNPSNMSGLVANEEKLPLLHVLNRQLSEL 468

>Kwal_26.9351
          Length = 649

 Score = 29.3 bits (64), Expect = 2.7,   Method: Composition-based stats.
 Identities = 25/81 (30%), Positives = 36/81 (44%), Gaps = 12/81 (14%)

Query: 87  STLLQRLNFRPNSSSGLIAPIGDLSKTKVLRRVREEIVSK---QEASSEPKLLLESDEED 143
           ++  + L  RP+ +SGL      +SK    RR  E  V +   +EA   PK L +     
Sbjct: 12  ASAFEILTDRPSRTSGL-----SVSK----RRTNEVTVMETHNEEAEEPPKNLWQRFVRA 62

Query: 144 VFPESGGNEKEPTSNVLPEMI 164
           V PESG    EP  N    ++
Sbjct: 63  VKPESGSPYDEPPKNTRERIV 83

>Scas_594.7
          Length = 1703

 Score = 28.9 bits (63), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 128 EASSEPKLLLESDEEDVFPESGGNEKEPTSNVLPEMIDVDSEKKPKFKFSNVQMLNLGNC 187
           +A S P +  + D E +FP S  +++E    +LP  +DV S  +    +  +  LN+G  
Sbjct: 497 DAFSLPNMETKVDYEKLFPTSETSKQEIYPGLLPTGLDVHSATE---LYHTLTALNIGTT 553

Query: 188 ID 189
           ID
Sbjct: 554 ID 555

>AER425W [2925] [Homologous to ScYNL078W (JIP1) - SH]
           complement(1452485..1453714) [1230 bp, 409 aa]
          Length = 409

 Score = 28.5 bits (62), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 20/26 (76%)

Query: 81  KLARIRSTLLQRLNFRPNSSSGLIAP 106
           +LAR R +L+ +L FRP++S+  +AP
Sbjct: 239 ELARDRPSLVSKLEFRPSTSTRPVAP 264

>CAGL0B01397g 127374..128918 similar to sp|Q08287 Saccharomyces
           cerevisiae YOL144w NOP8 nucleolar protein required for
           60S ribosome biogenesis, hypothetical start
          Length = 514

 Score = 28.1 bits (61), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 18/77 (23%)

Query: 96  RPNSSSGLIAPIGDLSKTKVLRRVREEIVSKQEASSEPKLLLESDEEDVFPESGGNEKEP 155
           RP +++GL     D S + +             A+S    L+++DE D+       EKE 
Sbjct: 231 RPATAAGLAGEALDSSGSTL-------------ATSTVDDLVDADESDI-----EQEKER 272

Query: 156 TSNVLPEMIDVDSEKKP 172
           T+N+L +M+D     KP
Sbjct: 273 TNNILAQMMDSFDFAKP 289

>Kwal_27.12498
          Length = 1365

 Score = 28.1 bits (61), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 44/92 (47%), Gaps = 9/92 (9%)

Query: 14   EEVLGKIKVGNLVEMKDIMTRFPSFRHTKHSDTTSCHLTTLERSGKHQYKLHYENNWEL- 72
            EEV G  K G L ++ + MTR  S    +   +TS  L  L+R G H  K+  E+  E  
Sbjct: 924  EEVQGFTKFGGLSKLTE-MTRVVSLYEKQSLPSTSEDLHLLDRDGDH--KMSRESTVEKS 980

Query: 73   ---DIFVSDIRKLARIRSTLLQRLNFRPNSSS 101
               D+ +SDI K    +   L  + FR N S+
Sbjct: 981  KTPDVDLSDIFKEQPTQKGTL--VTFRENPST 1010

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,801,157
Number of extensions: 305599
Number of successful extensions: 1243
Number of sequences better than 10.0: 29
Number of HSP's gapped: 1233
Number of HSP's successfully gapped: 29
Length of query: 202
Length of database: 16,596,109
Length adjustment: 97
Effective length of query: 105
Effective length of database: 13,238,163
Effective search space: 1390007115
Effective search space used: 1390007115
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)