Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.706337837315960.0
Sklu_2164.44652531785e-14
CAGL0G06314g653193968e-04
Scas_663.27559150890.005
KLLA0A03938g42057890.006
YAL028W528128760.23
Kwal_47.1918471265672.6
Scas_688.22187681673.0
Scas_592.1454959654.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.7063
         (373 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.7063                                                          619   0.0  
Sklu_2164.4 YAL028W, Contig c2164 3696-5093 reverse complement         73   5e-14
CAGL0G06314g complement(603668..605629) some similarities with s...    42   8e-04
Scas_663.27                                                            39   0.005
KLLA0A03938g 351240..352502 some similarities with sp|P39734 Sac...    39   0.006
YAL028W (YAL028W) [40] chr1 (92903..94489) Protein of unknown fu...    34   0.23 
Kwal_47.19184                                                          30   2.6  
Scas_688.22                                                            30   3.0  
Scas_592.14                                                            30   4.7  

>Kwal_26.7063
          Length = 378

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/373 (83%), Positives = 310/373 (83%)

Query: 1   MSSSVISSGYLPYNQDIRRPLARVPSISNNDLPRHSFHSRCEVERNAMTQHDYTSASAGK 60
           MSSSVISSGYLPYNQDIRRPLARVPSISNNDLPRHSFHSRCEVERNAMTQHDYTSASAGK
Sbjct: 1   MSSSVISSGYLPYNQDIRRPLARVPSISNNDLPRHSFHSRCEVERNAMTQHDYTSASAGK 60

Query: 61  FSECLFRSCQSSHANGGRAVGLXXXXXXXXIHNLERXXXXXXXXXXXXXXXXXXXXXXXX 120
           FSECLFRSCQSSHANGGRAVGL        IHNLER                        
Sbjct: 61  FSECLFRSCQSSHANGGRAVGLSASASASSIHNLERPLFNSSNSFLNPSFGPRPGSSRSR 120

Query: 121 VHDRTRSFEGHLKNDDKRLVHQFLNFDEETEAKSDIQVSLLSAQSSLYGASQGESLSRLM 180
           VHDRTRSFEGHLKNDDKRLVHQFLNFDEETEAKSDIQVSLLSAQSSLYGASQGESLSRLM
Sbjct: 121 VHDRTRSFEGHLKNDDKRLVHQFLNFDEETEAKSDIQVSLLSAQSSLYGASQGESLSRLM 180

Query: 181 LFDLKDPAVIRENCHSAQPGNKSTVLPQQYFANELSKFDHYIRDLMASISSDESRITKTR 240
           LFDLKDPAVIRENCHSAQPGNKSTVLPQQYFANELSKFDHYIRDLMASISSDESRITKTR
Sbjct: 181 LFDLKDPAVIRENCHSAQPGNKSTVLPQQYFANELSKFDHYIRDLMASISSDESRITKTR 240

Query: 241 TELDDLQQHIREAKSVIKDIDRCIQDQDIKMLRKXXXXXXXXXXXXXXXXXXXTYSESLA 300
           TELDDLQQHIREAKSVIKDIDRCIQDQDIKMLRK                   TYSESLA
Sbjct: 241 TELDDLQQHIREAKSVIKDIDRCIQDQDIKMLRKSFESEDESSFISRFSAAIATYSESLA 300

Query: 301 SFEKRIGKCKVDLTTQKATVHKLETTIKLNEMIQDSQSNMCFLDRIREYKGLIYDFCXXX 360
           SFEKRIGKCKVDLTTQKATVHKLETTIKLNEMIQDSQSNMCFLDRIREYKGLIYDFC   
Sbjct: 301 SFEKRIGKCKVDLTTQKATVHKLETTIKLNEMIQDSQSNMCFLDRIREYKGLIYDFCALI 360

Query: 361 XXXXXXXXXKRYF 373
                    KRYF
Sbjct: 361 LLIALIVVLKRYF 373

>Sklu_2164.4 YAL028W, Contig c2164 3696-5093 reverse complement
          Length = 465

 Score = 73.2 bits (178), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 62/253 (24%), Positives = 109/253 (43%), Gaps = 14/253 (5%)

Query: 135 DDKRLVHQFLN--------FDEETEAKSDIQVSLLSAQSSLYGASQGESLSRLMLFDLKD 186
           + KRLVHQFL          ++E   K  + +  L+  SS   +    SL R+  +DLK 
Sbjct: 210 NGKRLVHQFLKDPSQKDGELEKEGLFKDGLLIRPLTRSSSSLSSPMRNSLPRVFYYDLKR 269

Query: 187 PAVIRENCHSAQPGNKST-----VLPQQYFANELSKFDHYIRDLMASI-SSDESRITKTR 240
                      +P  + T     V  ++Y  NE+ KF+  I++ +  +    E  +  + 
Sbjct: 270 TLTSVSTTSVNEPLCEKTPDYNIVDYKEYIVNEIDKFESIIKNTVTDVLCMKEKYMEHSF 329

Query: 241 TELDDLQQHIREAKSVIKDIDRCIQDQDIKMLRKXXXXXXXXXXXXXXXXXXXTYSESLA 300
             L  L++ +R  ++ I ++   +++  +  L                      +  SL 
Sbjct: 330 QTLSTLEKELRRIRTRIVELHYEVKENYLVELETHFNATDSESFISQLDEIIQEHLSSLE 389

Query: 301 SFEKRIGKCKVDLTTQKATVHKLETTIKLNEMIQDSQSNMCFLDRIREYKGLIYDFCXXX 360
             E RI   K  L  QK  +  +E+ +KL +++ DS+ NM F DR++EYKG+++DF    
Sbjct: 390 KLEVRIKNSKDVLARQKNALEDMESIVKLKQLVADSKKNMTFSDRLKEYKGILWDFLAII 449

Query: 361 XXXXXXXXXKRYF 373
                    +RYF
Sbjct: 450 IIAILIWILRRYF 462

 Score = 35.8 bits (81), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 11/65 (16%)

Query: 13 YNQDIRRPL----ARVPSISNNDLPRHSF-HSRCEVERNAMTQH------DYTSASAGKF 61
          +N+ ++ P+      VPS S ND+P      S      N++++       DYTSAS GKF
Sbjct: 24 HNRVLQPPMMTSCGTVPSFSLNDVPMGPLGKSSFSGTGNSISKPRQSDTPDYTSASTGKF 83

Query: 62 SECLF 66
          S+C+F
Sbjct: 84 SDCIF 88

>CAGL0G06314g complement(603668..605629) some similarities with
           sp|P39734 Saccharomyces cerevisiae YAL028w, hypothetical
           start
          Length = 653

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 77/193 (39%), Gaps = 6/193 (3%)

Query: 184 LKDPAVIRENCHSAQP--GNKSTVLPQQYFANELSKFDHYIR-DLMASISSDESRITKTR 240
           +K+  +I  N + +    G   T   QQ+  + L+K +  I+ DL + I  DE  +    
Sbjct: 461 IKNSEIINSNANDSNMFLGTNETDYYQQHINSRLTKLESQIKNDLKSVILKDELELKNNI 520

Query: 241 TELDDLQQHIREAKSVIKDIDRCIQDQDIKMLRKXXXXXXXXXXXXXXXXXXXTYSESLA 300
           T  D+L   ++  KS I  +   I ++ + +L+                       + L 
Sbjct: 521 TSFDNLTSDLQNLKSQILGLKNTIANEYLTVLKADFDENNPESFESQLRKTVEENVKHLE 580

Query: 301 SFEKRIGKCKVDLTTQKATVHKLETTIKLNEMIQDSQSNMCFLDRIREYKGLIYDFCXXX 360
             E ++ +C+  L  QK T+ K+E+ + L   +  S+ N        +Y+ ++YD     
Sbjct: 581 FLENKMSECQSQLVDQKETMRKMESLLYLENSLMVSKKNTGL---AYKYRYMLYDILTLG 637

Query: 361 XXXXXXXXXKRYF 373
                    K YF
Sbjct: 638 FLVLIGYYLKAYF 650

 Score = 30.0 bits (66), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 52/151 (34%), Gaps = 36/151 (23%)

Query: 52  DYTSASAGKFSECLFRS--------------------------CQSSHANGGRAVGLXX- 84
           DYTS + G FSEC+F +                           Q    NGG+A      
Sbjct: 209 DYTSVNTGAFSECMFNTELEKQYNNNLSKTTKTEKPTPNRLGDQQEEVGNGGQATLFTAD 268

Query: 85  ---XXXXXXIHNLERXXXXXXXXXXXXXXXXXXXXXXXXVHDRTRSF-EGHLKNDDKRLV 140
                    + N ER                         H   +SF + +  ND KRLV
Sbjct: 269 KFIKSPVKSLDNEERPELSNGQNQSKNQNQTQFHKEHKK-HRHQKSFSQSYGSNDQKRLV 327

Query: 141 HQFLNFDEETEAKSDIQVSLLSAQSSLYGAS 171
           +QFL    ++  KS    +L S  +S YG++
Sbjct: 328 NQFL----QSIEKSGNNSALSSNNASAYGST 354

>Scas_663.27
          Length = 559

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/150 (19%), Positives = 68/150 (45%), Gaps = 4/150 (2%)

Query: 208 QQYFANELSKFDHYIR-DLMASISSDESRITKTRTELDDLQQHIREAKSVIKDIDRCIQD 266
           Q +  N L++F+  ++ +L   +  DE+ +  T ++ D+L  H++  K+ I ++   I +
Sbjct: 392 QTHICNTLAEFERLLKQNLQTFVIKDEADLHGTLSKFDNLTFHLQNMKNRIDELYDVINE 451

Query: 267 QDIKMLRKXXXXXXXXXXXXXXXXXXXTYSESLASFEKRIGKCKVDLTTQKATVHKLETT 326
           + +  ++                       + L   E R+  C++ L  Q+ T+ +L+  
Sbjct: 452 KYLSKIKTAFNEDDESSFEFELRTSVEASIKQLEELENRMEYCQLKLQEQRETMRQLDNL 511

Query: 327 IKLNEMIQDSQSNMCFLDRIREYKGLIYDF 356
           I +   + +S+ N+     I  Y+ L++D 
Sbjct: 512 ILIENSLLESKKNV---KHIYSYRFLVFDI 538

>KLLA0A03938g 351240..352502 some similarities with sp|P39734
           Saccharomyces cerevisiae YAL028w, hypothetical start
          Length = 420

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%)

Query: 299 LASFEKRIGKCKVDLTTQKATVHKLETTIKLNEMIQDSQSNMCFLDRIREYKGLIYD 355
           L + E +    + +L  +K  + KLE  IKLN+MI D + NM   ++++EY G   D
Sbjct: 342 LQALEGKTVDFQNELEAKKLQLRKLENLIKLNDMIGDFKRNMKLSEKLKEYYGTFGD 398

>YAL028W (YAL028W) [40] chr1 (92903..94489) Protein of unknown
           function [1587 bp, 528 aa]
          Length = 528

 Score = 33.9 bits (76), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 25/128 (19%), Positives = 52/128 (40%), Gaps = 3/128 (2%)

Query: 220 HYIRDLMASISSDESRITKTRTELDDLQQHIREAKSVIKDIDRCIQDQDIKMLRKXXXXX 279
           H ++D    +  DE+ + K     D + + +R+ +S        +++  +  L++     
Sbjct: 378 HSLKD---EVLKDENDLVKNIANFDKIVKELRDLRSRTIGWKELVEEDYLMNLKQDFDKE 434

Query: 280 XXXXXXXXXXXXXXTYSESLASFEKRIGKCKVDLTTQKATVHKLETTIKLNEMIQDSQSN 339
                         T    L   EKR+  CK  L ++K  + K+E+ + L   +  S+ N
Sbjct: 435 NPESFEARLSDTINTNVAKLQDLEKRMASCKDRLASRKEVMRKMESLLSLENSLMISKKN 494

Query: 340 MCFLDRIR 347
           + F  + R
Sbjct: 495 VTFASKYR 502

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 2/32 (6%)

Query: 38  HSRCEVERNAMTQHDYTSASAGKFSECLFRSC 69
           H+R ++ R  +   DYTSAS   FS+C+F + 
Sbjct: 82  HARHKLHRQVIP--DYTSASTAMFSDCMFNAA 111

>Kwal_47.19184
          Length = 712

 Score = 30.4 bits (67), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 38/65 (58%), Gaps = 7/65 (10%)

Query: 208 QQYFANELSKFDHYIRDLMASISSDESRITKTRTELDDLQQHIREA-KSVIKDIDRCIQD 266
           QQ  +N LS+FD  I+DL+      +S++++ R  +  L Q I ++ ++  +DI++ I D
Sbjct: 280 QQKASNTLSQFDAEIQDLV------DSKLSEIRPNVTTLLQSISDSCQAYYRDINKAILD 333

Query: 267 QDIKM 271
            D  M
Sbjct: 334 VDCNM 338

>Scas_688.22
          Length = 1876

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 42/81 (51%), Gaps = 3/81 (3%)

Query: 188  AVIRENCHSAQPGNKSTVLPQQYFANELSKFDHYIRDLMASISSDESRITKTRTELDDLQ 247
            A + +NCH+A+   +S V       N+L+      ++L   ++  E+ I++ R+++D   
Sbjct: 1009 ATLEKNCHAAKTRLESLVGENGDLRNKLTLSRKESKNLGNQLNLKEAEISRLRSKMD--- 1065

Query: 248  QHIREAKSVIKDIDRCIQDQD 268
            QH +E  SV    D  I +Q+
Sbjct: 1066 QHQKEIISVSNQRDELINEQN 1086

>Scas_592.14
          Length = 549

 Score = 29.6 bits (65), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 28/59 (47%), Gaps = 3/59 (5%)

Query: 299 LASFEKRIGKCKVDLTTQKATVHKLETTIKLNEMIQDSQSNMCFLDRIREYKGLIYDFC 357
           L   E+R+      L  QK T+ ++E  I L   ++ SQ N  +   + + K ++YD  
Sbjct: 476 LQDLERRMESSGERLNEQKETMKRMENLINLENSLKLSQKNASW---VSKNKAIVYDLS 531

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.131    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,463,764
Number of extensions: 332057
Number of successful extensions: 1396
Number of sequences better than 10.0: 26
Number of HSP's gapped: 1410
Number of HSP's successfully gapped: 31
Length of query: 373
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 270
Effective length of database: 13,030,455
Effective search space: 3518222850
Effective search space used: 3518222850
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)