Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.70551555153278310.0
ADR354W1558153757620.0
Sklu_2164.51350135455800.0
KLLA0A03905g1550153955020.0
CAGL0F00671g1566155053510.0
YOR326W (MYO2)1574156053190.0
Scas_663.261567156052410.0
Scas_592.13*1419148833240.0
YAL029C (MYO4)147191631030.0
CAGL0G06336g1418102827910.0
YHR023W (MYO1)192875413241e-153
ACR068W180582113131e-152
Scas_688.22187680813011e-150
Kwal_23.55341907111212981e-150
KLLA0E11572g184877812701e-146
CAGL0J00693g188477412401e-142
KLLA0B12562g126077311761e-137
Kwal_26.7587125077511381e-132
YMR109W (MYO5)121972611331e-132
Scas_721.119123272711251e-131
AEL306C129278111071e-128
YKL129C (MYO3)127174311031e-127
CAGL0K07590g125275210961e-126
CAGL0K03487g121774410931e-126
ABR111C78972830.19
CAGL0D00924g1980113732.8
YLR342W (FKS1)187688733.4
KLLA0F17435g127198733.4
Sklu_2233.420579685.8
KLLA0D18799g46771696.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.7055
         (1532 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.7055                                                         3021   0.0  
ADR354W [2095] [Homologous to ScYOR326W (MYO2) - SH; ScYAL029C (...  2224   0.0  
Sklu_2164.5 YOR326W, Contig c2164 5497-9549                          2154   0.0  
KLLA0A03905g complement(345818..350470) similar to sp|P19524 Sac...  2123   0.0  
CAGL0F00671g complement(73893..78593) highly similar to sp|P1952...  2065   0.0  
YOR326W (MYO2) [5107] chr15 (925716..930440) Myosin heavy chain,...  2053   0.0  
Scas_663.26                                                          2023   0.0  
Scas_592.13*                                                         1285   0.0  
YAL029C (MYO4) [39] chr1 complement(87858..92273) Myosin heavy c...  1199   0.0  
CAGL0G06336g 607817..612073 similar to sp|P32492 Saccharomyces c...  1079   0.0  
YHR023W (MYO1) [2310] chr8 (151658..157444) Myosin heavy chain (...   514   e-153
ACR068W [1115] [Homologous to ScYHR023W (MYO1) - SH] complement(...   510   e-152
Scas_688.22                                                           505   e-150
Kwal_23.5534                                                          504   e-150
KLLA0E11572g complement(1018972..1024518) similar to sp|P08964 S...   493   e-146
CAGL0J00693g complement(61246..66900) similar to sp|P08964 Sacch...   482   e-142
KLLA0B12562g complement(1095953..1099735) similar to sp|Q04439 S...   457   e-137
Kwal_26.7587                                                          442   e-132
YMR109W (MYO5) [4066] chr13 (486586..490245) Myosin type I, may ...   441   e-132
Scas_721.119                                                          437   e-131
AEL306C [2199] [Homologous to ScYMR109W (MYO5) - SH; ScYKL129C (...   431   e-128
YKL129C (MYO3) [3137] chr11 complement(196350..200165) Myosin ty...   429   e-127
CAGL0K07590g 748352..752110 highly similar to sp|P36006 Saccharo...   426   e-126
CAGL0K03487g 322030..325683 highly similar to sp|Q04439 Saccharo...   425   e-126
ABR111C [703] [Homologous to ScYPR090W - SH; ScYPR089W - SH] (59...    37   0.19 
CAGL0D00924g 108341..114283 similar to sp|P25386 Saccharomyces c...    33   2.8  
YLR342W (FKS1) [3725] chr12 (809997..815627) Component of beta-1...    33   3.4  
KLLA0F17435g complement(1596081..1599896) similar to sp|Q04217 S...    33   3.4  
Sklu_2233.4 YMR052W, Contig c2233 9923-10540                           31   5.8  
KLLA0D18799g complement(1584644..1586047) some similarities with...    31   6.9  

>Kwal_26.7055
          Length = 1555

 Score = 3021 bits (7831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1464/1532 (95%), Positives = 1464/1532 (95%)

Query: 1    MSFEVGTRCWYPDKKEGWVGSEVTKFSQPXXXXXXXXXXXXXXXTVEIETETLNESQNEK 60
            MSFEVGTRCWYPDKKEGWVGSEVTKFSQP               TVEIETETLNESQNEK
Sbjct: 1    MSFEVGTRCWYPDKKEGWVGSEVTKFSQPEEGKFLLELKLENGETVEIETETLNESQNEK 60

Query: 61   LPLLRNPPILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQL 120
            LPLLRNPPILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQL
Sbjct: 61   LPLLRNPPILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQL 120

Query: 121  YSQDMIQAYAGRRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIMR 180
            YSQDMIQAYAGRRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIMR
Sbjct: 121  YSQDMIQAYAGRRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIMR 180

Query: 181  YFASVEQANADNASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGKYLEILF 240
            YFASVEQANADNASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGKYLEILF
Sbjct: 181  YFASVEQANADNASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGKYLEILF 240

Query: 241  DESTSIIGARIRTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKVEDYHYL 300
            DESTSIIGARIRTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKVEDYHYL
Sbjct: 241  DESTSIIGARIRTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKVEDYHYL 300

Query: 301  RQGGDYRIKGVDDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRNDAS 360
            RQGGDYRIKGVDDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRNDAS
Sbjct: 301  RQGGDYRIKGVDDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRNDAS 360

Query: 361  LSSDEPNLKIACDLLGIDASGFSKWITKKQITTRSEKIVSNLSFNQALVARDSVAKFIFS 420
            LSSDEPNLKIACDLLGIDASGFSKWITKKQITTRSEKIVSNLSFNQALVARDSVAKFIFS
Sbjct: 361  LSSDEPNLKIACDLLGIDASGFSKWITKKQITTRSEKIVSNLSFNQALVARDSVAKFIFS 420

Query: 421  ALFDWLVENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480
            ALFDWLVENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN
Sbjct: 421  ALFDWLVENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480

Query: 481  QHVFKLEQEEYVNEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 540
            QHVFKLEQEEYVNEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK
Sbjct: 481  QHVFKLEQEEYVNEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 540

Query: 541  LYQTLDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLEVLKASK 600
            LYQTLDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLEVLKASK
Sbjct: 541  LYQTLDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLEVLKASK 600

Query: 601  NDTLLSILDTIDKNAAALAEKQDANKKPGPARMVKKPTLGSMFKQSLIELMNTIDSTNVH 660
            NDTLLSILDTIDKNAAALAEKQDANKKPGPARMVKKPTLGSMFKQSLIELMNTIDSTNVH
Sbjct: 601  NDTLLSILDTIDKNAAALAEKQDANKKPGPARMVKKPTLGSMFKQSLIELMNTIDSTNVH 660

Query: 661  YIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILIPS 720
            YIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILIPS
Sbjct: 661  YIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILIPS 720

Query: 721  DNWTKIFTSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAGMLAYLEKLRSTKMH 780
            DNWTKIFTSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAGMLAYLEKLRSTKMH
Sbjct: 721  DNWTKIFTSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAGMLAYLEKLRSTKMH 780

Query: 781  NSCVLIQKKIKGVYYRKQYLAIKNAIHNVQAVIAGNYCRQSVDHEFKTLAAISLQTIFRG 840
            NSCVLIQKKIKGVYYRKQYLAIKNAIHNVQAVIAGNYCRQSVDHEFKTLAAISLQTIFRG
Sbjct: 781  NSCVLIQKKIKGVYYRKQYLAIKNAIHNVQAVIAGNYCRQSVDHEFKTLAAISLQTIFRG 840

Query: 841  VRQRKNATIALASIVRVQSLVRKQIAQKEVLEKRQSEAAVTIQKKIRGFVPRQSYNATRG 900
            VRQRKNATIALASIVRVQSLVRKQIAQKEVLEKRQSEAAVTIQKKIRGFVPRQSYNATRG
Sbjct: 841  VRQRKNATIALASIVRVQSLVRKQIAQKEVLEKRQSEAAVTIQKKIRGFVPRQSYNATRG 900

Query: 901  SSVKIQSLVRRXXXXXXXXXXXXXXXSVNHLQEVSYKLENKVIQLTQSLAEKVKENRDMT 960
            SSVKIQSLVRR               SVNHLQEVSYKLENKVIQLTQSLAEKVKENRDMT
Sbjct: 901  SSVKIQSLVRRKLAQKQLKQLKADAKSVNHLQEVSYKLENKVIQLTQSLAEKVKENRDMT 960

Query: 961  AKIQDLQKSLNESANIKSLLDAQKDDHSRDLQEQKTSHDAELANKKIELDNXXXXXXXXX 1020
            AKIQDLQKSLNESANIKSLLDAQKDDHSRDLQEQKTSHDAELANKKIELDN         
Sbjct: 961  AKIQDLQKSLNESANIKSLLDAQKDDHSRDLQEQKTSHDAELANKKIELDNAKAEVEAAK 1020

Query: 1021 XXXXDLLSQQEQLKADVRAKVEELNNVQQEFEDSRTQNSDLRNEVKSLKDEINRLQTSIR 1080
                DLLSQQEQLKADVRAKVEELNNVQQEFEDSRTQNSDLRNEVKSLKDEINRLQTSIR
Sbjct: 1021 KEIEDLLSQQEQLKADVRAKVEELNNVQQEFEDSRTQNSDLRNEVKSLKDEINRLQTSIR 1080

Query: 1081 SGANSNTILAHTPTKSRRFSAHSSLTDASPRQLNVISMNNGMEDDARSTASALSQINDEL 1140
            SGANSNTILAHTPTKSRRFSAHSSLTDASPRQLNVISMNNGMEDDARSTASALSQINDEL
Sbjct: 1081 SGANSNTILAHTPTKSRRFSAHSSLTDASPRQLNVISMNNGMEDDARSTASALSQINDEL 1140

Query: 1141 YKILEDTKSLNIEIVEGLLKGFKIPETGVAAELTRKEVLYPARIMIIVLSDMWRLGLTKQ 1200
            YKILEDTKSLNIEIVEGLLKGFKIPETGVAAELTRKEVLYPARIMIIVLSDMWRLGLTKQ
Sbjct: 1141 YKILEDTKSLNIEIVEGLLKGFKIPETGVAAELTRKEVLYPARIMIIVLSDMWRLGLTKQ 1200

Query: 1201 SESFLAEAMSTIQKLVSGLKGDDMICHGAFWLTNVRELYSFVVFAQESILNDDSYNSGLN 1260
            SESFLAEAMSTIQKLVSGLKGDDMICHGAFWLTNVRELYSFVVFAQESILNDDSYNSGLN
Sbjct: 1201 SESFLAEAMSTIQKLVSGLKGDDMICHGAFWLTNVRELYSFVVFAQESILNDDSYNSGLN 1260

Query: 1261 EDEYKEYMTLVTELKDDFESLSYNIYNIWLKKLQKDLEKKAVSAVVMSQSLPGFIANESS 1320
            EDEYKEYMTLVTELKDDFESLSYNIYNIWLKKLQKDLEKKAVSAVVMSQSLPGFIANESS
Sbjct: 1261 EDEYKEYMTLVTELKDDFESLSYNIYNIWLKKLQKDLEKKAVSAVVMSQSLPGFIANESS 1320

Query: 1321 QFLPKLFSQSNYYKMDDILTFFNNIYWSMKTYHVEQEVFREVIITLLRYVDSICFNDLIM 1380
            QFLPKLFSQSNYYKMDDILTFFNNIYWSMKTYHVEQEVFREVIITLLRYVDSICFNDLIM
Sbjct: 1321 QFLPKLFSQSNYYKMDDILTFFNNIYWSMKTYHVEQEVFREVIITLLRYVDSICFNDLIM 1380

Query: 1381 RRNFLSWKRGLQLNYNVTRLEEWCKSHHIPEGTDCLQHMXXXXXXXXXXXXXXDDIDIIW 1440
            RRNFLSWKRGLQLNYNVTRLEEWCKSHHIPEGTDCLQHM              DDIDIIW
Sbjct: 1381 RRNFLSWKRGLQLNYNVTRLEEWCKSHHIPEGTDCLQHMLQASKLLQLKKANLDDIDIIW 1440

Query: 1441 EICSSLKPAQIQKLITQYAVADYEVPIPQEILTFVANRVKXXXXXXXXXXXQTHSIDIFL 1500
            EICSSLKPAQIQKLITQYAVADYEVPIPQEILTFVANRVK           QTHSIDIFL
Sbjct: 1441 EICSSLKPAQIQKLITQYAVADYEVPIPQEILTFVANRVKSESSLSSNGKSQTHSIDIFL 1500

Query: 1501 PVENGPFKDPFNLIETRRFGKIEAYIPAWMNL 1532
            PVENGPFKDPFNLIETRRFGKIEAYIPAWMNL
Sbjct: 1501 PVENGPFKDPFNLIETRRFGKIEAYIPAWMNL 1532

>ADR354W [2095] [Homologous to ScYOR326W (MYO2) - SH; ScYAL029C (MYO4)
            - SH] complement(1328357..1333033) [4677 bp, 1558 aa]
          Length = 1558

 Score = 2224 bits (5762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1072/1537 (69%), Positives = 1256/1537 (81%), Gaps = 9/1537 (0%)

Query: 1    MSFEVGTRCWYPDKKEGWVGSEVTKFSQPXXXXXXXXXXXXXXXTVEIETETLNESQNEK 60
            MS+EVGTRCWYPDK++GW+G E+TK  +                 VEI   ++ E   E+
Sbjct: 1    MSYEVGTRCWYPDKEQGWIGGEITKH-RLVGDKYQLDLTLENGEVVEITAPSVEEGSCEE 59

Query: 61   LPLLRNPPILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQL 120
            LPLLRNPPILEA EDLTSLSYLNEPAVLHAIKARY QLNIYTYSGIVLIATNPFDRV+QL
Sbjct: 60   LPLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQL 119

Query: 121  YSQDMIQAYAGRRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIMR 180
            YSQDMIQAYAGRRRGELEPHLFAIA+EAY LMK+ KQNQTIVVSGESGAGKTVSAKYIMR
Sbjct: 120  YSQDMIQAYAGRRRGELEPHLFAIAEEAYSLMKNSKQNQTIVVSGESGAGKTVSAKYIMR 179

Query: 181  YFASVEQAN-ADNASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGKYLEIL 239
            YFA+VEQ+N   +  S HH++MSETE++ILATNPIMEAFGNAKT+RNDNSSRFGKYLEIL
Sbjct: 180  YFATVEQSNLVGSGGSMHHIEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEIL 239

Query: 240  FDESTSIIGARIRTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKVEDYHY 299
            FD+  SIIGARIRTYLLERSRLVFQP  ERNYHIFYQL+ GL E  K+EL L  VE+YHY
Sbjct: 240  FDKDISIIGARIRTYLLERSRLVFQPPSERNYHIFYQLLAGLPEETKKELKLGGVEEYHY 299

Query: 300  LRQGGDYRIKGVDDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRNDA 359
            + QGG   I+GVDD  EY +T  AL +V  ++ TQ  LFK+LAALLHIGNI+VKKTRNDA
Sbjct: 300  MNQGGASEIQGVDDREEYAITTKALSLVDITERTQTALFKVLAALLHIGNIDVKKTRNDA 359

Query: 360  SLSSDEPNLKIACDLLGIDASGFSKWITKKQITTRSEKIVSNLSFNQALVARDSVAKFIF 419
            S+S+ +P+L+IAC+LLGIDA  F+KWITKKQITTRSEKIVSNL++ QA+VARDSVAKFI+
Sbjct: 360  SVSATDPSLEIACELLGIDAYNFAKWITKKQITTRSEKIVSNLNYGQAVVARDSVAKFIY 419

Query: 420  SALFDWLVENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEF 479
            SALFDWLVENIN VLCNP V ++I+SFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEF
Sbjct: 420  SALFDWLVENINNVLCNPAVINEIASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEF 479

Query: 480  NQHVFKLEQEEYVNEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQ 539
            NQHVFKLEQEEYV E+I+WSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDE+WTQ
Sbjct: 480  NQHVFKLEQEEYVKEEIQWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQ 539

Query: 540  KLYQTLDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLEVLKAS 599
            KLYQTLDKPPTN+VFSKPRFGQTKFVVSHYA DVAYDV GFIEKNRDTVSDGHLEVLK S
Sbjct: 540  KLYQTLDKPPTNTVFSKPRFGQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLKGS 599

Query: 600  KNDTLLSILDTIDKNAAALAEKQDANKKPGP-ARMV-KKPTLGSMFKQSLIELMNTIDST 657
             N+TLL+IL+TID+NAA LAEK ++ KKPGP  R V +KPTLGS+FKQSL+ELM+TI+ST
Sbjct: 600  TNETLLAILETIDRNAAKLAEKLESQKKPGPTTRTVNRKPTLGSLFKQSLVELMSTINST 659

Query: 658  NVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHIL 717
            NVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFP+RWTY+EF LRYHIL
Sbjct: 660  NVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPTRWTYDEFALRYHIL 719

Query: 718  IPSDNWTKIFTSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAGMLAYLEKLRST 777
            +PS NWTKIF +  +E++I  LCK IL  TV D  KYQLGNTKIFFKAGMLA+LEK R+ 
Sbjct: 720  VPSTNWTKIFATGTTEEEINQLCKNILDTTVTDKEKYQLGNTKIFFKAGMLAFLEKKRTD 779

Query: 778  KMHNSCVLIQKKIKGVYYRKQYLAIKNAIHNVQAVIAGNYCRQSVDHEFKTLAAISLQTI 837
            K+++S  +IQKKIKG+YYR++YL I NAI    +V  GN  R  +D EFKT AAI++Q++
Sbjct: 780  KLNSSSTMIQKKIKGIYYRRRYLEITNAIKRTHSVAKGNLLRARIDLEFKTWAAITIQSL 839

Query: 838  FRGVRQRKNATIALASIVRVQSLVRKQIAQKEVLEKRQSEAAVTIQKKIRGFVPRQSYNA 897
            +RG   R++    L SI+R QSL+R+ +A+KE+  + +++AA+TIQK IR F PR SY  
Sbjct: 840  YRGSLIRRDTIHLLDSIIRTQSLLRRSLARKELRARLETDAAITIQKNIRAFKPRTSYIT 899

Query: 898  TRGSSVKIQSLVRRXXXXXXXXXXXXXXXSVNHLQEVSYKLENKVIQLTQSLAEKVKENR 957
             R S++ +QSLVRR               SV+HL+EVSYKLENKVI+LT+SLA KVKEN+
Sbjct: 900  NRRSTIVVQSLVRRRFAKRKLETLKQEAKSVSHLKEVSYKLENKVIELTESLAAKVKENK 959

Query: 958  DMTAKIQDLQKSLNESANIKSLLDAQKDDHSRDLQEQKTSHDAELANKKIELDNXXXXXX 1017
            D+ ++I++LQ SLNESANI+ LL  +++++ + + +QK +H A        L        
Sbjct: 960  DLNSRIKELQLSLNESANIRELLKTKQEEYRKSIDQQKDTHAAAYEEVTGRLTLAMKEVD 1019

Query: 1018 XXXXXXXDLLSQQEQLKADVRAKVEELNNVQQEFEDSRTQNSDLRNEVKSLKDEINRLQT 1077
                    L S+QE LK +V+AK+EEL+ V+Q+  DSRTQNSDL NEV SLK+EI RL  
Sbjct: 1020 DARQEIDQLKSKQEDLKLEVKAKIEELSKVRQDLSDSRTQNSDLSNEVSSLKEEIARLHN 1079

Query: 1078 SIRSGANSNTILAHTPTKSRRFSAHSSLTD-ASPRQLNVISMNNG-MEDDARSTASALSQ 1135
            +IR+   + T+   +PT+S+R S++S L +  SP+Q NV+S+NNG ME++ RS  S LSQ
Sbjct: 1080 AIRNAPATGTL---SPTRSKRISSYSGLDNIGSPKQWNVVSLNNGLMEEETRSIMSQLSQ 1136

Query: 1136 INDELYKILEDTKSLNIEIVEGLLKGFKIPETGVAAELTRKEVLYPARIMIIVLSDMWRL 1195
            INDELYK+L D + L  EIVEGLLK  KIP+ G AA LTRKEVLYPAR++II+LSDMWRL
Sbjct: 1137 INDELYKLLNDDRPLTSEIVEGLLKSGKIPQPGFAANLTRKEVLYPARVLIIILSDMWRL 1196

Query: 1196 GLTKQSESFLAEAMSTIQKLVSGLKGDDMICHGAFWLTNVRELYSFVVFAQESILNDDSY 1255
            GLT+QSE FLAE +STIQ LV+ LKGD++I +GAFWLTNVRELYSF ++A +SILND++Y
Sbjct: 1197 GLTEQSERFLAEVLSTIQTLVTNLKGDNVIINGAFWLTNVRELYSFAIYAHDSILNDNAY 1256

Query: 1256 NSGLNEDEYKEYMTLVTELKDDFESLSYNIYNIWLKKLQKDLEKKAVSAVVMSQSLPGFI 1315
               LNEDEYK+Y+TLV+ LKDDFESLSYNIYNIWLKKLQK+LEK+AVSAVVMSQSLPGFI
Sbjct: 1257 IKDLNEDEYKQYVTLVSVLKDDFESLSYNIYNIWLKKLQKELEKRAVSAVVMSQSLPGFI 1316

Query: 1316 ANESSQFLPKLFSQSNYYKMDDILTFFNNIYWSMKTYHVEQEVFREVIITLLRYVDSICF 1375
              ESS FLPK+FS S+ YKMDDILTFFN IYWSMK YHVE EV+REVI++LLRYVD+ICF
Sbjct: 1317 VPESSAFLPKIFSSSSSYKMDDILTFFNTIYWSMKAYHVETEVYREVIMSLLRYVDAICF 1376

Query: 1376 NDLIMRRNFLSWKRGLQLNYNVTRLEEWCKSHHIPEGTDCLQHMXXXXXXXXXXXXXXDD 1435
            NDLIM+RNFLSWKRGLQLNYNVTRLEEWCK HHIPEG+DCL+HM              +D
Sbjct: 1377 NDLIMKRNFLSWKRGLQLNYNVTRLEEWCKVHHIPEGSDCLEHMLQASKLLQLKKANMED 1436

Query: 1436 IDIIWEICSSLKPAQIQKLITQYAVADYEVPIPQEILTFVANRVKXXXXXXXXXXXQTHS 1495
            I+IIWEICSSLKPAQIQKLI+QY+ ADYEVPIPQEIL+FVA+RVK            +HS
Sbjct: 1437 INIIWEICSSLKPAQIQKLISQYSAADYEVPIPQEILSFVADRVKKESALSNDGKSASHS 1496

Query: 1496 IDIFLPVENGPFKDPFNLIETRRFGKIEAYIPAWMNL 1532
             DIFLPV  G F DPF+ IE R   KIEA+IPAW+NL
Sbjct: 1497 SDIFLPVATGSFADPFSQIEPREINKIEAHIPAWLNL 1533

>Sklu_2164.5 YOR326W, Contig c2164 5497-9549
          Length = 1350

 Score = 2154 bits (5580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1048/1354 (77%), Positives = 1190/1354 (87%), Gaps = 7/1354 (0%)

Query: 1    MSFEVGTRCWYPDKKEGWVGSEVTKFSQPXXXXXXXXXXXXXXXTVEIETETLNESQNEK 60
            MS+EVGTRCWYPDK++GW+G E+TK +                  VEIE+ETL+E+++++
Sbjct: 1    MSYEVGTRCWYPDKQQGWIGGEITKHTN-LSNKHQLELTLEDNQIVEIESETLDETKDDR 59

Query: 61   LPLLRNPPILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQL 120
            LPLLRNPPILEA EDLTSLSYLNEPAVLHAIKARY QLNIYTYSGIVLIATNPFDRVEQL
Sbjct: 60   LPLLRNPPILEATEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVEQL 119

Query: 121  YSQDMIQAYAGRRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIMR 180
            YSQDMIQAYAG+RRGELEPHLFAIA+EAYRLMK+DKQNQTIVVSGESGAGKTVSAKYIMR
Sbjct: 120  YSQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMR 179

Query: 181  YFASVEQANADNASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGKYLEILF 240
            YFASVEQ N +NA   H+L+MSETE++ILATNPIMEAFGNAKT+RNDNSSRFGKYLEILF
Sbjct: 180  YFASVEQNNEENAH--HNLEMSETEKKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 237

Query: 241  DESTSIIGARIRTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKVEDYHYL 300
            D+  SIIGARIRTYLLERSRLVFQP+ ERNYHIFYQL+ GL+  EK +L LT VEDYHY+
Sbjct: 238  DKEISIIGARIRTYLLERSRLVFQPKSERNYHIFYQLLAGLTNEEKSQLKLTGVEDYHYM 297

Query: 301  RQGGDYRIKGVDDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRNDAS 360
             QGG+ +IKG+DDA EYQ TV+AL +VG S+DTQ+QLFKILAALLHIGN+E+KKTRNDAS
Sbjct: 298  NQGGEAQIKGIDDAEEYQTTVEALSLVGISKDTQYQLFKILAALLHIGNVEIKKTRNDAS 357

Query: 361  LSSDEPNLKIACDLLGIDASGFSKWITKKQITTRSEKIVSNLSFNQALVARDSVAKFIFS 420
            LSSDEPNL IAC+LLGID+  F+KWITKKQI TRSEKIVSNL++NQALVARDSVAKFI+S
Sbjct: 358  LSSDEPNLAIACELLGIDSFNFAKWITKKQINTRSEKIVSNLNYNQALVARDSVAKFIYS 417

Query: 421  ALFDWLVENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480
            ALF+WLV+NINTVLCNP+V+ +I+SFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN
Sbjct: 418  ALFEWLVDNINTVLCNPEVASEINSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 477

Query: 481  QHVFKLEQEEYVNEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 540
            QHVFKLEQEEYV E+IEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDE+WTQK
Sbjct: 478  QHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDETWTQK 537

Query: 541  LYQTLDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLEVLKASK 600
            LYQTLDKPPTN+VFSKPRFGQTKFVVSHYALDV+YDV GFIEKNRDTVSDGHLEVLKAS 
Sbjct: 538  LYQTLDKPPTNTVFSKPRFGQTKFVVSHYALDVSYDVEGFIEKNRDTVSDGHLEVLKAST 597

Query: 601  NDTLLSILDTIDKNAAALAEKQDANKKPGPARMV-KKPTLGSMFKQSLIELMNTIDSTNV 659
            N+TLLSIL+T+DK+AA LAEK+  NKKPGPARMV +KPTLGS+FKQSLIELM TI+STNV
Sbjct: 598  NETLLSILETLDKHAAKLAEKEQVNKKPGPARMVNRKPTLGSIFKQSLIELMGTINSTNV 657

Query: 660  HYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILIP 719
            HYIRCIKPNE KEAW FDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILIP
Sbjct: 658  HYIRCIKPNEVKEAWVFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILIP 717

Query: 720  SDNWTKIFTSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAGMLAYLEKLRSTKM 779
            S++W+K+F+S+ +E+DIR+LC+ ILGA V+D  KYQLGNTKIFFKAGMLAYLEKLRS ++
Sbjct: 718  SEHWSKMFSSDTTEEDIRDLCRTILGAIVEDKQKYQLGNTKIFFKAGMLAYLEKLRSDRL 777

Query: 780  HNSCVLIQKKIKGVYYRKQYLAIKNAIHNVQAVIAGNYCRQSVDHEFKTLAAISLQTIFR 839
            HNS VLIQKK+K VYYRK+YLAI ++I N  +   G   RQ VD EFKT AAI +Q++ R
Sbjct: 778  HNSSVLIQKKVKAVYYRKKYLAIISSIRNFHSRSEGFLTRQKVDLEFKTQAAILIQSMVR 837

Query: 840  GVRQRKNATIALASIVRVQSLVRKQIAQKEVLEKRQSEAAVTIQKKIRGFVPRQSYNATR 899
                R      L++I R+QSLVRKQ+AQKE+L++RQ +AAV+IQKKIR F PRQS+N TR
Sbjct: 838  STSTRNKTISLLSAITRLQSLVRKQLAQKELLQRRQRDAAVSIQKKIRAFEPRQSFNTTR 897

Query: 900  GSSVKIQSLVRRXXXXXXXXXXXXXXXSVNHLQEVSYKLENKVIQLTQSLAEKVKENRDM 959
             S+V +QSLVR+               SVNHL+EVSYKLENKVIQLT+SLAEKVKEN+ M
Sbjct: 898  RSTVVVQSLVRKKFAQKKLKDLKTEAKSVNHLKEVSYKLENKVIQLTESLAEKVKENKGM 957

Query: 960  TAKIQDLQKSLNESANIKSLLDAQKDDHSRDLQEQKTSHDAELANKKIELDNXXXXXXXX 1019
            TA+IQ+LQ+SLNESANIK LL++QKD+HS+ LQ+QK +HD +    + +L N        
Sbjct: 958  TARIQELQQSLNESANIKELLNSQKDEHSKVLQQQKDAHDVQFNEVQEKLVNAKKEVEEA 1017

Query: 1020 XXXXXDLLSQQEQLKADVRAKVEELNNVQQEFEDSRTQNSDLRNEVKSLKDEINRLQTSI 1079
                  L+++Q++LKA+VR K+EELN  ++ F + +TQNSDL+NEVKSLKDEI RLQ ++
Sbjct: 1018 KEEIEQLIAKQDELKAEVRTKIEELNKAKKTFTEFQTQNSDLKNEVKSLKDEIARLQAAV 1077

Query: 1080 RSGANSNTILAHTPTKSRRFSAHSSLTDA-SPRQLNVISMNN-GMEDDARSTASALSQIN 1137
            RS   +++ +  TPT SRRFSAHSS+ D  SPRQLNVISMNN G+EDDARSTASALSQIN
Sbjct: 1078 RS-GVTSSTITSTPTASRRFSAHSSVADGTSPRQLNVISMNNGGIEDDARSTASALSQIN 1136

Query: 1138 DELYKILEDTKSLNIEIVEGLLKGFKIPETGVAAELTRKEVLYPARIMIIVLSDMWRLGL 1197
            DELYK+LEDTKSLN EIVEGLLKGFKIPETGVA ELTRKEVLYPARI+IIVLSDMWRLGL
Sbjct: 1137 DELYKLLEDTKSLNTEIVEGLLKGFKIPETGVAVELTRKEVLYPARILIIVLSDMWRLGL 1196

Query: 1198 TKQSESFLAEAMSTIQKLVSGLKGDDMICHGAFWLTNVRELYSFVVFAQESILNDDSYNS 1257
            TKQSESFLAE +STIQKLV+ LKGDDMI HGAFWLTNVRELYSFVVFAQESILNDDSYN+
Sbjct: 1197 TKQSESFLAEVLSTIQKLVTNLKGDDMILHGAFWLTNVRELYSFVVFAQESILNDDSYNN 1256

Query: 1258 GLNEDEYKEYMTLVTELKDDFESLSYNIYNIWLKKLQKDLEKKAVSAVVMSQSLPGFIAN 1317
            GLNEDEYKEY+TLVTELKDDFESLSYNIYNIWLKKLQKDLE+KA+SAVVMSQSLPGFIA 
Sbjct: 1257 GLNEDEYKEYVTLVTELKDDFESLSYNIYNIWLKKLQKDLERKAISAVVMSQSLPGFIAP 1316

Query: 1318 ESSQFLPKLFSQSNYYKMDDILTFFNNIYWSMKT 1351
            ESS FLPKLFSQS++YKMDDI+TFFNNIYWS +T
Sbjct: 1317 ESSPFLPKLFSQSSHYKMDDIVTFFNNIYWSRET 1350

>KLLA0A03905g complement(345818..350470) similar to sp|P19524
            Saccharomyces cerevisiae YOR326w MYO2 myosin heavy chain,
            start by similarity
          Length = 1550

 Score = 2123 bits (5502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1022/1539 (66%), Positives = 1244/1539 (80%), Gaps = 17/1539 (1%)

Query: 1    MSFEVGTRCWYPDKKEGWVGSEVTKFSQPXXXXXXXXXXXXXXXTVEIETETLNESQNEK 60
            M +EVGTRCWYP K +GW+G+EVTK +                  VE+   +L+E++   
Sbjct: 1    MPYEVGTRCWYPSKDQGWIGAEVTKHTL-QGDSYNLELTLEDGQKVELLVSSLDETKEPS 59

Query: 61   LPLLRNPPILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQL 120
            LPLLRNPPILE  EDLTSLSYLNEPAVLHAIKARY QLNIYTYSGIVLIATNPFDRV+QL
Sbjct: 60   LPLLRNPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTYSGIVLIATNPFDRVDQL 119

Query: 121  YSQDMIQAYAGRRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIMR 180
            YSQ+MIQAYAG+ RGELEPHLFAIA+EAYRLMK   QNQTI+VSGESGAGKTVSAKYIMR
Sbjct: 120  YSQEMIQAYAGKLRGELEPHLFAIAEEAYRLMKTTDQNQTIIVSGESGAGKTVSAKYIMR 179

Query: 181  YFASVEQANADNASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGKYLEILF 240
            YFASVE+ N +NA   H+L+MSETE++ILATNPIMEAFGNAKT RNDNSSRFGKYLEILF
Sbjct: 180  YFASVEENNEENAH--HNLEMSETEKKILATNPIMEAFGNAKTIRNDNSSRFGKYLEILF 237

Query: 241  DESTSIIGARIRTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKVEDYHYL 300
            D+ TSIIGAR+RTYLLERSRLVFQP+ ERNYHIFYQ++ GLS+ EK +L LT ++DYHY+
Sbjct: 238  DDDTSIIGARVRTYLLERSRLVFQPKTERNYHIFYQILSGLSDDEKSQLKLTDIQDYHYM 297

Query: 301  RQGGDYRIKGVDDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRNDAS 360
             QGGD  I+GVDDA+EY  TV+AL +VG S+DTQ QLFKILAALLHIGNIEVKK RNDAS
Sbjct: 298  NQGGDSHIEGVDDASEYGDTVEALSLVGISKDTQFQLFKILAALLHIGNIEVKKVRNDAS 357

Query: 361  LSSDEPNLKIACDLLGIDASGFSKWITKKQITTRSEKIVSNLSFNQALVARDSVAKFIFS 420
            LSSDEPNL+IA DLLGIDA  F+KW+TKKQI TRSEKIVS+L ++QA+V+RDSVAKFI+S
Sbjct: 358  LSSDEPNLQIAADLLGIDAFDFAKWVTKKQIVTRSEKIVSSLPYHQAIVSRDSVAKFIYS 417

Query: 421  ALFDWLVENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480
            ALFDWLV+NINTVLCNP+V  +I +FIGVLDIYGFEHF+KNSFEQFCINYANEKLQQEFN
Sbjct: 418  ALFDWLVDNINTVLCNPEVVSEIYTFIGVLDIYGFEHFQKNSFEQFCINYANEKLQQEFN 477

Query: 481  QHVFKLEQEEYVNEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 540
            QHVFKLEQEEYV EQIEWSFIEFNDNQPCIDLIENK+GILSLLDEESRLPAG+DE WT K
Sbjct: 478  QHVFKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKVGILSLLDEESRLPAGTDEGWTHK 537

Query: 541  LYQTLDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLEVLKASK 600
            LY+TL+KPPTN VFSKPRFGQT+F+VSHYALDV YDV GFIEKNRDTVSDGHLEVLKAS 
Sbjct: 538  LYETLNKPPTNEVFSKPRFGQTQFIVSHYALDVTYDVDGFIEKNRDTVSDGHLEVLKASN 597

Query: 601  NDTLLSILDTIDKNAAALAE----KQDANKKPGPA--RMVKKPTLGSMFKQSLIELMNTI 654
            N+TLLSIL+T+DKNA  LAE    KQ++ KKPGPA  ++V+KPTLGSMFKQSLI+LM TI
Sbjct: 598  NETLLSILETVDKNAEKLAEKQAQKQESQKKPGPASRKIVRKPTLGSMFKQSLIDLMETI 657

Query: 655  DSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRY 714
            +STNVHYIRCIKPNE+KEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTY EF LRY
Sbjct: 658  NSTNVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYTEFALRY 717

Query: 715  HILIPSDNWTKIFTSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAGMLAYLEKL 774
            HIL+PS+ W+ I  S+ SE+D++NLCK+IL  T+DD+ KYQ GNTKIFFKAGMLA+LEKL
Sbjct: 718  HILVPSELWSNILLSDPSEEDVKNLCKEILKRTMDDTAKYQAGNTKIFFKAGMLAHLEKL 777

Query: 775  RSTKMHNSCVLIQKKIKGVYYRKQYLAIKNAIHNVQAVIAGNYCRQSVDHEFKTLAAISL 834
            R+ K+ +S V+IQKKIKG++YRK YL   +AI  +QA ++G   R   ++EFK  AA+ +
Sbjct: 778  RTDKLFSSSVMIQKKIKGLHYRKTYLRTVDAIKRLQANVSGKIIRLRTENEFKNNAALLI 837

Query: 835  QTIFRGVRQRKNATIALASIVRVQSLVRKQIAQKEVLEKRQSEAAVTIQKKIRGFVPRQS 894
            Q+ +RG+  R N +  + SI+R+QS+ RKQI  KE+LE+R+ +AAVTIQK +R F PR+S
Sbjct: 838  QSAYRGISVRDNVSSIIISIIRIQSMARKQITCKELLERRRGDAAVTIQKSVRSFQPRKS 897

Query: 895  YNATRGSSVKIQSLVRRXXXXXXXXXXXXXXXSVNHLQEVSYKLENKVIQLTQSLAEKVK 954
            +   +  +V IQS +R+               SVNHLQEVSYKLENKVI+LT+SLA KVK
Sbjct: 898  FLHEKKGTVVIQSFIRKHYAQRKLKQLKSEAKSVNHLQEVSYKLENKVIELTESLASKVK 957

Query: 955  ENRDMTAKIQDLQKSLNESANIKSLLDAQKDDHSRDLQEQKTSHDAELANKKIELDNXXX 1014
            EN+++ +++++LQKSLNES NIKS L+ +K+ H++ L +QK+ H+ E      +L     
Sbjct: 958  ENKELVSRLENLQKSLNESENIKSSLEEEKEGHTKALADQKSIHEEEYGKVNDQLIAAKE 1017

Query: 1015 XXXXXXXXXXDLLSQQEQLKADVRAKVEELNNVQQEFEDSRTQNSDLRNEVKSLKDEINR 1074
                      +LL++Q+ LK ++ + +EEL + + E   S+++N+DL+ EV SLK+E+ R
Sbjct: 1018 EIISAKAEVDELLNKQKNLKDEIASTLEELTSARDELLTSQSENADLKKEVFSLKEEVAR 1077

Query: 1075 LQTSIRSGANSNTILAHTPTKSRRFSAHSSLTD-ASPRQLNVISMNNGMEDDARSTASAL 1133
            LQ+S+RSG      +  TP K+RRFSA+S+L D +SP+QLNV+S+NN    +    ++ +
Sbjct: 1078 LQSSMRSGVYVGGGINATPVKNRRFSANSTLNDGSSPKQLNVVSINNNF--NTEDVSALM 1135

Query: 1134 SQINDELYKILEDTKSLNIEIVEGLLKGFKIPETGVAAELTRKEVLYPARIMIIVLSDMW 1193
            SQINDELYK+ ED++SLN EI+EGLLKG K+P TGV+  LTRKEVLYP+R++II+LSDMW
Sbjct: 1136 SQINDELYKMFEDSRSLNTEIIEGLLKGGKVPPTGVSVNLTRKEVLYPSRVLIIILSDMW 1195

Query: 1194 RLGLTKQSESFLAEAMSTIQKLVSGLKGDDMICHGAFWLTNVRELYSFVVFAQESILNDD 1253
            RLGLT QSE+FLAE +  IQK++S LK D MI HGAFW TNVREL+SFVV+A ESI  D+
Sbjct: 1196 RLGLTSQSETFLAEVLDAIQKIISNLKPDVMIEHGAFWYTNVRELHSFVVYAYESITTDE 1255

Query: 1254 SYNSGLNEDEYKEYMTLVTELKDDFESLSYNIYNIWLKKLQKDLEKKAVSAVVMSQSLPG 1313
            +YNSG+NE+EY  Y+ LV ELKDDFE+LS+N+YN+W+KKL+K+LEK AV AVV+SQSLPG
Sbjct: 1256 TYNSGMNEEEYNRYVNLVKELKDDFEALSFNVYNLWMKKLRKNLEKIAVPAVVVSQSLPG 1315

Query: 1314 FIANESSQFLPKLFSQSNYYKMDDILTFFNNIYWSMKTYHVEQEVFREVIITLLRYVDSI 1373
            F+  E SQFL K    S+ YKMDD+LTFFNNIYW+MK+Y +E EVF +VI  LL+ +D++
Sbjct: 1316 FVVPEPSQFLQKFLQNSSTYKMDDVLTFFNNIYWAMKSYDIEMEVFEDVITNLLKLLDAL 1375

Query: 1374 CFNDLIMRRNFLSWKRGLQLNYNVTRLEEWCKSHHIPEGTDCLQHMXXXXXXXXXXXXXX 1433
            CFNDLI+R+NFLSWKRGLQLNYNVTR+EEWCKSHHI E + CLQH+              
Sbjct: 1376 CFNDLILRKNFLSWKRGLQLNYNVTRIEEWCKSHHISEVSVCLQHILQAAKLLQLKKRIV 1435

Query: 1434 DDIDIIWEICSSLKPAQIQKLITQYAVADYEVPIPQEILTFVANRVKXXXXXXXXXXXQT 1493
             DIDIIW+IC+ LKP Q+++LITQY+VADYE PI  EIL +VA +VK           + 
Sbjct: 1436 ADIDIIWDICNCLKPIQLKQLITQYSVADYEEPIAPEILQYVAEKVK-----NDTSKAEV 1490

Query: 1494 HSIDIFLPVENGPFKDPFNLIETRRFGKIEAYIPAWMNL 1532
             + D+FLPV+NGPF+DP+  +E R FGKIEAYIPAW+NL
Sbjct: 1491 GNNDVFLPVDNGPFEDPYQKVEVRAFGKIEAYIPAWLNL 1529

>CAGL0F00671g complement(73893..78593) highly similar to sp|P19524
            Saccharomyces cerevisiae YOR326w MYO2 or sp|P32492
            Saccharomyces cerevisiae YAL029c MYO4, start by
            similarity
          Length = 1566

 Score = 2065 bits (5351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1011/1550 (65%), Positives = 1213/1550 (78%), Gaps = 22/1550 (1%)

Query: 1    MSFEVGTRCWYPDKKEGWVGSEVTKFSQPXXXXXXXXXXXXXXXTVEIETETLNESQNEK 60
            MSFEVGTRCWYP K+ GW+G+EVTK +                 +V IET+ L +  +E 
Sbjct: 1    MSFEVGTRCWYPSKELGWIGAEVTK-NDLKDGTYHMELALEDGKSVNIETKDLTDESDES 59

Query: 61   LPLLRNPPILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQL 120
            LPLLRNPPILEA EDLTSLSYLNEPAVLHAIK RY QLNIYTYSGIVLIATNPFDRV+QL
Sbjct: 60   LPLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQL 119

Query: 121  YSQDMIQAYAGRRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIMR 180
            YSQDMIQAYAG++RGE+EPHLFAIA+EAYRLMK +K+NQTIVVSGESGAGKTVSAKYIMR
Sbjct: 120  YSQDMIQAYAGKQRGEMEPHLFAIAEEAYRLMKDNKENQTIVVSGESGAGKTVSAKYIMR 179

Query: 181  YFASVEQANADNASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGKYLEILF 240
            YFASVE+ N+   +  H ++MSETE++ILATNPIMEAFGNAKT+RNDNSSRFGKYLEILF
Sbjct: 180  YFASVEEENS--MTVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 237

Query: 241  DESTSIIGARIRTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKVEDYHYL 300
            D+ TSIIGA+IRTYLLERSRLV+QP+ ERNYHIFYQ++ GLS  EK ELHL   EDY+Y+
Sbjct: 238  DKDTSIIGAKIRTYLLERSRLVYQPETERNYHIFYQMMAGLSPKEKAELHLKGAEDYYYM 297

Query: 301  RQGGDYRIKGVDDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRNDAS 360
             QGGD +I+GVDD  EY  TVDAL +VG S +TQ  +FKILAALLHIGNIE+KKTRNDAS
Sbjct: 298  NQGGDVKIEGVDDKQEYNTTVDALTLVGISNETQQHIFKILAALLHIGNIEIKKTRNDAS 357

Query: 361  LSSDEPNLKIACDLLGIDASGFSKWITKKQITTRSEKIVSNLSFNQALVARDSVAKFIFS 420
            LSSDE NLKIAC+LLGID+  F+KWITKKQI TRSEKIVSNL+++QALVARDSVAKFI+S
Sbjct: 358  LSSDEENLKIACELLGIDSFNFAKWITKKQIITRSEKIVSNLNYSQALVARDSVAKFIYS 417

Query: 421  ALFDWLVENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480
            ALFDWLVENINTVLCNP V D+++SFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN
Sbjct: 418  ALFDWLVENINTVLCNPAVVDKVASFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 477

Query: 481  QHVFKLEQEEYVNEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 540
            QHVFKLEQEEYV EQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK
Sbjct: 478  QHVFKLEQEEYVKEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 537

Query: 541  LYQTLDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLEVLKASK 600
            LYQTLDKPPTN VFSKPRFGQTKFVVSHYALDVAYDV GFIEKNRDTVSDGHLEVLKAS 
Sbjct: 538  LYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKAST 597

Query: 601  NDTLLSILDTIDKNAAAL-----AEKQDANKKPGPARMV-KKPTLGSMFKQSLIELMNTI 654
            N+TL++ILDT+++NA  L     AE++    KPGP R V +KPTLGSMFKQSLIELM TI
Sbjct: 598  NETLINILDTLERNANKLEDAKKAEQESKPAKPGPMRTVQRKPTLGSMFKQSLIELMTTI 657

Query: 655  DSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRY 714
             STN HYIRCIKPN +KEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWT+NEF+LRY
Sbjct: 658  RSTNAHYIRCIKPNNDKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFNEFILRY 717

Query: 715  HILIPSDNWTKIFT-SEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAGMLAYLEK 773
            +IL+P+  W+ IFT  + +EDD+  LC +IL  TV +  KYQ+GNTKIFFKAGMLA+LEK
Sbjct: 718  YILLPASEWSFIFTKKDMTEDDVIGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLAFLEK 777

Query: 774  LRSTKMHNSCVLIQKKIKGVYYRKQYLAIKNAIHNVQAVIAGNYCRQSVDHEFKTLAAIS 833
            LRS KMH S VLIQK I+  YYR+++L I +AI ++Q  + G   R  +D EFK  AA  
Sbjct: 778  LRSDKMHISSVLIQKNIRAKYYRREFLRIMSAITSLQQRVKGEVRRSIIDREFKNKAATE 837

Query: 834  LQTIFRGVRQRKNATIALASIVRVQSLVRKQIAQKEVLEKRQSEAAVTIQKKIRGFVPRQ 893
            +Q++ RG R+R      ++SI  +Q  VRK++ +K    + +++AAV IQ K+R F PR+
Sbjct: 838  IQSLLRGYRRRSQILSIISSIRCIQLKVRKELNRKHAQVQHETDAAVAIQSKVRSFKPRK 897

Query: 894  SYNATRGSSVKIQSLVRRXXXXXXXXXXXXXXXSVNHLQEVSYKLENKVIQLTQSLAEKV 953
            ++   R  +V +QSL+RR               SVNHL+EVSYKLENKV++LTQ+LA KV
Sbjct: 898  AFLEDRRKTVVVQSLIRRRFAQKKLKQLKADAKSVNHLKEVSYKLENKVVELTQNLAAKV 957

Query: 954  KENRDMTAKIQDLQKSLNESANIKSLLDAQKDDHSRDLQEQKTSHDAELANKKIELDNXX 1013
            KEN+ ++A++ +LQ SL ESA ++  L   K  H  +L EQK     +    + EL+   
Sbjct: 958  KENKSLSARVVELQTSLEESALLQEELKQIKSKHDAELLEQKDVFAEKGKQIEEELNAAN 1017

Query: 1014 XXXXXXXXXXXDLLSQQEQLKADVRAKVEELNNVQQEFEDSRTQNSDLRNEVKSLKDEIN 1073
                       DL  + E+ KA  ++ +EEL   + E  + +T NSDL+NEV SLK+E++
Sbjct: 1018 LQVEEYKSKLLDLTQEYEEHKATTKSYLEELEKTKAELIEVQTFNSDLQNEVNSLKEELS 1077

Query: 1074 RLQTSIRSGANSNTILAHTPTKSRRFSAH-SSLTDASP-RQLNVISMNN---------GM 1122
            RLQT I  G  +  +L  TP+K      + ++ TD  P  +LNV  +N+         GM
Sbjct: 1078 RLQTQISLGTVTANVLPQTPSKDIHMQRNVTNGTDIGPGSELNVRPVNSKDAGSVSNMGM 1137

Query: 1123 EDDARSTASALSQINDELYKILEDTKSLNIEIVEGLLKGFKIPETGVAAELTRKEVLYPA 1182
             D   S ++AL+QIN+EL+++LED + LN EI +GLLK F++P  GV  +L+R++V+YPA
Sbjct: 1138 -DSYASDSNALTQINEELFRLLEDIEVLNNEITDGLLKDFEVPAAGVGMQLSRRDVVYPA 1196

Query: 1183 RIMIIVLSDMWRLGLTKQSESFLAEAMSTIQKLVSGLKGDDMICHGAFWLTNVRELYSFV 1242
            RI+II+LS+MWR GLTKQSE FLA+ ++TIQK+V+ LKG+D+I  GAFWL NVRELYSFV
Sbjct: 1197 RILIIILSEMWRFGLTKQSEGFLAQVLTTIQKVVTTLKGNDLIPAGAFWLANVRELYSFV 1256

Query: 1243 VFAQESILNDDSYNSGLNEDEYKEYMTLVTELKDDFESLSYNIYNIWLKKLQKDLEKKAV 1302
            VFAQ SIL ++S+ SG+ +DEYKEY++LVTELK+DFESLSYNIYNIWLKKLQ++L+KKAV
Sbjct: 1257 VFAQHSILTEESFKSGMTDDEYKEYVSLVTELKEDFESLSYNIYNIWLKKLQRELQKKAV 1316

Query: 1303 SAVVMSQSLPGFIANESSQFLPKLFSQSNYYKMDDILTFFNNIYWSMKTYHVEQEVFREV 1362
            +AVV+S++LPGF A +S   L K+FS    Y MDDILTFFN+IYWSMK++ +E EVF +V
Sbjct: 1317 NAVVLSEALPGFSAGQSGGLLNKIFSSGEEYTMDDILTFFNSIYWSMKSFQIENEVFHKV 1376

Query: 1363 IITLLRYVDSICFNDLIMRRNFLSWKRGLQLNYNVTRLEEWCKSHHIPEGTDCLQHMXXX 1422
            + TLL YVD+ICFNDLIM+RNFLSWKRGLQLNYNVTRLEEWCK+H +P+GTDCLQH+   
Sbjct: 1377 VTTLLNYVDAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGVPDGTDCLQHLIQT 1436

Query: 1423 XXXXXXXXXXXDDIDIIWEICSSLKPAQIQKLITQYAVADYEVPIPQEILTFVANRVKXX 1482
                       +DIDI+  ICSSL PAQ+QKLITQY VADYE PIPQEIL +VA+ VK  
Sbjct: 1437 SKLLQVRKYSIEDIDILRGICSSLTPAQLQKLITQYQVADYESPIPQEILKYVADIVKSE 1496

Query: 1483 XXXXXXXXXQTHSIDIFLPVENGPFKDPFNLIETRRFGKIEAYIPAWMNL 1532
                      THS DIF+  E GPF DPF  IET +F ++EAYIPAW+ L
Sbjct: 1497 ASLSASSKAPTHSNDIFITPETGPFNDPFADIETHKFDQVEAYIPAWLVL 1546

>YOR326W (MYO2) [5107] chr15 (925716..930440) Myosin heavy chain,
            class V, involved in polarized growth, secretion and
            cytokinesis, required for mitochondrial distribution into
            growing bud [4725 bp, 1574 aa]
          Length = 1574

 Score = 2053 bits (5319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1018/1560 (65%), Positives = 1223/1560 (78%), Gaps = 33/1560 (2%)

Query: 1    MSFEVGTRCWYPDKKEGWVGSEVTKFSQPXXXXXXXXXXXXXXXTVEIETETLNESQNEK 60
            MSFEVGTRCWYP K+ GW+G+EV K ++                 V ++T+ LN  +++ 
Sbjct: 1    MSFEVGTRCWYPHKELGWIGAEVIK-NEFNDGKYHLELQLEDDEIVSVDTKDLNNDKDQS 59

Query: 61   LPLLRNPPILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQL 120
            LPLLRNPPILEA EDLTSLSYLNEPAVLHAIK RY QLNIYTYSGIVLIATNPFDRV+QL
Sbjct: 60   LPLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQL 119

Query: 121  YSQDMIQAYAGRRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIMR 180
            Y+QDMIQAYAG+RRGELEPHLFAIA+EAYRLMK+DKQNQTIVVSGESGAGKTVSAKYIMR
Sbjct: 120  YTQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMR 179

Query: 181  YFASVEQANADNASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGKYLEILF 240
            YFASVE+ N+  A+  H ++MSETE++ILATNPIMEAFGNAKT+RNDNSSRFGKYLEILF
Sbjct: 180  YFASVEEENS--ATVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILF 237

Query: 241  DESTSIIGARIRTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKVEDYHYL 300
            D+ TSIIGARIRTYLLERSRLV+QP +ERNYHIFYQL+ GL    KEELHLT   DY Y+
Sbjct: 238  DKDTSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYM 297

Query: 301  RQGGDYRIKGVDDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRNDAS 360
             QGGD +I G+DDA EY++TVDAL +VG +++TQHQ+FKILAALLHIGNIE+KKTRNDAS
Sbjct: 298  NQGGDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDAS 357

Query: 361  LSSDEPNLKIACDLLGIDASGFSKWITKKQITTRSEKIVSNLSFNQALVARDSVAKFIFS 420
            LS+DEPNLK+AC+LLGIDA  F+KW+TKKQI TRSEKIVSNL+++QALVA+DSVAKFI+S
Sbjct: 358  LSADEPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYS 417

Query: 421  ALFDWLVENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 480
            ALFDWLVENINTVLCNP V+DQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN
Sbjct: 418  ALFDWLVENINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFN 477

Query: 481  QHVFKLEQEEYVNEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 540
            QHVFKLEQEEYV E+IEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK
Sbjct: 478  QHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQK 537

Query: 541  LYQTLDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLEVLKASK 600
            LYQTLDK PTN VFSKPRFGQTKF+VSHYALDVAYDV GFIEKNRDTVSDGHLEVLKAS 
Sbjct: 538  LYQTLDKSPTNKVFSKPRFGQTKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKAST 597

Query: 601  NDTLLSILDTIDKNAAALAE------KQDANKKPGPARMV-KKPTLGSMFKQSLIELMNT 653
            N+TL++IL+ ++K A  L E      +Q  +KKPGP R V +KPTLGSMFKQSLIELMNT
Sbjct: 598  NETLINILEGLEKAAKKLEEAKKLELEQAGSKKPGPIRTVNRKPTLGSMFKQSLIELMNT 657

Query: 654  IDSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLR 713
            I+STNVHYIRCIKPN +KEAW+FDNLMVLSQLRACGVLETIRISCAGFPSRWT+ EFVLR
Sbjct: 658  INSTNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLR 717

Query: 714  YHILIPSDNWTKIF-TSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAGMLAYLE 772
            Y+ILIP + W  IF   E +E+DI ++ K IL ATV D +KYQ+GNTKIFFKAGMLAYLE
Sbjct: 718  YYILIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLAYLE 777

Query: 773  KLRSTKMHNSCVLIQKKIKGVYYRKQYLAIKNAIHNVQAVIAGNYCRQSVDHEFKTLAAI 832
            KLRS KMHNS V+IQKKI+  YYRKQYL I  AI  +Q  I G   RQ V+ E K   A 
Sbjct: 778  KLRSNKMHNSIVMIQKKIRAKYYRKQYLQISQAIKYLQNNIKGFIIRQRVNDEMKVNCAT 837

Query: 833  SLQTIFRGVRQRKNATIALASIVRVQSLVRKQIAQKEVLEKRQSEAAVTIQKKIRGFVPR 892
             LQ  +RG   R N    L +I  +Q  +RK++ Q+++ ++ +  AAVTIQ K+R F PR
Sbjct: 838  LLQAAYRGHSIRANVFSVLRTITNLQKKIRKELKQRQLKQEHEYNAAVTIQSKVRTFEPR 897

Query: 893  QSYNATRGSSVKIQSLVRRXXXXXXXXXXXXXXXSVNHLQEVSYKLENKVIQLTQSLAEK 952
              +  T+  +V +QSL+RR               SVNHL+EVSYKLENKVI+LTQ+LA K
Sbjct: 898  SRFLRTKKDTVVVQSLIRRRAAQRKLKQLKADAKSVNHLKEVSYKLENKVIELTQNLASK 957

Query: 953  VKENRDMTAKIQDLQKSLNESANIKSLLDAQKDDHSRDLQEQKTSHDAELANKKIE--LD 1010
            VKEN++MT +I++LQ  + ESA ++  L+  K +H  D+  QK S D EL  K IE  L 
Sbjct: 958  VKENKEMTERIKELQVQVEESAKLQETLENMKKEHLIDIDNQK-SKDMEL-QKTIENNLQ 1015

Query: 1011 NXXXXXXXXXXXXXDLLSQQEQLKADVRAKVEELNNVQQEFEDSRTQNSDLRNEVKSLKD 1070
            +             D++ Q ++LK + + ++EEL   ++   + +T N DL+NEVKSLK+
Sbjct: 1016 STEQTLKDAQLELEDMVKQHDELKEESKKQLEELEQTKKTLVEYQTLNGDLQNEVKSLKE 1075

Query: 1071 EINRLQTSIRSGANSNTILAHTPTKSRRFSAHSSL-------TDASPRQLNVISM----- 1118
            EI RLQT++  G  + ++L  TP K       S+        +D SP  LN+ S      
Sbjct: 1076 EIARLQTAMSLGTVTTSVLPQTPLKDVMGGGASNFNNMMLENSDLSPNDLNLKSRSTPSS 1135

Query: 1119 -NNGMEDDA--RSTASALSQINDELYKILEDTKSLNIEIVEGLLKGFKIPETGVAAELTR 1175
             NN ++  +  R      +QIN+ELY++LEDT+ LN EI EGLLKGF++P+ GVA +L++
Sbjct: 1136 GNNHIDSLSVDRENGVNATQINEELYRLLEDTEILNQEITEGLLKGFEVPDAGVAIQLSK 1195

Query: 1176 KEVLYPARIMIIVLSDMWRLGLTKQSESFLAEAMSTIQKLVSGLKGDDMICHGAFWLTNV 1235
            ++V+YPARI+IIVLS+MWR GLTKQSESFLA+ ++TIQK+V+ LKG+D+I  G FWL NV
Sbjct: 1196 RDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTQLKGNDLIPSGVFWLANV 1255

Query: 1236 RELYSFVVFAQESILNDDSYNSGLNEDEYKEYMTLVTELKDDFESLSYNIYNIWLKKLQK 1295
            RELYSFVVFA  SIL ++++ +G+ ++EYKEY++LVTELKDDFE+LSYNIYNIWLKKLQK
Sbjct: 1256 RELYSFVVFALNSILTEETFKNGMTDEEYKEYVSLVTELKDDFEALSYNIYNIWLKKLQK 1315

Query: 1296 DLEKKAVSAVVMSQSLPGFIANESSQFLPKLFSQSNYYKMDDILTFFNNIYWSMKTYHVE 1355
             L+KKA++AVV+S+SLPGF A E+S FL K+F+ +  Y MDDILTFFN+IYW MK++H+E
Sbjct: 1316 QLQKKAINAVVISESLPGFSAGETSGFLNKIFANTEEYTMDDILTFFNSIYWCMKSFHIE 1375

Query: 1356 QEVFREVIITLLRYVDSICFNDLIMRRNFLSWKRGLQLNYNVTRLEEWCKSHHIPEGTDC 1415
             EVF  V+ TLL YVD+ICFN+LIM+RNFLSWKRGLQLNYNVTRLEEWCK+H + +GT+C
Sbjct: 1376 NEVFHAVVTTLLNYVDAICFNELIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLTDGTEC 1435

Query: 1416 LQHMXXXXXXXXXXXXXXDDIDIIWEICSSLKPAQIQKLITQYAVADYEVPIPQEILTFV 1475
            LQH+              +DIDI+  IC SL PAQ+QKLI+QY VADYE PIPQEIL +V
Sbjct: 1436 LQHLIQTAKLLQVRKYTIEDIDILRGICYSLTPAQLQKLISQYQVADYESPIPQEILRYV 1495

Query: 1476 ANRVKXXXXXXXX---XXXQTHSIDIFLPVENGPFKDPFNLIETRRFGKIEAYIPAWMNL 1532
            A+ VK                HS  IF+  E GPF DPF+LI+TR+F ++EAYIPAW++L
Sbjct: 1496 ADIVKKEAALSSSGNDSKGHEHSSSIFITPETGPFTDPFSLIKTRKFDQVEAYIPAWLSL 1555

>Scas_663.26
          Length = 1567

 Score = 2023 bits (5241), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1003/1560 (64%), Positives = 1229/1560 (78%), Gaps = 40/1560 (2%)

Query: 1    MSFEVGTRCWYPDKKEGWVGSEVTKFSQPXXXXXXXXXXXXXXXTVEIETETLNESQNEK 60
            MSFEVGTRCWYP K++GW+G+EVTK +                  V +ET+ L   ++  
Sbjct: 1    MSFEVGTRCWYPSKEQGWIGAEVTK-NDLKDGTYFMELTLEDNEVVNVETKDLTNEKDPS 59

Query: 61   LPLLRNPPILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQL 120
            LPLLRNPPILE+ EDLT+LSYLNEPAVLHAIK RY QLNIYTYSGIVLIATNPFDR++QL
Sbjct: 60   LPLLRNPPILESTEDLTTLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRMDQL 119

Query: 121  YSQDMIQAYAGRRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIMR 180
            YSQDMIQAY+G+RRGE+EPHLFAIA+EAYRLMK+DKQNQTIVVSGESGAGKTVSAKYIMR
Sbjct: 120  YSQDMIQAYSGKRRGEIEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMR 179

Query: 181  YFASVEQANADNASS-DHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGKYLEIL 239
            YFAS ++ N+ N  +  H  +MSETEERILATNPIMEAFGNAKT+RNDNSSRFGKYLEIL
Sbjct: 180  YFASCDEENSSNMGNLQHTAEMSETEERILATNPIMEAFGNAKTTRNDNSSRFGKYLEIL 239

Query: 240  FDESTSIIGARIRTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKVEDYHY 299
            FD+ T+IIGA++RTYLLERSRLV+QP+ ERNYHIFYQ++ GL E  K+ELHLTK +DY Y
Sbjct: 240  FDKETAIIGAKMRTYLLERSRLVYQPKTERNYHIFYQILAGLPEDVKQELHLTKADDYFY 299

Query: 300  LRQGGDYRIKGVDDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRNDA 359
            + QGG+  I G+DD +EY +T+ AL +VG + +TQ  +FKILAALLHIGNIE+KKTRND+
Sbjct: 300  MNQGGEPEIAGIDDVSEYGITIKALTLVGVAPETQQHIFKILAALLHIGNIEIKKTRNDS 359

Query: 360  SLSSDEPNLKIACDLLGIDASGFSKWITKKQITTRSEKIVSNLSFNQALVARDSVAKFIF 419
            SLSSDEPNLKIAC+LLG+D S F+KWITKKQI TRSEKIVSNL+++QALVARDSVAKFI+
Sbjct: 360  SLSSDEPNLKIACELLGVDPSNFAKWITKKQIVTRSEKIVSNLNYSQALVARDSVAKFIY 419

Query: 420  SALFDWLVENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEF 479
            SALFDWLV NINTVLCNP V DQI SFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEF
Sbjct: 420  SALFDWLVTNINTVLCNPAVLDQIHSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEF 479

Query: 480  NQHVFKLEQEEYVNEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQ 539
            NQHVFKLEQEEY+ E+IEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQ
Sbjct: 480  NQHVFKLEQEEYIKEEIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQ 539

Query: 540  KLYQTLDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLEVLKAS 599
            KLYQTLDKPPTN VFSKPRFGQTKFVVSHYALDVAYDV GFIEKNRDTVSDGHLEVLKA+
Sbjct: 540  KLYQTLDKPPTNKVFSKPRFGQTKFVVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKAT 599

Query: 600  KNDTLLSILDTID----------KNAAALAEKQDANKKPGPARMV-KKPTLGSMFKQSLI 648
             NDTL +IL++++          KNAA+  +KQ   KKP P R V +KPTLGSMFK SLI
Sbjct: 600  TNDTLSTILESVEESARKVEEAKKNAASQDQKQ--LKKPTPIRQVQRKPTLGSMFKLSLI 657

Query: 649  ELMNTIDSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYN 708
            ELM TI+STNVHYIRCIKPN EKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWT+N
Sbjct: 658  ELMQTINSTNVHYIRCIKPNGEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFN 717

Query: 709  EFVLRYHILIPSDNWTKIF-TSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAGM 767
            EF+LRY+ILIP   W  IF  ++ +E D+ NLCK+IL ATV D  KYQ+GNTKIFFKAGM
Sbjct: 718  EFILRYYILIPPVEWAPIFQKNDLTEQDVINLCKKILAATVQDKEKYQIGNTKIFFKAGM 777

Query: 768  LAYLEKLRSTKMHNSCVLIQKKIKGVYYRKQYLAIKNAIHNVQAVIAGNYCRQSVDHEFK 827
            LAY EKLRSTKM+++ VLIQK I+  YYRKQY+ +K ++  + A   G   RQ V++E +
Sbjct: 778  LAYFEKLRSTKMNSAIVLIQKHIRSKYYRKQYMLMKASLSLLGAYSKGTVIRQRVEYELE 837

Query: 828  TLAAISLQTIFRGVRQRKNATIALASIVRVQSLVRKQIAQKEVLEKRQSEAAVTIQKKIR 887
              AA  +QT++RG  +R   +  ++SIV++QS +R+++ Q+E+  K +S AA++IQ +IR
Sbjct: 838  QHAATLIQTMYRGYSKRSYISGVISSIVKLQSRIREELEQREMQSKYESNAAISIQSRIR 897

Query: 888  GFVPRQSYNATRGSSVKIQSLVRRXXXXXXXXXXXXXXXSVNHLQEVSYKLENKVIQLTQ 947
             FVPR++Y + R  ++ +QSL+RR               SV+HL+EVSYKLENKVIQLTQ
Sbjct: 898  AFVPRKAYESKRRDTIVVQSLIRRRIAQRDFKKLKADAKSVHHLKEVSYKLENKVIQLTQ 957

Query: 948  SLAEKVKENRDMTAKIQDLQKSLNESANIKSLLDAQKDDHSRDLQEQKTSHDAELANKKI 1007
            +LA KVKENR ++ ++++LQ ++   + ++  L+AQK ++ + L +QK     +  + K 
Sbjct: 958  NLAAKVKENRQLSKRLEELQATMVTVSELQDQLEAQKMENQKALADQKDGFVLDSKSLKD 1017

Query: 1008 ELDNXXXXXXXXXXXXXDLLSQQEQLKADVRAKVEELNNVQQEFEDSRTQNSDLRNEVKS 1067
            +L                L ++  +++A+ + +++EL   +    +S+TQNSDL +E+KS
Sbjct: 1018 QLIKANKDVESVKFELATLTAKYTEMEAESKNQLDELERTKTLLTESKTQNSDLYSEIKS 1077

Query: 1068 LKDEINRLQTSIRSG-ANSNT-ILAHTPTKSRRF-SAH--SSLTDASPRQLNVI------ 1116
            LK+E+  LQTSI  G   +NT I+ HTP++  R  S H  ++  + SP QL  I      
Sbjct: 1078 LKEELAHLQTSIALGTVTTNTNIVPHTPSRENRMPSGHMRAAEENISPNQLKSIPSDTAA 1137

Query: 1117 ---SMNN-GMEDDARSTASALSQINDELYKILEDTKSLNIEIVEGLLKGFKIPETGVAAE 1172
               S+N  GM+DD  +T + L+QIN+ELY++LE T  LN EI EGLLKGF++P+ GVA +
Sbjct: 1138 DHVSVNGYGMDDDIINT-NTLTQINEELYRLLEGTDVLNNEITEGLLKGFQVPDAGVAIQ 1196

Query: 1173 LTRKEVLYPARIMIIVLSDMWRLGLTKQSESFLAEAMSTIQKLVSGLKGDDMICHGAFWL 1232
            L+R++V+YPARI+IIVLS+MWR GLTKQSESFLA+ ++TIQK+V+ LKG D+I  GAFWL
Sbjct: 1197 LSRRDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTTLKGIDLIPSGAFWL 1256

Query: 1233 TNVRELYSFVVFAQESILNDDSYNSGLNEDEYKEYMTLVTELKDDFESLSYNIYNIWLKK 1292
             NVRELYSFVVFAQ SIL ++S+  G+N++EY EY++LVTELK+DFESLSYNIYNIWLKK
Sbjct: 1257 ANVRELYSFVVFAQHSILTEESFKKGMNDEEYNEYVSLVTELKEDFESLSYNIYNIWLKK 1316

Query: 1293 LQKDLEKKAVSAVVMSQSLPGFIANESSQFLPKLFSQSNYYKMDDILTFFNNIYWSMKTY 1352
            LQKDL+KKA++AVV+S+SLPGF A+ES+ FL K+F+    Y MDDILTFFNNI+W MK++
Sbjct: 1317 LQKDLQKKAINAVVVSESLPGFNASESNGFLNKIFNSGEEYTMDDILTFFNNIFWCMKSF 1376

Query: 1353 HVEQEVFREVIITLLRYVDSICFNDLIMRRNFLSWKRGLQLNYNVTRLEEWCKSHHIPEG 1412
            H+E EVFR VIITLL YVD+ICFNDLIM+RNFLSWKRGLQLNYNVTRLEEWCK+H +P+G
Sbjct: 1377 HIENEVFRTVIITLLNYVDTICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGLPDG 1436

Query: 1413 TDCLQHMXXXXXXXXXXXXXXDDIDIIWEICSSLKPAQIQKLITQYAVADYEVPIPQEIL 1472
               LQH+              +DID++  ICSSL PAQ+QKLI+QY VADYE PIPQ+IL
Sbjct: 1437 AQYLQHLIQTAKLLQLRKYTIEDIDMVRGICSSLSPAQLQKLISQYHVADYESPIPQDIL 1496

Query: 1473 TFVANRVKXXXXXXXXXXXQTHSIDIFLPVENGPFKDPFNLIETRRFGKIEAYIPAWMNL 1532
             +VA+ VK             H+ DIFL  E GPF DPF  ++TR+F ++EAYIP+W+ L
Sbjct: 1497 KYVADIVK-------KESTSAHN-DIFLHPETGPFNDPFVAVKTRKFDQVEAYIPSWLVL 1548

>Scas_592.13*
          Length = 1419

 Score = 1285 bits (3324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 692/1488 (46%), Positives = 923/1488 (62%), Gaps = 140/1488 (9%)

Query: 1    MSFEVGTRCWYPDKKEGWVGSEVTKFSQPXXXXXXXXXXXXXXXTVEIETETLN-----E 55
            MSFEVGTRCWYP+ + GW+G EVTK +                  + IET+ L      E
Sbjct: 1    MSFEVGTRCWYPNSEAGWIGCEVTK-NDFQDGTYHIELTSETGLVIPIETKHLESNNAME 59

Query: 56   SQNEKLPLLRNPPILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFD 115
            + +E LP+LRNPPILEA  DLT+LSYLNEPAVLHAIK RY Q NIYTYSGIVLIATNPFD
Sbjct: 60   NNHEFLPVLRNPPILEATHDLTTLSYLNEPAVLHAIKERYNQRNIYTYSGIVLIATNPFD 119

Query: 116  RVEQLYSQDMIQAYAGRRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSA 175
            +VE+LYS +MIQAYA + R E+ PH+FAIA+EAYR M ++ QNQTI+VSGESGAGKTVSA
Sbjct: 120  KVEELYSSEMIQAYARKNRDEMAPHIFAIAEEAYREMINNDQNQTIIVSGESGAGKTVSA 179

Query: 176  KYIMRYFASVEQANADN-ASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGK 234
            KYIMR+FASVE+ + +    S H  +MS+ E +ILATNP+MEAFGNAKT+RNDNSSRFGK
Sbjct: 180  KYIMRFFASVEEEHFNKEGDSKHQEEMSDIEVKILATNPVMEAFGNAKTTRNDNSSRFGK 239

Query: 235  YLEILFDESTSIIGARIRTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKV 294
            YL+ILFD + +IIG+ I+TYLLERSRLVFQP  ERNYHIFYQ++ GLS   K++L+LT  
Sbjct: 240  YLQILFDSNKNIIGSSIKTYLLERSRLVFQPTSERNYHIFYQMLSGLSSDMKKQLYLTNA 299

Query: 295  EDYHYLRQGGDYRIKGVDDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKK 354
            ED+ YL QGG+  I G+DD+ EY  T+++L  VG   + Q Q+FKILAALLHIGNIE+KK
Sbjct: 300  EDFFYLNQGGESTINGIDDSLEYSTTIESLSTVGIDTEVQLQIFKILAALLHIGNIEIKK 359

Query: 355  TRNDASLSSDEPNLKIACDLLGIDASGFSKWITKKQITTRSEKIVSNLSFNQALVARDSV 414
            TR DA+LSS +P+L+ AC+LLG+D   FSKWITKKQI TRSEKI+SNLSFNQALVARDSV
Sbjct: 360  TRTDATLSSTDPSLQKACELLGLDPLTFSKWITKKQINTRSEKIISNLSFNQALVARDSV 419

Query: 415  AKFIFSALFDWLVENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEK 474
            AKFI+S+LFDWLV NIN VLC  QVS+ I+SFIGVLDIYGFEHFE+NSFEQFCINYANEK
Sbjct: 420  AKFIYSSLFDWLVGNINNVLCTSQVSETINSFIGVLDIYGFEHFEQNSFEQFCINYANEK 479

Query: 475  LQQEFNQHVFKLEQEEYVNEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSD 534
            LQQEFN HVFKLEQEEYV E+IEWSFIEF+DNQPCIDLIENKLGILSLLDEESRLPAGSD
Sbjct: 480  LQQEFNHHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPAGSD 539

Query: 535  ESWTQKLYQTLDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLE 594
            ESWT KLYQT +KPP+N+VF KPRFGQ KF++SHYA+DV Y+V GFIEKN+DT+S+  LE
Sbjct: 540  ESWTTKLYQTFNKPPSNTVFGKPRFGQNKFIISHYAVDVTYEVDGFIEKNKDTISESQLE 599

Query: 595  VLKASKNDTLLSILDTID-KNAAALAEKQDANKKPGPARMVKKPTLGSMFKQSLIELMNT 653
            VLKA+ N TL +I +  + +N   + E+    ++    R   KPTLGS+FK+SL+ELM T
Sbjct: 600  VLKATTNPTLATIFEFSEAENKTNITEQAGTIQRKTINR---KPTLGSIFKRSLVELMET 656

Query: 654  IDSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLR 713
            I+STNVHYIRCIKPN EKEAWKFDNLMVLSQLRACGVLETI+ISCAGFPSRW + EF+ R
Sbjct: 657  INSTNVHYIRCIKPNTEKEAWKFDNLMVLSQLRACGVLETIKISCAGFPSRWAFEEFIQR 716

Query: 714  YHILIPSDNWTKIFTS-EASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAGMLAYLE 772
            Y++L P+D W ++    E S +D+   C  IL   +D  +KYQ+G TKIFFKAG+LAYLE
Sbjct: 717  YYLLAPTDQWGRVTADMEMSLEDMVAFCDLILSEKIDSKDKYQIGKTKIFFKAGVLAYLE 776

Query: 773  KLRSTKMHNSCVLIQKKIKGVYYRKQYLAIKNAIHNVQAVIAGNYCRQSVDHEFKTLAAI 832
            K+RS K+    VLIQK I+  YYR  YL    +I N Q++I G   RQ VD E KT AA 
Sbjct: 777  KIRSDKVTELAVLIQKHIRAKYYRSLYLQAMLSIKNCQSLIRGVQSRQRVDFEMKTDAAT 836

Query: 833  SLQTIFRGVRQRKNATIALASIVRVQSLVRKQIAQKEVLEKRQSEAAVTIQKKIRGFVPR 892
             LQT+ R  R R      L +I+ VQ+ +R+ +    +  + +S +A+ IQ KIR   P+
Sbjct: 837  LLQTLHRSTRVRSQVFETLKNILEVQTAIRRVLVSNFIQREFESRSAIMIQSKIRANSPK 896

Query: 893  QSYNATRGSSVKIQSLVRRXXXXXXXXXXXXXXXSVNHLQEVSYKLENKVIQLTQSLAEK 952
              Y   +  ++ IQ+LVRR               S   L+  +  ++ ++I   + L   
Sbjct: 897  HRYQTLKTGTILIQALVRRKQSQEKLKQLKIQAESAASLKNSAAGIQKELIGFIEELISN 956

Query: 953  VKENRDMTAKIQDLQKSLNESANIKSLLDAQKDDHSRDLQEQKTSHDAELANKKIELDNX 1012
            +KEN   T + + L K  +        L      + R      T +  E     I     
Sbjct: 957  IKENDAKTTEYKSLLKHTS--------LPVVTGTNERTAAYISTKNQVEEDKVTIR---- 1004

Query: 1013 XXXXXXXXXXXXDLLSQQEQLKADVRAKVEELNNVQQEFEDSRTQNSDLRNEVKSLKDEI 1072
                         +L++ E LK   R +++ L ++++   D +  +S L++ ++ +K +I
Sbjct: 1005 ------------TILTKYETLKDLCRKELKSLESLEKGVNDEKFASS-LQSSLELIKRDI 1051

Query: 1073 NRLQTSIRSGANSNTILAHTPTKSRRFSAHSSLTDASPRQLNVISMNNGMEDDARSTASA 1132
            + L+ +     N  T                             S ++ ++D    T +A
Sbjct: 1052 SDLRINAIEKDNERT-----------------------------STSSELKDGTDCTDNA 1082

Query: 1133 LSQINDELYKILEDTKSLNIEIVEGLLKGFKIPETGVAAELTRKEVLYPARIMIIVLSDM 1192
            + QI      + +    L  ++V  +   F+IP+ G   +    E  YP +++I +++ M
Sbjct: 1083 VVQI------LTKRQGDLINDLVNVVFLEFQIPQRGRTKDC---EHFYPVKLLISIVNLM 1133

Query: 1193 WRLGLTKQSESFLAEAMSTIQKLVSGLKGDDMICHGAFWLTNVRELYSFVVFAQESILND 1252
             + GL K S S L + +  +   +S +     +  G +W+ ++ +L S     + ++LN 
Sbjct: 1134 NKFGLRKSSHSILKQTVQDLIGKISSMDAKKCVTFGLYWIISLHKLSSLP--QEPAVLN- 1190

Query: 1253 DSYNSGLNEDEYKEYMTLVTELKDDFESLSYNIYNIWLKKLQKDLEKKAVSAVVMSQSLP 1312
                                +L+D F       Y  WLK                     
Sbjct: 1191 --------------------KLQDKF-------YKTWLK--------------------- 1202

Query: 1313 GFIANESSQFLPKLFSQSNYYKMDDILTFFNNIYWSMKTYHVEQEVFREVIITLLRYVDS 1372
                        + F+Q     +D IL  F+ I      +    E+   +I  LL+++++
Sbjct: 1203 ------------QCFNQMK--TVDSILILFDTISEFTLFFQGTTELLTNIITALLQHINA 1248

Query: 1373 ICFNDLIMRRNFLSWKRGLQLNYNVTRLEEWCKSHHIPEGTDCLQHMXXXXXXXXXXXXX 1432
              FNDL++++N LSW  GL+ +  + ++ +WC SH I   T+ L+++             
Sbjct: 1249 KWFNDLLIKQNTLSWTHGLEKDSEIKKVLDWCNSHKIRNSTEYLRNVNQACKLLQLRISN 1308

Query: 1433 XDDIDIIWEICSSLKPAQIQKLITQYAVADYEVPIPQEILTFVANRVK 1480
              D  ++ E C  L   Q+  L+T+Y    +E PIP ++L  ++N  +
Sbjct: 1309 ISDFQLVCEFCYDLSSLQMHALLTKYRPTQFEKPIPVDVLNHLSNTAR 1356

>YAL029C (MYO4) [39] chr1 complement(87858..92273) Myosin heavy
           chain, class V [4416 bp, 1471 aa]
          Length = 1471

 Score = 1199 bits (3103), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/916 (63%), Positives = 710/916 (77%), Gaps = 11/916 (1%)

Query: 1   MSFEVGTRCWYPDKKEGWVGSEVTKFSQPXXXXXXXXXXXXXXXTVEIETETL-NESQNE 59
           MSFEVGT+CWYP K++GW+G EVTK +                 TV IET +  N+  + 
Sbjct: 1   MSFEVGTKCWYPHKEQGWIGGEVTK-NDFFEGTFHLELKLEDGETVSIETNSFENDDDHP 59

Query: 60  KLPLLRNPPILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQ 119
            LP+LRNPPILE+ +DLT+LSYLNEPAVLHAIK RY    IYTYSGIVLIA NPFD+V+ 
Sbjct: 60  TLPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDH 119

Query: 120 LYSQDMIQAYAGRRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIM 179
           LYS++MIQ Y+ +R+ ELEPHLFAIA+EAYR M H+K NQT+VVSGESGAGKTVSAKYIM
Sbjct: 120 LYSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIM 179

Query: 180 RYFASVEQANADNASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGKYLEIL 239
           RYFASV+++N    + +  ++MS+ E +ILATNPIMEAFGNAKT+RNDNSSRFGKYL+IL
Sbjct: 180 RYFASVQESN----NREGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQIL 235

Query: 240 FDESTSIIGARIRTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKVEDYHY 299
           FDE+T+I G++IRTYLLE+SRLV+QP+ ERNYHIFYQ++EGL E  K+ELHL+  +DYHY
Sbjct: 236 FDENTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHY 295

Query: 300 LRQGGDYRIKGVDDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRNDA 359
             QGG   I G+D+A EY++T DAL +VG + +TQ  +FKILA LLHIGNIE+K TRNDA
Sbjct: 296 TNQGGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKMTRNDA 355

Query: 360 SLSSDEPNLKIACDLLGIDASGFSKWITKKQITTRSEKIVSNLSFNQALVARDSVAKFIF 419
           SLSS+E NL+IAC+LLGID   F+KWI KKQI TRSEKIV+NL++NQAL+ARDSVAKFI+
Sbjct: 356 SLSSEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIY 415

Query: 420 SALFDWLVENINTVLCNPQV--SDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQ 477
           S LFDWLV+NIN  L +P++   D + SFIG+LDIYGFEHFEKNSFEQFCINYANEKLQQ
Sbjct: 416 STLFDWLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQ 475

Query: 478 EFNQHVFKLEQEEYVNEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESW 537
           EFNQHVFKLEQEEYV E+IEWSFIEF+DNQPCIDLIENKLGILSLLDEESRLP+GSDESW
Sbjct: 476 EFNQHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENKLGILSLLDEESRLPSGSDESW 535

Query: 538 TQKLYQTLDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLEVLK 597
             KLY   +KPP+N VFSKPRFGQTKF+VSHYA+DV Y+V GFIEKNRD+VS GHL+V K
Sbjct: 536 ASKLYSAFNKPPSNEVFSKPRFGQTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFK 595

Query: 598 ASKNDTLLSILDTIDKNAAALAEKQDANKKPG-PARMV-KKPTLGSMFKQSLIELMNTID 655
           A+ N     ILD  +  +    E+Q+  KK   PAR+  KKPTLGSMFK+SL ELM  I+
Sbjct: 596 ATTNPIFKQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAIIN 655

Query: 656 STNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYH 715
           STNVHYIRCIKPN EK+ W+FDNLMVLSQLRACGVLETIRISCAGFPSRWT++EFV RY 
Sbjct: 656 STNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYF 715

Query: 716 ILIPSDNWTKI-FTSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAGMLAYLEKL 774
           +L     W+ I +  +  ++ I N C+ IL AT+ DS KYQ+GNTKIFFKAGMLA+LEKL
Sbjct: 716 LLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFLEKL 775

Query: 775 RSTKMHNSCVLIQKKIKGVYYRKQYLAIKNAIHNVQAVIAGNYCRQSVDHEFKTLAAISL 834
           R+ KM+  C++IQKKI+  YYR QYL    +I   Q+ I     R  VDHE KT AAI L
Sbjct: 776 RTNKMNEICIIIQKKIRARYYRLQYLQTMESIKKCQSQIRSLLVRTRVDHELKTRAAILL 835

Query: 835 QTIFRGVRQRKNATIALASIVRVQSLVRKQIAQKEVLEKRQSEAAVTIQKKIRGFVPRQS 894
           QT  R + +R+    A+  I+++Q   ++++    V  K    AAV IQ  IR +  +  
Sbjct: 836 QTNIRALWKREYYRAAIGQIIKLQCTCKRKLILDSVNRKFMLMAAVIIQSYIRSYGHKTD 895

Query: 895 YNATRGSSVKIQSLVR 910
           Y   + SS+ +QS +R
Sbjct: 896 YRTLKRSSILVQSAMR 911

>CAGL0G06336g 607817..612073 similar to sp|P32492 Saccharomyces
            cerevisiae YAL029c MYO4 or sp|P19524 Saccharomyces
            cerevisiae YOR326w MYO2, start by similarity
          Length = 1418

 Score = 1079 bits (2791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/1028 (55%), Positives = 719/1028 (69%), Gaps = 34/1028 (3%)

Query: 1    MSFEVGTRCWYPDKKEGWVGSEVTKFSQPXXXXXXXXXXXXXXXTVEIETETLN-----E 55
            M+FEVGTRCWYP +  GW+  EV+K ++P                ++++T++++      
Sbjct: 1    MTFEVGTRCWYPSEN-GWIPCEVSK-NEPRDGKYHLQFTLEDGSLIDLDTDSIDYNDSLS 58

Query: 56   SQNEKLPLLRNPPILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFD 115
            ++   +P+LRNP   E+ +DLT+LSYLNEPAVLHAIK RY    IYTYSGIVL+ATNPF 
Sbjct: 59   NEGSPMPVLRNPHSRESTQDLTTLSYLNEPAVLHAIKLRYMNKEIYTYSGIVLVATNPFA 118

Query: 116  RVEQLYSQDMIQAYAG-RRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVS 174
            ++E+LYS DMI+ Y+    R EL+PHLFAIA +AY  M    +NQTIVVSGESGAGKTVS
Sbjct: 119  QMEELYSNDMIKKYSRITSREELDPHLFAIAHDAYTTMDSQSRNQTIVVSGESGAGKTVS 178

Query: 175  AKYIMRYFASVEQANADNASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGK 234
            AKYIMRYFAS++  NA   S     +MS+ E++ILATNPIMEAFGNAKT RNDNSSRFGK
Sbjct: 179  AKYIMRYFASLDDNNAAVVS-----EMSDIEKKILATNPIMEAFGNAKTIRNDNSSRFGK 233

Query: 235  YLEILFDESTSIIGARIRTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKV 294
            YL+I+FD   +IIGA+IRTYLLERSRLVFQ Q ERNYHIFYQL+ GL  + KEEL ++  
Sbjct: 234  YLQIMFDAKKNIIGAQIRTYLLERSRLVFQQQSERNYHIFYQLLAGLPAAIKEELCISNP 293

Query: 295  EDYHYLRQGGDYRIKGVDDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKK 354
            E ++YL QG D RI GVDDA E+Q T+ AL ++G +   Q ++FKILA LLHIGNIE+K+
Sbjct: 294  EQFYYLNQGSDPRIDGVDDAQEFQDTIAALSVIGINDSLQMEVFKILAGLLHIGNIEIKQ 353

Query: 355  TRNDASLSSDEPNLKIACDLLGIDASGFSKWITKKQITTRSEKIVSNLSFNQALVARDSV 414
            +   +S+S DEPNLK+AC+LLG+D   FSKW+TKK+ITTRSEKIV+NL   QALV RDSV
Sbjct: 354  SSTSSSISPDEPNLKLACELLGLDPYEFSKWLTKKEITTRSEKIVTNLKKEQALVVRDSV 413

Query: 415  AKFIFSALFDWLVENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEK 474
            +KFI+S LFDWLV  INT+L   +VSDQ+ SFIGVLDIYGFEHFE NSFEQFCINYANEK
Sbjct: 414  SKFIYSLLFDWLVNQINTMLHGAEVSDQVRSFIGVLDIYGFEHFEMNSFEQFCINYANEK 473

Query: 475  LQQEFNQHVFKLEQEEYVNEQIEWSFIEFNDNQPCIDLIENKLGILSLLDEESRLPAGSD 534
            LQQEFNQHVFKLEQEEYV E+IEWSFIEFNDNQPCIDLIEN+LGILSLLDEESRLP+G+D
Sbjct: 474  LQQEFNQHVFKLEQEEYVREKIEWSFIEFNDNQPCIDLIENRLGILSLLDEESRLPSGTD 533

Query: 535  ESWTQKLYQTLDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLE 594
            ESWTQKLYQTLDKPP N VFSKP+FGQTKFV+SHYA +V YDV GFIEKNRDTVS+  + 
Sbjct: 534  ESWTQKLYQTLDKPPMNQVFSKPKFGQTKFVISHYADNVEYDVEGFIEKNRDTVSESLMN 593

Query: 595  VLKASKNDTLLSILDTIDKNAAALAEKQDANKKPGPARMVKKPTLGSMFKQSLIELMNTI 654
            VLK S+NDTL+S+    ++ +    +    ++   P  + KKPTLG MFK+SL ELM  I
Sbjct: 594  VLKNSQNDTLISLTKPTEETSTPPPQTASISR---PKLINKKPTLGFMFKKSLGELMEII 650

Query: 655  DSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRY 714
            ++TNVHYIRC+KPN  K AW+FD+ MVLSQLRACG+LETI+ISCAGFPSRW++ EF+ RY
Sbjct: 651  NNTNVHYIRCVKPNSSKVAWEFDDGMVLSQLRACGILETIKISCAGFPSRWSFQEFIDRY 710

Query: 715  HILIPSDNWTKIFTSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAGMLAYLEKL 774
            ++L+ +  W+ + +SE++ +     CK+ILGAT     K Q+G TKIFFK+G+LA LE L
Sbjct: 711  YMLVDTTLWSDVASSESNAESSIKFCKEILGATELSHEKCQIGQTKIFFKSGVLAELESL 770

Query: 775  RSTKMHNSCVLIQKKIKGVYYRKQYLAIKNAIHNVQAVIAGNYCRQSVDHEFKTLAAISL 834
            R  KM    + IQKKI+    R  YL I N + ++Q  I     R  V+H+ KT  A+ +
Sbjct: 771  RLKKMKGIAITIQKKIRAYKIRTWYLEIVNCVRDLQNRIRSKLVRLDVEHQLKTKLALMM 830

Query: 835  QTIFRGVRQRKNATIALASIVRVQSLVRKQIAQKEVLEKRQSEAAVTIQKKIRGFVPRQS 894
            Q   R  R R      L  I+ +Q   R  +AQ+ + E ++++A++ IQ  IRG+  +  
Sbjct: 831  QATLRSYRVRIRVAKELDDIILLQCKFRTVLAQRYLQELKRNKASIMIQSYIRGYKHKTQ 890

Query: 895  YNATRGSSVKIQSLVRRXXXXXXXXXXXXXXXSVNHLQEVSY-KLENKVIQLTQSLAEK- 952
            Y   R +   IQ+L  R                V  +  V+Y +L + V  +  S+    
Sbjct: 891  YRYFRKNYQAIQAL-SRSMLARSLMLKLRSESEVTQINGVTYTELHSIVKDIHDSMTSNN 949

Query: 953  --VKENRDMTAKIQDLQKSL---NESANIKSL-LDAQK--------DDHSRDLQEQKTSH 998
              +KE  +    I D QKSL   + SA  + L  DAQK        +   +DL+E K   
Sbjct: 950  QIIKELDEFNGVI-DTQKSLTFTDLSAKAEQLNSDAQKIIIKHSNQEKQIKDLKESKGDV 1008

Query: 999  DAELANKK 1006
            D+ L N K
Sbjct: 1009 DSTLTNIK 1016

>YHR023W (MYO1) [2310] chr8 (151658..157444) Myosin heavy chain
           (myosin II), coiled-coil protein involved in septation
           and cell wall organization [5787 bp, 1928 aa]
          Length = 1928

 Score =  514 bits (1324), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 299/754 (39%), Positives = 458/754 (60%), Gaps = 31/754 (4%)

Query: 66  NPPILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQLYSQDM 125
           NP   + +E+++ L++LNEP+VL+ ++ RY    IYTYSG+ L+A NP+  +  LYS+D 
Sbjct: 70  NPSTFDKVENMSELTHLNEPSVLYNLEKRYDCDLIYTYSGLFLVAINPYHNL-NLYSEDH 128

Query: 126 IQAYAGRR------------RGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTV 173
           I  Y  +               +L PH+FAIA+EAY  +  + ++Q+I+V+GESGAGKT 
Sbjct: 129 INLYHNKHNRLSKSRLDENSHEKLPPHIFAIAEEAYENLLSEGKDQSILVTGESGAGKTE 188

Query: 174 SAKYIMRYFASVEQANADNASSDHHLQMSET-EERILATNPIMEAFGNAKTSRNDNSSRF 232
           + K I++Y AS+   +  N +      + E+ E +IL +NPI+E+FGNA+T RN+NSSRF
Sbjct: 189 NTKKILQYLASITSGSPSNIAPVSGSSIVESFEMKILQSNPILESFGNAQTVRNNNSSRF 248

Query: 233 GKYLEILFDESTSIIGARIRTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLT 292
           GK+++I F+E   I GA I  YLLE+SR+V Q   ERNYHIFYQL+ GL +SE + L L 
Sbjct: 249 GKFIKIEFNEHGMINGAHIEWYLLEKSRIVHQNSKERNYHIFYQLLSGLDDSELKNLRLK 308

Query: 293 --KVEDYHYLRQGGDYRIKGVDDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNI 350
              V+DY  L       I G++D   ++  + AL ++GFS+D    +F+++A +L IGNI
Sbjct: 309 SRNVKDYKILSNSNQDIIPGINDVENFKELLSALNIIGFSKDQIRWIFQVVAIILLIGNI 368

Query: 351 EVKKTRNDASLSSDEPNLKIACDLLGIDASGFSKWITKKQITTRSEKIVSNLSFNQALVA 410
           E    R  A  +S + ++   C  LG+D   F   I + +     E +  + +  QA   
Sbjct: 369 EFVSDR--AEQASFKNDVSAICSNLGVDEKDFQTAILRPRSKAGKEWVSQSKNSQQAKFI 426

Query: 411 RDSVAKFIFSALFDWLVENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINY 470
            +++++ ++  LF ++V+ IN  L +   +    ++IG+LDI GFE FE NSFEQ CINY
Sbjct: 427 LNALSRNLYERLFGYIVDMINKNLDHGSAT---LNYIGLLDIAGFEIFENNSFEQLCINY 483

Query: 471 ANEKLQQEFNQHVFKLEQEEYVNEQIEWSFIEFN-DNQPCIDLIENK---LGILSLLDEE 526
            NEKLQQ FN H+F LEQ EY+ E I+W +I++  D Q  IDLIE+K    G+L LLDEE
Sbjct: 484 TNEKLQQFFNNHMFVLEQSEYLKENIQWDYIDYGKDLQLTIDLIESKGPPTGVLPLLDEE 543

Query: 527 SRLPAGSDESWTQKLYQTLDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRD 586
           + LP  +DES+  KL  T D+   +S F + R  +  F++ HYA DV Y V G++ KN+D
Sbjct: 544 AVLPKSTDESFYSKLISTWDQ--NSSKFKRSRL-KNGFILKHYAGDVEYTVEGWLSKNKD 600

Query: 587 TVSDGHLEVLKASKNDTLLSILDTI-DKNAAALAEKQDANKK-PGPARMVKKPTLGSMFK 644
            ++D  L +L +S+ND +  +     +K+++A  E   +N++    AR     T  S  +
Sbjct: 601 PLNDNLLSLLSSSQNDIISKLFQPEGEKSSSAGVEANISNQEVKKSARTSTFKTTSSRHR 660

Query: 645 QSLIELMNTIDSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSR 704
           +  I L+N + ST+ H++RCI PN  K+   F+  ++L QLR  GVLE IR++  G+P+R
Sbjct: 661 EQQITLLNQLASTHPHFVRCIIPNNVKKVKTFNRRLILDQLRCNGVLEGIRLAREGYPNR 720

Query: 705 WTYNEFVLRYHILIPSDNWTKIFTSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFK 764
             + EF  RY IL P ++ T  F+S+      +N C+ +L +   D+  Y++GNTK+FFK
Sbjct: 721 IAFQEFFQRYRILYPENSTTTTFSSKLKASTKQN-CEFLLTSLQLDTKVYKIGNTKLFFK 779

Query: 765 AGMLAYLEKLRSTKMHNSCVLIQKKIKGVYYRKQ 798
           AG+LA LEK +  K++N  + +   I+G   RK+
Sbjct: 780 AGVLADLEKQKDVKLNNIMIKLTATIRGYTVRKE 813

>ACR068W [1115] [Homologous to ScYHR023W (MYO1) - SH]
           complement(480141..485558) [5418 bp, 1805 aa]
          Length = 1805

 Score =  510 bits (1313), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 309/821 (37%), Positives = 470/821 (57%), Gaps = 101/821 (12%)

Query: 48  IETETLNESQN--EKLPLLR----------------NPPILEAIEDLTSLSYLNEPAVLH 89
           + T+T+   QN  EK+ L+R                NP   + I+D++ L++LNE +VL+
Sbjct: 23  VSTKTIKNKQNKDEKVCLVRVNGKEREVLEVETAAVNPSTFDKIDDMSELTHLNEASVLY 82

Query: 90  AIKARYGQLNIYTYSGIVLIATNPFDRVEQLYSQDMIQAYAGRRRGELEPHLFAIADEAY 149
            ++ RY    IYTYSG+ L+A NP+  + ++Y+QD +  Y G  + + EPH+FA+A++AY
Sbjct: 83  NLENRYKDDMIYTYSGLFLVALNPYSNI-KVYTQDYVNLYHGSPKEDNEPHIFAVAEQAY 141

Query: 150 RLMKHDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEQANADNASSDH---HLQMSETEE 206
           R +   +Q+Q+++V+GESGAGKT + K I++Y AS+        +SD    H  +   E 
Sbjct: 142 RNLLTQRQDQSVLVTGESGAGKTENTKKILQYLASI--------TSDEKLAHTNLESFER 193

Query: 207 RILATNPIMEAFGNAKTSRNDNSSRFGKYLEILFDESTSIIGARIRTYLLERSRLVFQPQ 266
           +IL  NPI+E+FGNA+T RN+NSSRFGK+++I FDE   I GA I  YLLE+SR++ Q  
Sbjct: 194 KILQANPILESFGNAQTVRNNNSSRFGKFIKIEFDEFGKINGAHIEWYLLEKSRIIQQNI 253

Query: 267 VERNYHIFYQLVEGLSESEKEELHLT--KVEDYHYLRQGGDYRIKGVDDAAEYQVTVDAL 324
            ERNYH+FYQL+ G+   + + L L    + DY YLR   +  I GVDDA ++   + A 
Sbjct: 254 RERNYHVFYQLLSGMPAGKLKTLELVSNSITDYAYLR-DSNPSIPGVDDAHDFSSLLSAF 312

Query: 325 KMVGFSQDTQHQLFKILAALLHIGNIEVKKTRND-ASLSSDEPNLKIACDLLGIDASGFS 383
            +VGF +D  H +F+ +A +LHIGN+E   TR + A++ +D   L   C L+G+D + F 
Sbjct: 313 NVVGFKEDEIHDIFQCIAIILHIGNVEFTSTRAEQATIKNDVAPL---CKLIGVDEAAFK 369

Query: 384 KWITKKQITTRSEKIVSNLSFNQALVARDSVAKFIFSALFDWLVENINTVLCNPQVSDQI 443
             + K +     E +  + +  Q+    +S+++ ++  LF  +V  IN  L +  +++  
Sbjct: 370 MAVLKPKSKAGKEWVSQSKNAAQSRFILNSLSRSLYEKLFAHIVRRINRSLDHGSMTE-- 427

Query: 444 SSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVNEQIEWSFIEF 503
            ++IG+LDI GFE F+ NSFEQ CINY NEKLQQ FN H+F LEQ EYV E I+W FI++
Sbjct: 428 -NYIGLLDIAGFEIFKDNSFEQLCINYTNEKLQQFFNHHMFVLEQREYVKEDIQWDFIDY 486

Query: 504 N-DNQPCIDLIE---NKLGILSLLDEESRLPAGSDESWTQKLYQTLD-KPPTNSVFSKPR 558
             D +  I+LIE   N  GILS+LDEES LP  +DES+  KL    D K P    F + +
Sbjct: 487 GKDLEYTIELIEKKNNPAGILSILDEESILPKSTDESFYSKLMSAWDGKSPK---FKRSK 543

Query: 559 FGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLEVLKASKNDTLLSILDTIDKNAAAL 618
             Q  FV+ HYA DV Y+V  ++ KN+D ++D HL  L +  ++ L+S   T        
Sbjct: 544 LQQC-FVLEHYAADVEYNVKDWLSKNKDPLND-HLLTLLSESSNKLISEFYT-------- 593

Query: 619 AEKQDANKKPGPARMVKKPTLGSMFKQSLIELMNTIDSTNVHYIRCIKPNEEKEAWKFDN 678
                       +R     T  +  K+ L  L++ + ST+ H++RCI PN +K+A  FD 
Sbjct: 594 ----------EQSRGHFSKTASNRHKEQLTLLLDQLSSTDPHFVRCIVPNTKKKAKTFDR 643

Query: 679 LMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILIPSDNWTKIFTSEASEDDIRN 738
            ++L QLR  GVLE IRI+  G+P+R  + EF  RY IL     ++         ++ + 
Sbjct: 644 KLILDQLRCNGVLEGIRIAREGYPNRIFFREFFQRYKILGADPKFS---------NNSKK 694

Query: 739 LCKQILGATVDDSNKYQLGNTKIFFKAGMLAYLEKLRSTKMHNSCVLIQKKIKGVYYRKQ 798
            C+ +L     D + Y++GNTK+FFKAG+LA LE  +           ++KI G+     
Sbjct: 695 NCEYLLSCISLDPSLYKVGNTKLFFKAGVLAQLETQK-----------EEKISGI----- 738

Query: 799 YLAIKNAIHNVQAVIAGNYCRQSVDHEFKTL-AAISLQTIF 838
                  +  + A+I G   R +++ +F+ L AA  L T F
Sbjct: 739 -------VTGLNAIIHGKTVRTAINLQFQKLQAAKVLSTTF 772

>Scas_688.22
          Length = 1876

 Score =  505 bits (1301), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 298/808 (36%), Positives = 472/808 (58%), Gaps = 62/808 (7%)

Query: 9   CWYPDKKEGWVGSEVTKFSQPXXXXXXXXXXXXXXXTVEIETETLNESQNEKLPLL-RNP 67
            W PD  + +  +EV +                   TV I  ET  E Q EK  L   NP
Sbjct: 8   VWIPDPDKIFTLAEVARIE---SVKNARTNVEEEMATVRI-METGEELQIEKSNLSPSNP 63

Query: 68  PILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQLYSQDMIQ 127
              + +++++ L++LNE +VLH ++ RY    IYTYSG+ L+A NP+  + ++Y+Q+ I 
Sbjct: 64  TSFDKVDNMSELTHLNEASVLHNLEKRYKDDMIYTYSGLFLVAINPYCNI-KIYTQEYIN 122

Query: 128 AYAGRRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIMRYFASV-- 185
            Y G  + + +PH++AIA+EAY+ +  +KQ+Q+++V+GESGAGKT + K I++Y AS+  
Sbjct: 123 LYNGSSKEDNKPHIYAIAEEAYQKLLTEKQDQSVLVTGESGAGKTENTKKILQYLASITS 182

Query: 186 -----EQANADNASSDHHLQMSET-EERILATNPIMEAFGNAKTSRNDNSSRFGKYLEIL 239
                 +A+   + +D+ +   E+ E +IL +NPI+E+FGNA+T RN+NSSRFGK+++I 
Sbjct: 183 NKSKYSEADLLVSQNDNEINQFESFEMKILQSNPILESFGNAQTVRNNNSSRFGKFIKIE 242

Query: 240 FDESTSIIGARIRTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLT--KVEDY 297
           FDE   I GA I  YLLE+SR++ Q   ERNYHIFYQL+ GLS  E  +L LT   V DY
Sbjct: 243 FDERGKINGAHIEWYLLEKSRVINQHPEERNYHIFYQLLAGLSLQELRKLELTSKSVSDY 302

Query: 298 HYLRQGGDYRIKGVDDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRN 357
            YL +     I GV+DA ++Q  + A   VGF+ +  + ++++L+ +LHIGN++    ++
Sbjct: 303 KYLSKSNP-SIPGVNDAQDFQDLLKAFTTVGFTHEEVNNIWQVLSIILHIGNVDFTSEKS 361

Query: 358 DASLSSDEPNLKIACDLLGIDASGFSKWITKKQITTRSEKIVSNLSFNQALVARDSVAKF 417
             +   ++P+      LLG+    F+  +   +     E +  + + +QA    +S+++ 
Sbjct: 362 QQATFKNDPS--TLAKLLGVTEKEFTTAVLTPKTKAGKEWVTQSKNASQARFILNSLSRT 419

Query: 418 IFSALFDWLVENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQ 477
           ++  LF ++VE IN  L +   S   +++IG+LDI GFE F+ NSFEQ CINY NEKLQQ
Sbjct: 420 LYEKLFSFIVERINNSLDH---SSMTANYIGLLDIAGFEIFKHNSFEQLCINYTNEKLQQ 476

Query: 478 EFNQHVFKLEQEEYVNEQIEWSFIEFN-DNQPCIDLIENK---LGILSLLDEESRLPAGS 533
            FN H+F LEQ EY+ E I+W+F++F  D Q  IDLIENK    G+L LLDEES LP  S
Sbjct: 477 FFNHHMFVLEQNEYMKENIQWNFVDFGKDLQASIDLIENKSSPTGVLPLLDEESILPNSS 536

Query: 534 DESWTQKLYQTLDKPPTNSVFSKPRFGQTK----FVVSHYALDVAYDVGGFIEKNRDTVS 589
           D+S+  KL  T D+         P+F ++K    FV+ HYA +V Y++ G++ KN+D +S
Sbjct: 537 DDSFFSKLISTWDQKS-------PKFIRSKLPQCFVLKHYAGEVEYNIEGWLSKNKDPLS 589

Query: 590 DGHLEVLKASKNDTLLSILDTIDKNAAALAEKQDANKKPGPARMVKKPTLGSMFKQSLIE 649
           +  + +L +S N+ + S  +  +KN         ++ +   AR  ++  L          
Sbjct: 590 ECMISMLSSSTNEIVTSFFNESNKNVRG------SSFRTASARHREQQML---------- 633

Query: 650 LMNTIDSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNE 709
           L+  +++T+ H++RCI PN  K+A  FD  ++L QLR  GVLE IRI+  G+P+R  + E
Sbjct: 634 LLKQLETTHPHFVRCIIPNNRKKAKDFDRKLILDQLRCNGVLEGIRIAREGYPNRIFFKE 693

Query: 710 FVLRYHILIPSDNWTKIFTSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAGMLA 769
           F  RY +L   +++   F            C+ +L +   D + Y++G +K+FFKAG+LA
Sbjct: 694 FFQRYRLLSDENHFATGFKKN---------CEILLSSLHLDPSLYKIGTSKLFFKAGVLA 744

Query: 770 YLEKLRSTKMHNSCVLIQKKIKGVYYRK 797
            LE  +  ++ +  +     ++G   RK
Sbjct: 745 ELETKKDQRIRSIVIRFNSHLRGRIIRK 772

>Kwal_23.5534
          Length = 1907

 Score =  504 bits (1298), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 365/1112 (32%), Positives = 590/1112 (53%), Gaps = 130/1112 (11%)

Query: 66   NPPILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQLYSQDM 125
            NP   + I+D++ L++LNEP+VLH ++ RY   NIYTYSG+ L+A NP+  + ++YSQD 
Sbjct: 55   NPSTFDRIDDMSELTHLNEPSVLHNLENRYADDNIYTYSGLFLVAINPYSNI-RIYSQDY 113

Query: 126  IQAYAGRRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIMRYFASV 185
            +  Y G  + + +PH+FAIA+EAY+ +  ++++Q+I+V+GESGAGKT + K I++Y AS+
Sbjct: 114  VNLYHGSPKEDNKPHIFAIAEEAYQNLLSERRDQSILVTGESGAGKTENTKKILQYLASI 173

Query: 186  EQANADNASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGKYLEILFDESTS 245
                +D+  S    Q S  E +IL +NPI+E+FGNA+T RN+NSSRFGK+++I FDE   
Sbjct: 174  ---TSDDKLSPDTSQES-FERKILQSNPILESFGNAQTVRNNNSSRFGKFIKIEFDELGK 229

Query: 246  IIGARIRTYLLERSRLVFQPQVERNYHIFYQLVEGLSESE--KEELHLTKVEDYHYLRQG 303
            I GA +  YLLE+SR++ Q   ERNYHIFYQ++ G+S  E  +  L    ++DY YLR  
Sbjct: 230  INGAHVDWYLLEKSRVIQQNSRERNYHIFYQMLSGMSAQELRRYGLETNSIKDYGYLR-N 288

Query: 304  GDYRIKGVDDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRNDASLSS 363
             +  I GVDD+ +++  + + ++VGFS+D    +   ++ +LHIGNIE    R  A  +S
Sbjct: 289  SNPSIPGVDDSQDFRTLLSSFQIVGFSEDEIQSMLTCISIILHIGNIEFVSER--AEQAS 346

Query: 364  DEPNLKIACDLLGIDASGFSKWITKKQITTRSEKIVSNLSFNQALVARDSVAKFIFSALF 423
             + +++  C+LLG+  + F   + K +     + +    + +QA    +S+++ ++  LF
Sbjct: 347  FDGSVETLCNLLGVTEADFKVAVLKPRAKAGKDWVSQAKNAHQARFILNSLSRSLYENLF 406

Query: 424  DWLVENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHV 483
              +V+ IN  L +  +++   ++IG+LDI GFE F+ NSFEQ CINY NEKLQQ FN H+
Sbjct: 407  AHIVQRINNNLDHGSMTE---NYIGLLDIAGFEIFKHNSFEQLCINYTNEKLQQFFNHHM 463

Query: 484  FKLEQEEYVNEQIEWSFIEFN-DNQPCIDLIE---NKLGILSLLDEESRLPAGSDESWTQ 539
            F LEQ EY+ E ++W+FI++  D Q  IDLIE    K GIL LLDEES LP  +DES+  
Sbjct: 464  FVLEQNEYLKENVQWNFIDYGKDLQSTIDLIERKDTKPGILPLLDEESILPKSTDESFYS 523

Query: 540  KLYQTLDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLEVLKAS 599
            KL +T       S   K    Q  FV+ HYA DV Y+V G++ KN+D + +  L++L  S
Sbjct: 524  KL-ETF--YSDKSSKFKRSKKQRCFVLKHYAGDVEYNVDGWLSKNKDPLHENLLQMLSNS 580

Query: 600  KNDTLLSILDTIDKNAAALAEKQDANKKPGPARMVKKPTLGSMFKQSLIELMNTIDSTNV 659
             N+ +       D   ++                    T     +  L  L++ + ST  
Sbjct: 581  SNELIRGFYSEKDSRGSSF------------------KTTSIRHRDQLKSLLDRLSSTEP 622

Query: 660  HYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILIP 719
            H++RCI PN++K+A  F+  ++L QLR  GVLE IRI+  G+P+R  + EF  RY IL  
Sbjct: 623  HFVRCIIPNDKKKAHDFNRKLILDQLRCNGVLEGIRIAREGYPNRIFFKEFFQRYKIL-- 680

Query: 720  SDNWTKIFTSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAGMLAYLEKLRSTKM 779
            SD +    TS+ +       C+ +L +   D + +++GN+K+FFKAG+LA LE  +  + 
Sbjct: 681  SDEYRFSNTSKKN-------CEIVLSSLRLDPSVFKVGNSKLFFKAGVLASLEAKKEGR- 732

Query: 780  HNSCVLIQKKIKGVYYRKQYLAIKNAIHNVQAVIAGNYCRQSVDHEFKTL-AAISLQTIF 838
                                  I +    + A I GN  R+S   + K L AA  L + F
Sbjct: 733  ----------------------ISDMASKLNARINGNAVRRSTSQKLKKLQAAQVLGSAF 770

Query: 839  RGVRQRKNATIALASIVRVQSLVRKQIAQKEVLEKRQ-SEAAVTIQKKIRGFVPRQSYNA 897
                Q+       +  V+++ L+    + +E+ + R+ +E    +++K++    +     
Sbjct: 771  ETY-QKMMGDPWFSLYVKIKPLLE---STQEISKTRKIAEQVKNLEEKLKTLELQNQALG 826

Query: 898  TRGSSVKIQSLVRRXXXXXXXXXXXXXXXSVNHLQEVSYKLENKVIQLTQSLAEKVKENR 957
               S++                       SVN L  V  +L  +    +Q LA+K K+  
Sbjct: 827  EEKSAI-----------------------SVN-LASVKERLATE----SQELAQKQKDLD 858

Query: 958  DMTAKIQDLQKSLNESANIKSLLDAQKD-------DHSRDLQEQK-TSHDAELANKKIEL 1009
             + AK  +L++ LNES  ++  +  +KD       D S  L+EQ     +AEL  K  E 
Sbjct: 859  SVLAKEAELKQKLNESNELQQEIMQKKDTELKLKLDESNKLREQTFAEKEAELQQKFDES 918

Query: 1010 DNXXXXXXXXXXXXXDLLSQQEQLK---ADVRAKV----EELNNVQQEFEDSRTQNSDLR 1062
            +                L+++E L+   ++ RAK     EE    Q  ++   ++N  L+
Sbjct: 919  EKLRQH----------FLAEKEALQKEYSEARAKADQNREETEKSQSLYKKLLSENDQLK 968

Query: 1063 NEVKSLKDEINRLQTSIRSGANSNTILAHTPTKSRRFSAHSSLTDASPRQLNVISMNNGM 1122
            N+V +L  +I+  + S RS  +    L H   KS      S  T+ +  +  +   +  +
Sbjct: 969  NQVTNLTTKIDDGERSFRSIESDKASL-HDQIKSLNSEVLSKTTEINELKTKLSESDKEL 1027

Query: 1123 EDDARSTASALSQINDELYKILEDTKSLNIEI 1154
            E   +      +  +  L  ++E+ KSL + +
Sbjct: 1028 ERSLQGLEKKFTSASKRLTSLVEENKSLRVSM 1059

>KLLA0E11572g complement(1018972..1024518) similar to sp|P08964
           Saccharomyces cerevisiae YHR023w MYO1 myosin-1 isoform
           (type II myosin) heavy chain, start by similarity
          Length = 1848

 Score =  493 bits (1270), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 296/778 (38%), Positives = 450/778 (57%), Gaps = 82/778 (10%)

Query: 66  NPPILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQLYSQDM 125
           NP   + ++DL+ L++LNE +VL  ++ RY    IYTYSG+ L+A NP+  + ++YS   
Sbjct: 59  NPSTFDKVDDLSELTHLNEASVLFNLQNRYQDDLIYTYSGLFLVAINPYSNI-KIYSNSY 117

Query: 126 IQAYAGRRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIMRYFASV 185
           I+ Y G  + + +PH+FA+A++AY+ + H KQ+Q+I+V+GESGAGKT + K I++Y AS+
Sbjct: 118 IKLYHGSPKEDNKPHIFAVAEQAYQNLLHQKQDQSILVTGESGAGKTENTKKILQYLASI 177

Query: 186 EQANADNASSDHHLQMSET----EERILATNPIMEAFGNAKTSRNDNSSRFGKYLEILFD 241
                   ++D  + +++T    E +IL +NPI+E+FGNA+T RN+NSSRFGK+++I FD
Sbjct: 178 --------TTDDKILLNQTNESFERKILQSNPILESFGNAQTVRNNNSSRFGKFIKIDFD 229

Query: 242 ESTSIIGARIRTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHL--TKVEDYHY 299
           E   I GA I  YLLE+SR++     ERNYHIFYQ++ G+S+ E   + L    + DY Y
Sbjct: 230 EYGKINGAHIEWYLLEKSRVIQAHARERNYHIFYQILSGMSKQELRAIGLESNSIVDYQY 289

Query: 300 LRQGGDYRIKGVDDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRND- 358
           LR      I G+DD   YQ  V A + VGF++D    + K ++ +LHIGN+E    R++ 
Sbjct: 290 LRHSNP-SIPGIDDGQNYQELVSAFETVGFTKDDIQSILKCISIILHIGNVEFVSERSEQ 348

Query: 359 ASLSSDEPNLKIACDLLGIDASGFSKWITKKQITTRSEKIVSNLSFNQALVARDSVAKFI 418
           AS+ +D   +K  C LLG+    F   + K +     E +    + +QA    +S+++ +
Sbjct: 349 ASIKND---IKPLCKLLGVQEDDFKSAVLKPKSKAGKEWVSQAKNASQARSILNSLSRSL 405

Query: 419 FSALFDWLVENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQE 478
           +  LF+++V  IN  L +  +++    FIG+LDI GFE F+ NSFEQ CINY NEKLQQ 
Sbjct: 406 YEKLFEYIVNQINKSLEHGSMTE---YFIGLLDIAGFEIFKDNSFEQLCINYTNEKLQQF 462

Query: 479 FNQHVFKLEQEEYVNEQIEWSFIEFN-DNQPCIDLIENK----LGILSLLDEESRLPAGS 533
           FN H+F LEQ EY  E I+W+FI++  D Q  IDLIE K     GIL +L+EES LP  S
Sbjct: 463 FNHHMFVLEQNEYQKEDIQWNFIDYGKDLQTTIDLIEQKNSSIPGILPILEEESILPKSS 522

Query: 534 DESWTQKLYQTLDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHL 593
           D S+  KL  + D   T   F + +     F++ HYA DV Y+V  ++ KN+D +++  L
Sbjct: 523 DASFYSKLLSSWDNKSTK--FKRSKLDNC-FILKHYAGDVEYNVTDWLSKNKDPLNENLL 579

Query: 594 EVLKASKNDTLLSILDTIDKNAAALAEKQDANKKPGPARMVKKPTLGSMFKQSLIELMNT 653
           +VL    ND            A  L  +  A++  G +      T  +  ++ L  L+  
Sbjct: 580 QVL----NDC-----------ANPLVSQFFADRIRGSSF----RTSSNKHREQLHTLIEQ 620

Query: 654 IDSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLR 713
           + +T+ H++RCI PN +K+A  FD  ++L QLR  GVLE IRI+  G+P+R  + EF  R
Sbjct: 621 LGNTDPHFVRCIIPNNKKKAGDFDKKLILDQLRCNGVLEGIRIARDGYPNRIFFKEFFQR 680

Query: 714 YHILIPSDNWTKIFTSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAGMLAYLEK 773
           Y IL  SD     FT+ + ++     C+ +L +   D   Y++GNTK+FFKAG+LA LE 
Sbjct: 681 YKIL--SDECR--FTNNSKKN-----CEILLSSLHLDPTIYKVGNTKLFFKAGVLANLEL 731

Query: 774 LRSTKMHNSCVLIQKKIKGVYYRKQYLAIKNAIHNVQAVIAGNYCRQSVDHEFKTLAA 831
           L+  ++                         A+  + A+I+ N  R+ +    K L A
Sbjct: 732 LKEQRLS-----------------------AAVTRLNAIISANSVRKEIRSHLKKLQA 766

>CAGL0J00693g complement(61246..66900) similar to sp|P08964
           Saccharomyces cerevisiae YHR023w MYO1, hypothetical
           start
          Length = 1884

 Score =  482 bits (1240), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 296/774 (38%), Positives = 448/774 (57%), Gaps = 48/774 (6%)

Query: 66  NPPILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQLYSQDM 125
           NP   + +++++ L++LNEP+VL+ ++ RY    IYTYSG+ L+A NP+  +  LYS   
Sbjct: 61  NPANFDRVDNMSELTHLNEPSVLNNLENRYKDNLIYTYSGLFLVAINPYKEISNLYSNST 120

Query: 126 IQAY-AGRRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIMRYFAS 184
           I++Y +       +PH+F +A+ AYR +K  KQ+Q+I+V+GESGAGKT + K I++Y AS
Sbjct: 121 IKSYHSSNEETSQKPHIFEVAESAYRDLKSKKQDQSILVTGESGAGKTENTKKILQYLAS 180

Query: 185 VEQANADNASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGKYLEILFDEST 244
           +    +D+    ++ +M     +IL +NP++E+FGNA+T RN+NSSRFGK+++I FD+S 
Sbjct: 181 I---TSDSFEVSNNFEM-----KILQSNPVLESFGNAQTVRNNNSSRFGKFIKIEFDQSG 232

Query: 245 SIIGARIRTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKVEDY-HY-LRQ 302
            I GA I  YLLE+SR+  + + ERNYHIFYQL++G S+ + E ++     D+ HY +  
Sbjct: 233 KINGAFIEWYLLEKSRITNENRNERNYHIFYQLLKGTSQKDLESIYKLSSNDFAHYQILA 292

Query: 303 GGDYRIKGVDDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIE-VKKTRNDASL 361
             ++ I GVDDAAE+Q  + AL+ VGF +D  + +FKI+A +LH GNIE V +    AS 
Sbjct: 293 NSNHVIPGVDDAAEFQKLLVALETVGFGKDQINSIFKIVAVILHCGNIEFVSEKSEQASF 352

Query: 362 SSDEPNLKIACDLLGIDASGFSKWITKKQITTRSEKIVSNLSFNQALVARDSVAKFIFSA 421
            SD   +     LLG+  S F   I K +     E +    + NQA    +S+ + ++  
Sbjct: 353 KSD---ISAIATLLGVSESDFKTAILKPRSKAGREWVSQAKNANQARFIINSLCRTLYEH 409

Query: 422 LFDWLVENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQ 481
           LF ++V+ IN  L +  ++   +++IG+LDI GFE FE NSFEQ CINY NEKLQQ FN 
Sbjct: 410 LFGYIVDTINMSLNHGSMT---ANYIGLLDIAGFEIFEHNSFEQLCINYTNEKLQQFFNH 466

Query: 482 HVFKLEQEEYVNEQIEWSFIEFN-DNQPCIDLIENK---LGILSLLDEESRLPAGSDESW 537
           H+F LEQ EY+ E I+W ++++  D Q  I+L+E K    GIL LLDEE+ LP   D S+
Sbjct: 467 HMFVLEQSEYLKENIQWDYVDYGKDLQSTINLLEAKGPPTGILPLLDEETILPKSEDSSF 526

Query: 538 TQKLYQTLDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLEVLK 597
             KL  T  +  T   F + +     FV+ HYA DV Y V G++ KN+D +++  + +L 
Sbjct: 527 YSKLISTWQQNSTK--FKRSKLDMC-FVLKHYAGDVEYHVNGWLAKNKDPLNENLVNILS 583

Query: 598 ASKNDTLLSILDTIDKNAAAL--------AEKQDANKKPGPARMVKKPTLGSMFKQSLIE 649
            S N  +       +  ++          +    +    G  R   K  L S  ++    
Sbjct: 584 VSSNRLISEFFSGFESISSPSSSPTRLTHSSSSASINSLGKGRTNLKTAL-SRHREQQSS 642

Query: 650 LMNTIDSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNE 709
           L++ +  TN H++RCI PN +K +  FD  ++L QLR  GVLE IRI+  G+P+R  + E
Sbjct: 643 LLSQLALTNPHFVRCIIPNNKKMSETFDRRLILDQLRCNGVLEGIRIAREGYPNRILFKE 702

Query: 710 FVLRYHILIPSDNWTKIFTSEASEDDIR-NLCKQILGATVD-DSNKYQLGNTKIFFKAGM 767
           F  RY IL  S++  K      S D I      QIL + +  D   Y++G +K+FFKAG 
Sbjct: 703 FYERYRIL--SEHLDK------SSDAINYKQSSQILISELHLDPTTYKVGTSKLFFKAGT 754

Query: 768 LAYLEKLRSTKMHNSCVLIQKKIKGVYYRKQYLAIKNAIHNVQAV-IAGNYCRQ 820
           LA LE  + + +    V     I+G   RK+    K  I  ++A  + GN  R+
Sbjct: 755 LAELESKKESILFEITVRFNSIIRGWSQRKR---TKGEIQKMRASEMIGNVFRK 805

>KLLA0B12562g complement(1095953..1099735) similar to sp|Q04439
           Saccharomyces cerevisiae YMR109w MYO5 myosin I, start by
           similarity
          Length = 1260

 Score =  457 bits (1176), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 285/773 (36%), Positives = 425/773 (54%), Gaps = 53/773 (6%)

Query: 72  AIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQLYSQDMIQAYAG 131
            + DLT LS +++ A+   +K R+    IYTY G VLI+ NPF R   +Y+  ++++Y G
Sbjct: 35  GVSDLTLLSSISDDAINQNLKKRFENGTIYTYIGHVLISVNPF-RDLGIYTDAVLESYKG 93

Query: 132 RRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEQANAD 191
           + R E+ PH+FAIA+  Y  +K   +NQ +++SGESGAGKT +AK IM+Y A+       
Sbjct: 94  KNRLEVPPHVFAIAEAMYYNLKAYNENQCVIISGESGAGKTEAAKRIMQYIAA------- 146

Query: 192 NASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGKYLEILFDESTSIIGARI 251
            ASS H   + + ++ +LATNP++E+FG AKT RN+NSSR GKYLEI F+E       +I
Sbjct: 147 -ASSTHEASIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNEQFEPCAGQI 205

Query: 252 RTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKVEDYHYLRQGGDYRIKGV 311
             YLLE+ R+V Q + ERN+HIFYQ  +G S++ ++   + + + Y Y    G   +  +
Sbjct: 206 TNYLLEKQRVVGQIRNERNFHIFYQFTKGASDTYRQNFGVLQPDQYIYTSASGCTSVDTI 265

Query: 312 DDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRNDASLSSDEPNLKIA 371
           DD  +YQ T+ A++++G SQ+ Q Q+F++L+A+L IGN+   +     +   D       
Sbjct: 266 DDLHDYQETIKAMQVIGLSQEEQDQIFRMLSAILWIGNVTFVENNEGNAEVRDTSVTDFV 325

Query: 372 CDLLGIDASGFSKWITKKQITT-----RSEKIVSNLSFNQALVARDSVAKFIFSALFDWL 426
             L+ +D+    K + ++ + T     R       L+  QA   RD++AK I++ LFDW+
Sbjct: 326 AYLMQVDSGLLIKCLVERVMETGHGSRRGSVYHVPLNVVQATAVRDALAKAIYNNLFDWI 385

Query: 427 VENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKL 486
           V+ +N  L        + S IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K 
Sbjct: 386 VDRVNVSL--KAFPGAVKS-IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKS 442

Query: 487 EQEEYVNEQIEWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTQKLYQT 544
           EQEEY  EQI+W+ I++ DN+   DLIE+K   GI + LD+          +  Q   Q 
Sbjct: 443 EQEEYNKEQIQWTPIKYFDNKVVCDLIESKRPPGIFATLDDSVATAHADSNAADQAFAQR 502

Query: 545 LDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLEVLKASKNDTL 604
           L+   TN+ F       +KFV+ HYA DV YD+ G  +KN+D +     E+++ + N  L
Sbjct: 503 LNLFSTNAHFD---LRSSKFVIKHYAGDVTYDISGMTDKNKDQLVKDLAELVQTTTNPFL 559

Query: 605 LSIL-DTIDKNAAALAEKQDANKKPGPARMVKKPTLGSMFKQSLIELMNTIDSTNVHYIR 663
            +I  DTIDK+         + ++P        PT G+   +S  EL+ T+      YIR
Sbjct: 560 STIFPDTIDKS---------SKRRP--------PTAGNKIIKSANELVETLSKAQPSYIR 602

Query: 664 CIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILIPSDNW 723
            IKPN+ K    +D+  VL Q++  G+ E +RI  AGF  R T+ +FV R+++L P  ++
Sbjct: 603 TIKPNQTKSPRDYDDQQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSPKCSY 662

Query: 724 TKIFTSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAG-MLAYLEKLRSTKMHNS 782
              +T +    D     KQIL      + +YQLG TK+F K    L  LE +R    +N 
Sbjct: 663 AGDYTWQG---DTLGAVKQILQDASIPTTEYQLGVTKVFIKTPETLFALEHMRDRYWYNM 719

Query: 783 CVLIQKKIKGVYYRKQYLAIKNAIHNVQAVI----AGNYCRQSVDHEFKTLAA 831
              IQ+  +    R+   AIK     +Q  I     GN   Q  D+  + L  
Sbjct: 720 AARIQRAWRRFIQRRIDSAIK-----IQRAIREKKGGNQYEQLRDYGHRLLGG 767

>Kwal_26.7587
          Length = 1250

 Score =  442 bits (1138), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 279/775 (36%), Positives = 420/775 (54%), Gaps = 57/775 (7%)

Query: 72  AIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQLYSQDMIQAYAG 131
            + DLT LS +++ A+   +K R+    IYTY G VLI+ NPF R   +Y+  ++++Y G
Sbjct: 37  GVSDLTLLSKISDEAINENLKKRFQNGTIYTYIGHVLISVNPF-RDLGIYTDSVLRSYVG 95

Query: 132 RRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEQANAD 191
           + R E+ PH+FAIA+  Y  MK   +NQ +++SGESGAGKT +AK IM+Y A+       
Sbjct: 96  KNRLEVAPHVFAIAESMYYNMKAYNENQCVIISGESGAGKTEAAKRIMQYIAA------- 148

Query: 192 NASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGKYLEILFDESTSIIGARI 251
            AS  H   + + ++ +LATNP++E+FG AKT RN+NSSR GKYLEI F+         I
Sbjct: 149 -ASETHSDSIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNAQFEPCAGNI 207

Query: 252 RTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKVEDYHYLRQGGDYRIKGV 311
             YLLE+ R+V Q + ERN+HIFYQ  +G S++ ++   + K E Y Y    G   +  +
Sbjct: 208 TNYLLEKQRVVGQLKDERNFHIFYQFTKGASDNYRQIYGVQKPEQYLYTSASGCTSVDTI 267

Query: 312 DDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRNDASLSSDEPNLKIA 371
           DD +++Q T++A+ ++G +Q  Q ++F+ LAA+L IGNI   +     +   D       
Sbjct: 268 DDLSDFQETLNAMSVIGITQHEQDEVFRFLAAILWIGNISFTENEEGNAQVRDTSVTDFV 327

Query: 372 CDLLGIDASGFSKWITKKQITT-----RSEKIVSNLSFNQALVARDSVAKFIFSALFDWL 426
             LL +D++   + + ++ + T     R       L+  QA   +D++AK I++ LFDW 
Sbjct: 328 AYLLQVDSNLLVQALVERVMETNHGMKRGSIYHVPLNVVQATAVKDALAKAIYNNLFDWT 387

Query: 427 VENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKL 486
           V+ +N  L   Q     +  IG+LDIYGFE F+ NSFEQ CINY NEKLQQ F Q   K 
Sbjct: 388 VDRVNLSL---QALPGANKSIGILDIYGFEIFDYNSFEQICINYVNEKLQQIFIQLTLKS 444

Query: 487 EQEEYVNEQIEWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTQKLYQT 544
           EQEEY  EQIEW+ I++ DN+   DLIE +   GI++ +++         ++  Q   Q 
Sbjct: 445 EQEEYAREQIEWTPIKYFDNRVVCDLIEARRPPGIIAAMNDSVATAHADSDAADQAFAQR 504

Query: 545 LDKPPTNSVFSKPRF--GQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLEVLKASKND 602
           L     N   S P F    +KF++ HYA DV YD+ G  +KN+D +    +E++K S N+
Sbjct: 505 L-----NLFSSNPHFELRSSKFIIKHYAGDVTYDIFGMTDKNKDQLQKDLVELVKTSSNE 559

Query: 603 TLLSILDT-IDKNAAALAEKQDANKKPGPARMVKKPTLGSMFKQSLIELMNTIDSTNVHY 661
            L S+  T +DKN         + ++P        P+ G    +S  EL+ T+      Y
Sbjct: 560 FLCSLFPTVVDKN---------SKRRP--------PSAGDKIIKSANELVETLSKAQPSY 602

Query: 662 IRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILIPSD 721
           IR IKPN+ K    +D+  VL Q++  G+ E +RI  AGF  R  +++FV R+++L P  
Sbjct: 603 IRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQVFDKFVERFYLLSPQC 662

Query: 722 NWTKIFTSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAG-MLAYLEKLRSTKMH 780
           ++   +T +    D     K IL        +YQLG +K+F K    L  LE +R    H
Sbjct: 663 SYAGDYTWQG---DTLEAVKLILKDASIPPTEYQLGVSKVFIKTPESLFALETMRDKYWH 719

Query: 781 NSCVLIQKKIKGVYYRKQYLAIKNAIHNVQAVI----AGNYCRQSVDHEFKTLAA 831
           N    IQ+      +R+  L   +A   +Q  I     GN   +  D+  K LA 
Sbjct: 720 NMAARIQRA-----WRRFLLRRIDAASRIQRAIREKKGGNEFEKLRDYGSKLLAG 769

>YMR109W (MYO5) [4066] chr13 (486586..490245) Myosin type I, may
           play a role in cell growth or polarity that is partially
           redundant with Myo3p, appears to stimulate actin patch
           formation, has an SH3 domain [3660 bp, 1219 aa]
          Length = 1219

 Score =  441 bits (1133), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 269/726 (37%), Positives = 395/726 (54%), Gaps = 44/726 (6%)

Query: 72  AIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQLYSQDMIQAYAG 131
            + DLT LS +++ A+   +K R+    IYTY G VLI+ NPF R   +Y+  ++  Y G
Sbjct: 37  GVSDLTLLSKISDEAINENLKKRFLNATIYTYIGHVLISVNPF-RDLGIYTDAVMNEYKG 95

Query: 132 RRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEQANAD 191
           + R E+ PH+FAIA+  Y  MK   +NQ +++SGESGAGKT +AK IM+Y A+       
Sbjct: 96  KNRLEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIAA------- 148

Query: 192 NASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGKYLEILFDESTSIIGARI 251
            ASS H   + + ++ +LATNP++E+FG AKT RN+NSSR GKYLEI F+         I
Sbjct: 149 -ASSTHTESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNNQFEPCAGNI 207

Query: 252 RTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKVEDYHYLRQGGDYRIKGV 311
             YLLE+ R+V Q + ERN+HIFYQ  +G S++ ++   + K E Y Y    G    + +
Sbjct: 208 TNYLLEKQRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQKPEQYVYTAAAGCISAETI 267

Query: 312 DDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRNDASLSSDEPNLKIA 371
           DD  +YQ T+ A++++G  Q+ Q Q+F++LAA+L IGN+   +     +   D       
Sbjct: 268 DDLQDYQETLKAMRVIGLGQEEQDQIFRMLAAILWIGNVSFIENEEGNAQVRDTSVTDFV 327

Query: 372 CDLLGIDASGFSKWITKKQITT-----RSEKIVSNLSFNQALVARDSVAKFIFSALFDWL 426
             LL ID+    K + ++ + T     R       L+  QA   RD++AK I++ LFDW+
Sbjct: 328 AYLLQIDSQLLIKSLVERIMETNHGMKRGSVYHVPLNIVQADAVRDALAKAIYNNLFDWI 387

Query: 427 VENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKL 486
           V  +N  L   Q        IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K 
Sbjct: 388 VSRVNKSL---QAFPGAEKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKS 444

Query: 487 EQEEYVNEQIEWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTQKLYQT 544
           EQE Y  E+I+W+ I++ DN+   DLIE +   GI + +++          +  Q   Q 
Sbjct: 445 EQETYEREKIQWTPIKYFDNKVVCDLIEARRPPGIFAAMNDSVATAHADSNAADQAFAQR 504

Query: 545 LDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLEVLKASKNDTL 604
           L+   TN  F        KFV+ HYA DV YD+ G  +KN+D +    +E++  + N  L
Sbjct: 505 LNLFTTNPHFD---LRSNKFVIKHYAGDVTYDIDGITDKNKDQLQKDLVELIGTTTNTFL 561

Query: 605 LSIL-DTIDKNAAALAEKQDANKKPGPARMVKKPTLGSMFKQSLIELMNTIDSTNVHYIR 663
            +I  DT+D+         ++ ++P        PT G    +S  +L+ T+      YIR
Sbjct: 562 ATIFPDTVDR---------ESKRRP--------PTAGDKIIKSANDLVETLSKAQPSYIR 604

Query: 664 CIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILIPSDNW 723
            IKPNE K    +D+  VL Q++  G+ E +RI  AGF  R  + +FV R+++L P  ++
Sbjct: 605 TIKPNETKSPNDYDDRQVLHQIKYLGLQENVRIRRAGFAYRQVFEKFVERFYLLSPHCSY 664

Query: 724 TKIFTSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAG-MLAYLEKLRSTKMHNS 782
              +T +    D  +  K IL  +     +YQLG T +F K    L  LE +R    HN 
Sbjct: 665 AGDYTWQG---DTLDAVKYILQDSSIPQQEYQLGVTSVFIKTPETLFALEHMRDRYWHNM 721

Query: 783 CVLIQK 788
              IQ+
Sbjct: 722 AARIQR 727

>Scas_721.119
          Length = 1232

 Score =  437 bits (1125), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 269/727 (37%), Positives = 393/727 (54%), Gaps = 48/727 (6%)

Query: 72  AIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQLYSQDMIQAYAG 131
            + DLT LS +++  +   +K R+    IYTY G VLI+ NPF R   +Y+  ++++Y G
Sbjct: 37  GVSDLTLLSKISDETINDNLKKRFMNGTIYTYIGHVLISVNPF-RDLGIYTDAIVESYKG 95

Query: 132 RRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEQANAD 191
           + R E+ PH+FAIA+  Y  MK   +NQ +++SGESGAGKT +AK IM+Y AS       
Sbjct: 96  KNRLEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIAS------- 148

Query: 192 NASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGKYLEILFDESTSIIGARI 251
            AS+ H   + + ++ +LATNP++E+FG AKT RN+NSSR GKYLEI F+         I
Sbjct: 149 -ASTTHSESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNSQFEPCAGNI 207

Query: 252 RTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKVEDYHYLRQGGDYRIKGV 311
             YLLE+ R+V Q + ERN+HIFYQ  +G S++ ++   + K E Y Y    G   +  +
Sbjct: 208 TNYLLEKQRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQKPEQYIYTSASGCTSVDTI 267

Query: 312 DDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRNDASLSSDEPNLKIA 371
           DD  +Y+ T+ A++++G  Q+ Q Q+F++LAA+L IGN+   +     +   D       
Sbjct: 268 DDVNDYRETLKAMEVIGLHQEEQDQIFRMLAAVLWIGNVSFVENEEGNAQVRDTSVTDFV 327

Query: 372 CDLLGIDASGFSKWITKKQITT-----RSEKIVSNLSFNQALVARDSVAKFIFSALFDWL 426
             LL IDA    K + ++ + T     R       L+  QA   RD++AK I++ LF+W+
Sbjct: 328 AYLLQIDAPLLIKSLVERVMETNHGMRRGSVYHVPLNIVQATAVRDALAKAIYNNLFEWI 387

Query: 427 VENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKL 486
           V  +N  L   Q        IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K 
Sbjct: 388 VGRVNVSL---QAYPGADRSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKS 444

Query: 487 EQEEYVNEQIEWSFIEFNDNQPCIDLIENK--LGILSLLDEESRLPAGSDESWTQKLYQT 544
           EQE Y  E+I+W+ I++ DN+   DLIE K   GI + +++          +  Q   Q 
Sbjct: 445 EQETYKREKIKWTPIKYFDNKVVCDLIEAKRPPGIFAAMNDSVATAHADSNAADQAFAQR 504

Query: 545 LDKPPTNSVFSKPRF--GQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLEVLKASKND 602
           L     N   S P F     KFV+ HYA DV YDV G  +KN+D +    +E++  + N 
Sbjct: 505 L-----NMFSSNPHFELRSNKFVIKHYAGDVTYDVNGITDKNKDQLQKDLVELIATTTNP 559

Query: 603 TLLSILDT-IDKNAAALAEKQDANKKPGPARMVKKPTLGSMFKQSLIELMNTIDSTNVHY 661
            L  I    +DK         ++ ++P        PT G    +S  EL+ T+      Y
Sbjct: 560 FLSGIFPVEVDK---------ESKRRP--------PTAGDKIIKSANELVETLSKAQPSY 602

Query: 662 IRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILIPSD 721
           IR IKPN+ K    +D+  VL Q++  G+ E +RI  AGF  R T+ +FV R+++L P  
Sbjct: 603 IRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSPHC 662

Query: 722 NWTKIFTSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAG-MLAYLEKLRSTKMH 780
           ++   +T +    D     + IL      +++YQLG T +F K    L  LE +R    H
Sbjct: 663 SYAGDYTWQGETLD---AVQHILNDASIPASEYQLGTTSVFIKTPETLFALEHMRDRYWH 719

Query: 781 NSCVLIQ 787
           N    IQ
Sbjct: 720 NMAARIQ 726

>AEL306C [2199] [Homologous to ScYMR109W (MYO5) - SH; ScYKL129C
           (MYO3) - SH] (65141..69019) [3879 bp, 1292 aa]
          Length = 1292

 Score =  431 bits (1107), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 284/781 (36%), Positives = 419/781 (53%), Gaps = 69/781 (8%)

Query: 72  AIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQLYSQDMIQAYAG 131
            + DLT LS +++  +   +K R+   +IYTY G VLI+ NPF R   +Y+  +++ Y G
Sbjct: 36  GVSDLTLLSKISDEHINENLKRRFENGSIYTYIGHVLISVNPF-RDLGIYTDQVLETYKG 94

Query: 132 RRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEQANAD 191
           R R E+ PH+FAIA+  Y  +K   +NQ +++SGESGAGKT +AK IM+Y A+   ++  
Sbjct: 95  RNRLEVPPHVFAIAEAMYYNLKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASSSHE- 153

Query: 192 NASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGKYLEILFDESTSIIGARI 251
                    +   ++ +LATNP++E+FG AKT RN+NSSR GKYLEI F+        +I
Sbjct: 154 -------ASIGRIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNAQFEPCAGQI 206

Query: 252 RTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKVEDYHYLRQGGDYRIKGV 311
             YLLE+ R+V Q + ERN+HIFYQ  +G S+  ++   +   E Y Y    G   +  +
Sbjct: 207 TNYLLEKQRVVGQIKNERNFHIFYQFSKGASDRYRKTYGVQLPEQYVYTSASGCTSVDTI 266

Query: 312 DDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRNDASLSSDEPNLKIA 371
           DD  +Y+ T++A+ ++G SQ  Q ++F++L+A+L IGN+          +  DE N KIA
Sbjct: 267 DDLNDYEATLEAMNVIGLSQAEQDEIFRLLSAILWIGNVTF--------MEDDEGNAKIA 318

Query: 372 --------CDLLGIDASGFSKWITKKQITTR---SEKIVSNLSFN--QALVARDSVAKFI 418
                     LL +DA    K + ++ I T        + N+  N  QA   RD++AK I
Sbjct: 319 DTSITDFVAYLLQVDAGLLVKSLVERTIETTHGMRRGSIYNVPLNIVQATAVRDALAKAI 378

Query: 419 FSALFDWLVENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQE 478
           ++ LF+W+V+ +N  L   Q        IG+LDIYGFE FE NSFEQ CINY NEKLQQ 
Sbjct: 379 YNNLFEWIVDRVNVSL---QALPGAEKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQI 435

Query: 479 FNQHVFKLEQEEYVNEQIEWSFIEFNDNQPCIDLIENK--LGILSLLDEESRLPAGSDES 536
           F Q   K EQEEY  EQI+W+ I++ DN+   +LIE K   GI + L++          +
Sbjct: 436 FIQLTLKSEQEEYAKEQIQWTPIKYFDNKVVCELIEAKRPPGIFAALNDSVATAHADSNA 495

Query: 537 WTQKLYQTLDKPPTNSVFSKPRF--GQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLE 594
             Q   Q L     N   S P F    +KFV+ HYA DV YD+GG  +KN+D +    +E
Sbjct: 496 ADQAFAQRL-----NLFTSNPHFELRSSKFVIKHYAGDVTYDIGGMTDKNKDQLQRDLVE 550

Query: 595 VLKASKNDTLLSIL-DTIDKNAAALAEKQDANKKPGPARMVKKPTLGSMFKQSLIELMNT 653
           +L ++ N  L +I  DT DK         D+ + P         T G    +S  EL++T
Sbjct: 551 LLNSTSNTFLATIFPDTGDK---------DSKRIPS--------TAGDKIIRSANELVDT 593

Query: 654 IDSTNVHYIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLR 713
           +      YIR IKPN+ K    +D+  VL Q++  G+ E +RI  A +  R  +++FV R
Sbjct: 594 LSKAQPSYIRTIKPNQTKSPLDYDDRQVLHQVKYLGLQENVRIRRACYAYRHIFDKFVER 653

Query: 714 YHILIPSDNWTKIFTSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAG-MLAYLE 772
           +++L P  ++   +T + +  D  NL   IL  T     +YQLG TK+F K    L  LE
Sbjct: 654 FYLLSPQCSYAGDYTWQGNTLDAVNL---ILRDTSIPVTEYQLGVTKVFIKTPETLFALE 710

Query: 773 KLRSTKMHNSCVLIQKKIKGVYYRK--QYLAIKNAIHNVQAVIAGNYCRQSVDHEFKTLA 830
            +R    HN    IQ+  +    R+    + I+ AI  ++    GN   Q  D+  K L 
Sbjct: 711 NMRDKYWHNMASRIQRAWRRFLQRRIDSAIRIQRAIREMK---HGNQFEQLRDYGNKLLG 767

Query: 831 A 831
            
Sbjct: 768 G 768

>YKL129C (MYO3) [3137] chr11 complement(196350..200165) Myosin type
           I, may play a role in cell growth or polarity that is
           partially redundant with Myo5p, has an SH3 domain [3816
           bp, 1271 aa]
          Length = 1271

 Score =  429 bits (1103), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 272/743 (36%), Positives = 402/743 (54%), Gaps = 49/743 (6%)

Query: 72  AIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQLYSQDMIQAYAG 131
            I DLT LS +++ ++   +K R+    IYTY G VLI+ NPF R   +Y+  ++++Y G
Sbjct: 37  GISDLTLLSKISDESINENLKKRFKNGIIYTYIGHVLISVNPF-RDLGIYTNAVLESYKG 95

Query: 132 RRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEQANAD 191
           + R E+ PH+FAIA+  Y  +K   +NQ +++SGESGAGKT +AK IM+Y A+       
Sbjct: 96  KNRLEVPPHVFAIAESMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAA------- 148

Query: 192 NASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGKYLEILFDESTSIIGARI 251
            AS+ H   + + ++ +LATNP++E+FG AKT RN+NSSR GKYLEI F+         I
Sbjct: 149 -ASNSHSESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNSQFEPCAGNI 207

Query: 252 RTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKVEDYHYLRQGGDYRIKGV 311
             YLLE+ R+V Q + ERN+HIFYQ  +G S++ K+   +   E Y Y    G       
Sbjct: 208 TNYLLEKQRVVGQIKNERNFHIFYQFTKGASDTYKQMFGVQMPEQYIYTAAAG---CTSA 264

Query: 312 DD--AAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRNDASLSSDEPNLK 369
           D     +Y+ T++A++ +G  Q+ Q Q+F++LAA+L IGNI   +     +   D     
Sbjct: 265 DQLMRKDYEGTLEAMRTIGLVQEEQDQIFRMLAAILWIGNISFIENEEGNAQVGDTSVTD 324

Query: 370 IACDLLGIDASGFSKWITKKQITTR---SEKIVSNLSFN--QALVARDSVAKFIFSALFD 424
               LL +DAS   K + ++ + T        V ++  N  QA   RD++AK I++ LFD
Sbjct: 325 FVAYLLQVDASLLVKCLVERIMQTSHGMKRGSVYHVPLNPVQATAVRDALAKAIYNNLFD 384

Query: 425 WLVENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVF 484
           W+V+ +N  L   Q        IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   
Sbjct: 385 WIVDRVNVSL---QAFPGADKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTL 441

Query: 485 KLEQEEYVNEQIEWSFIEFNDNQPCIDLIE--NKLGILSLLDEESRLPAGSDESWTQKLY 542
           K EQE Y  E+I+W+ I++ DN+   DLIE  N  GIL+ +++          +  Q   
Sbjct: 442 KAEQETYEREKIKWTPIKYFDNKVVCDLIEAKNPPGILAAMNDSIATAHADSNAADQAFA 501

Query: 543 QTLDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLEVLKASKND 602
           Q L+   +N  F        KFV+ HYA DV YD+ G  +KN+D +    +E++  + N 
Sbjct: 502 QRLNLFNSNPYF---ELRANKFVIKHYAGDVTYDINGITDKNKDQLQKDLIELIGTTTNT 558

Query: 603 TLLSIL-DTIDKNAAALAEKQDANKKPGPARMVKKPTLGSMFKQSLIELMNTIDSTNVHY 661
            L +I  D +DK         D+ ++P        PT G    +S  EL+ T+      Y
Sbjct: 559 FLSTIFPDDVDK---------DSKRRP--------PTAGDKIIKSANELVETLSKAEPSY 601

Query: 662 IRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILIPSD 721
           IR IKPN+ K    +D+  VL Q++  G+ E +RI  AGF  R T+ +FV R+++L P  
Sbjct: 602 IRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSPDC 661

Query: 722 NWTKIFTSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAG-MLAYLEKLRSTKMH 780
           ++   +T +    D     K IL   +    ++QLG T +F K    L  LE +R    +
Sbjct: 662 SYAGDYTWDG---DTLEAVKLILRDAMIPEKEFQLGVTSVFIKTPESLFALEDMRDKYWY 718

Query: 781 NSCVLIQKKIKGVYYRKQYLAIK 803
           N    IQ+  +    R+   AIK
Sbjct: 719 NMAARIQRAWRRFLQRRIDAAIK 741

>CAGL0K07590g 748352..752110 highly similar to sp|P36006
           Saccharomyces cerevisiae YKL129c or sp|Q04439
           Saccharomyces cerevisiae YMR109w myosin like proteins,
           start by similarity
          Length = 1252

 Score =  426 bits (1096), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 273/752 (36%), Positives = 401/752 (53%), Gaps = 46/752 (6%)

Query: 72  AIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQLYSQDMIQAYAG 131
            + DLT LS +++ ++   +K R+    IYTY G VLI+ NPF R   +Y+ D +++Y G
Sbjct: 37  GVSDLTLLSKISDESINDNLKKRFEHGIIYTYIGYVLISVNPF-RDLGIYTDDTMKSYQG 95

Query: 132 RRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEQANAD 191
           + R E  PH+FAIA+  Y  +K   +NQ +++SGESGAGKT +AK IM+Y A+       
Sbjct: 96  KNRLEAPPHVFAIAENMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAAT------ 149

Query: 192 NASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGKYLEILFDESTSIIGARI 251
             SS H   +S+ ++ +LATNP++E+FG AKT RN+NSSR GKYLEI FD         I
Sbjct: 150 --SSTHSESISKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFDAHFQPCAGHI 207

Query: 252 RTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKVEDYHYLRQGGDYRIKGV 311
             YLLE+ R+V Q + ERN+HIFYQ  +G  E  ++   + + E Y Y        ++ +
Sbjct: 208 TNYLLEKQRVVGQIKNERNFHIFYQFTKGAPEEYRQLFGVQQPEQYIYTSASQCTAVENM 267

Query: 312 DDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRNDASLSSDEPNLKIA 371
           DD  E+  T++A++ +G ++  Q Q+F+ LAA+L IGNI   +     +   D+      
Sbjct: 268 DDVEEFNETLNAMRTIGLTKSEQDQIFRALAAILWIGNISFVENEAGNAEIRDKSVTTFV 327

Query: 372 CDLLGIDASGFSKWITKKQITT-----RSEKIVSNLSFNQALVARDSVAKFIFSALFDWL 426
             LL +      K + ++ I T     R     S L+  QA   RD++AK I++ LF+W+
Sbjct: 328 AYLLEVQEELLIKALIERIIETTHGAKRGSTYHSPLNIIQATAVRDALAKAIYNNLFEWI 387

Query: 427 VENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKL 486
           VE +N  L   Q        IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K 
Sbjct: 388 VERVNNSL---QAFPGADKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKS 444

Query: 487 EQEEYVNEQIEWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTQKLYQT 544
           EQ+ Y  EQI W+ IE+ DN+   DLIE K   GI + +++         ++  Q   Q 
Sbjct: 445 EQDTYKKEQIHWTPIEYFDNKIVCDLIEAKRPPGIFAAMNDAIATAHADSDAADQAFAQR 504

Query: 545 LDKPPTNSVFSKPRFGQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLEVLKASKNDTL 604
           L+   TN  F      Q KFVV HYA DV YD+ G  +KN+D +    +E+L  + N  +
Sbjct: 505 LNLFTTNPHF---ELRQNKFVVKHYAGDVTYDIFGITDKNKDQLQKDLVELLSTTSNSFV 561

Query: 605 LSILDTIDKNAAALAEKQDANKKPGPARMVKKPTLGSMFKQSLIELMNTIDSTNVHYIRC 664
             I             + D+ ++P        PT G    +S  EL+ T+      YIR 
Sbjct: 562 REIFPD--------QPQTDSRRRP--------PTSGDKIIKSANELVETLSKAQPSYIRT 605

Query: 665 IKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILIPSDNWT 724
           IKPN+ K +  +D+  VL Q++  G+ E +RI  AGF  R  + +FV R+++L P  ++ 
Sbjct: 606 IKPNDTKSSTIYDDQRVLHQIKYLGLKENVRIRRAGFAHRQVFEKFVERFYLLSPQCSYA 665

Query: 725 KIFTSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFK-AGMLAYLEKLRSTKMHNSC 783
             +  +    D     K IL      + +Y++G T+IF K    L  LE +R    +N  
Sbjct: 666 GDYVWDGETLD---AVKLILQDASIPTTEYEIGVTQIFIKHPETLFALENMRDKYWYNMA 722

Query: 784 VLIQKKIKGVYYRKQYLA---IKNAIHNVQAV 812
             IQ+  +  Y +K+  A   I+NAI     V
Sbjct: 723 ARIQRAWRR-YLQKRIDAAIRIQNAIRGKSGV 753

>CAGL0K03487g 322030..325683 highly similar to sp|Q04439
           Saccharomyces cerevisiae YMR109w myosin-like protein,
           start by similarity
          Length = 1217

 Score =  425 bits (1093), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 264/744 (35%), Positives = 403/744 (54%), Gaps = 50/744 (6%)

Query: 72  AIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYSGIVLIATNPFDRVEQLYSQDMIQAYAG 131
            + DLT L+ +++ ++   +K R+    IYTY G VLI+ NPF R   +Y+  ++++Y G
Sbjct: 38  GVSDLTLLTSISDESINDNLKKRFLNGTIYTYIGHVLISVNPF-RDLGIYTDAIMKSYQG 96

Query: 132 RRRGELEPHLFAIADEAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEQANAD 191
           + R E+ PH++AI++  Y  +K   +NQ +++SGESGAGKT +AK IM Y A+       
Sbjct: 97  KNRLEVPPHVYAISEAMYYNLKAYNENQCVIISGESGAGKTEAAKKIMEYIAAT------ 150

Query: 192 NASSDHHLQMSETEERILATNPIMEAFGNAKTSRNDNSSRFGKYLEILFDESTSIIGARI 251
             SS H   + + ++ +LATNP++E+FG AKT RN+NSSR GKYLEI F+         I
Sbjct: 151 --SSTHSESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNSQFEPCAGNI 208

Query: 252 RTYLLERSRLVFQPQVERNYHIFYQLVEGLSESEKEELHLTKVEDYHYLRQGGDYRIKGV 311
             YLLE+ R+V Q   ERN+HIFYQ  +G S++ ++   +   E Y Y        +  +
Sbjct: 209 TNYLLEKQRVVGQITNERNFHIFYQFTKGASDNYRQTFGVQLPEQYVYTSASKCTSVDTI 268

Query: 312 DDAAEYQVTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRNDASLSSDEPNLKIA 371
           DD  +++ T+ A++++G +Q+ Q Q+F++LAA+L IGNI   +     +   D       
Sbjct: 269 DDVKDFEATIKAMQVIGLAQEEQDQIFRMLAAILWIGNISFIENEEGNAQVRDTSVTDFV 328

Query: 372 CDLLGIDASGFSKWITKKQITT-----RSEKIVSNLSFNQALVARDSVAKFIFSALFDWL 426
             LL +D+    K + ++ + T     R       L+  QA   RD++AK I++ LF+W+
Sbjct: 329 AYLLQVDSQSLIKALVERIVETNHGSRRGSVYHVPLNIVQATAVRDALAKAIYNNLFEWI 388

Query: 427 VENINTVLCNPQVSDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKL 486
           V+ +N  L     +D+    IG+LDIYGFE FE NSFEQ CINY NEKLQQ F Q   K 
Sbjct: 389 VDRVNKSLHAYPGADKS---IGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKS 445

Query: 487 EQEEYVNEQIEWSFIEFNDNQPCIDLIENKL--GILSLLDEESRLPAGSDESWTQKLYQT 544
           EQ+ Y  E+I+W+ I++ DN+   DLIE K   GI + +++          +  Q   Q 
Sbjct: 446 EQDTYAREKIQWTPIKYFDNKVVCDLIEAKRPPGIFAAMNDSVATAHADSSAADQAFAQR 505

Query: 545 LDKPPTNSVFSK-PRF--GQTKFVVSHYALDVAYDVGGFIEKNRDTVSDGHLEVLKASKN 601
           L      S+FS  P F   Q KFV+ HYA DV YDV G  +KN+D +    +E++  + N
Sbjct: 506 L------SLFSSNPHFEQRQNKFVIKHYAGDVTYDVLGMTDKNKDQLQKDLVELVGTTTN 559

Query: 602 DTLLSIL-DTIDKNAAALAEKQDANKKPGPARMVKKPTLGSMFKQSLIELMNTIDSTNVH 660
             L ++  + +DK         D  ++P        PT G    +S  EL+ T+      
Sbjct: 560 AFLTTLFPNQVDK---------DNKRRP--------PTAGDKIIKSANELVETLSKAQPS 602

Query: 661 YIRCIKPNEEKEAWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTYNEFVLRYHILIPS 720
           YIR IKPN+ K    +D+  VL Q++  G+ E +RI  AGF  R  + +FV R+++L P 
Sbjct: 603 YIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQGFEKFVERFYLLSPR 662

Query: 721 DNWTKIFTSEASEDDIRNLCKQILGATVDDSNKYQLGNTKIFFKAG-MLAYLEKLRSTKM 779
            ++   +T      DI    + IL   +    +YQLG T++F K    L  LE +R    
Sbjct: 663 CSYAGDYTWTG---DILEAVRLILQDALIPEKEYQLGVTQVFIKTPETLFALENMRDKFW 719

Query: 780 HNSCVLIQKKIKGVYYRKQYLAIK 803
           HN    IQ+  +    R+   A+K
Sbjct: 720 HNMAARIQRAWRRYLQRRIDAAVK 743

>ABR111C [703] [Homologous to ScYPR090W - SH; ScYPR089W - SH]
            (591654..594023) [2370 bp, 789 aa]
          Length = 789

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 14/72 (19%), Positives = 40/72 (55%)

Query: 1338 ILTFFNNIYWSMKTYHVEQEVFREVIITLLRYVDSICFNDLIMRRNFLSWKRGLQLNYNV 1397
            I+  F  + + ++++ V   +  + + T + +  +  FN ++  + +LS  + +Q+  N+
Sbjct: 452  IVQIFGALAYVLESHQVHPLLSMQCLSTSIEWFSTSIFNIMVSSKKYLSRAQAMQIRLNL 511

Query: 1398 TRLEEWCKSHHI 1409
            + +E+W K+H +
Sbjct: 512  STIEDWVKNHDM 523

>CAGL0D00924g 108341..114283 similar to sp|P25386 Saccharomyces
            cerevisiae YDL058w USO1 intracellular protein transport
            protein, start by similarity
          Length = 1980

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 57/113 (50%), Gaps = 13/113 (11%)

Query: 1035 ADVRAKVEELNNVQQEFEDSRTQNSDLRNEVKSLKDEINRLQTSIRSGANSNTILAHTPT 1094
            + +  K ++LNN+QQ+ E S++       E+ +LK EI +L+TS+    ++   L     
Sbjct: 1056 SSIDEKNKDLNNIQQQIEGSQS-------EISTLKAEITQLKTSLNEEKSTRKALEKLKE 1108

Query: 1095 KSRRF--SAHSSLTDASPRQLNVISMNNGMEDDARSTASALSQINDELYKILE 1145
            ++  +  SA   L     ++++++   N    DA    S+L Q  DEL K LE
Sbjct: 1109 ENETYIQSAQDELLQLQ-KEVDLLKSENK---DALDNNSSLKQKYDELVKELE 1157

>YLR342W (FKS1) [3725] chr12 (809997..815627) Component of
           beta-1,3-glucan synthase, provides an essential function
           that overlaps with that of Gsc2p, a strongly similar
           protein [5631 bp, 1876 aa]
          Length = 1876

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/88 (22%), Positives = 38/88 (43%), Gaps = 9/88 (10%)

Query: 319 VTVDALKMVGFSQDTQHQLFKILAALLHIGNIEVKKTRNDASLSSDEPNLKIACDLLGID 378
           + +D    +GF +D+   +F     LL     + + +R    +S D+  L +  D +G D
Sbjct: 167 IFIDLTNRLGFQRDSMRNMFDHFMVLL-----DSRSSR----MSPDQALLSLHADYIGGD 217

Query: 379 ASGFSKWITKKQITTRSEKIVSNLSFNQ 406
            + + KW    Q+    E    N+S  +
Sbjct: 218 TANYKKWYFAAQLDMDDEIGFRNMSLGK 245

>KLLA0F17435g complement(1596081..1599896) similar to sp|Q04217
           Saccharomyces cerevisiae YMR128w ECM16 putative DEAH-box
           RNA helicase, start by similarity
          Length = 1271

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 43/98 (43%), Gaps = 10/98 (10%)

Query: 147 EAYRLMKHDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEQANADNASSDHHLQMSETEE 206
           E +R+M+    N  +++ GE+G+GKT      +      E    +++S+D    +  T+ 
Sbjct: 413 EEHRIMEAIHHNDVVIICGETGSGKTTQVPQFL-----YEAGYGNSSSTDTPGMIGITQP 467

Query: 207 RILATNPIMEAFGNAKTSRNDNSSRFGKYLEILFDEST 244
           R +A    +   G       D+    G   +I FD ST
Sbjct: 468 RRVAA---VSMAGRVTNEMGDHGEYVG--YQIRFDSST 500

>Sklu_2233.4 YMR052W, Contig c2233 9923-10540
          Length = 205

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 17/79 (21%)

Query: 438 QVSDQISSFIGVLDI---YGFEHFEKNSFEQFCINYANEKLQQEFNQH-----------V 483
           Q +D+I S +  L       F+HF K   +Q   ++  EKL QE               +
Sbjct: 27  QETDRIESLLRRLSKQTQISFDHFSKEPNDQVRADF--EKLSQETETEAERLIKDNYSLI 84

Query: 484 FKLEQEEYVNEQIEWSFIE 502
           +K+EQ+EY+N++I W+ I+
Sbjct: 85  YKIEQQEYINQKI-WTLID 102

>KLLA0D18799g complement(1584644..1586047) some similarities with
            sgd|S0002608 Saccharomyces cerevisiae YDR200c,
            hypothetical start
          Length = 467

 Score = 31.2 bits (69), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 1026 LLSQQEQLKADVRAKVEELNNVQQEFEDSRTQNSDLRN-EVKSLKDEINRLQTSIRSGAN 1084
            L +QQ +L      +++ L    ++  DS  +N+DL+N ++K LK E++ LQT +     
Sbjct: 349  LANQQAELTTIHNEEIQALKQENKKLNDSLKENNDLKNTKIKQLKSEVDELQTRLEVEIF 408

Query: 1085 SNTILAHTPTK 1095
             NT L    +K
Sbjct: 409  KNTQLQQAKSK 419

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.132    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 47,127,885
Number of extensions: 2050230
Number of successful extensions: 9331
Number of sequences better than 10.0: 235
Number of HSP's gapped: 9259
Number of HSP's successfully gapped: 371
Length of query: 1532
Length of database: 16,596,109
Length adjustment: 115
Effective length of query: 1417
Effective length of database: 12,615,039
Effective search space: 17875510263
Effective search space used: 17875510263
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)