Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_26.705474742723e-33
Scas_663.25112742719e-33
KLLA0A03883g110742702e-32
YOR327C (SNC2)115742702e-32
ADR355C109742682e-32
CAGL0G06358g113742632e-31
YAL030W (SNC1)117512521e-29
CAGL0E05258g108512362e-27
CAGL0C00429g234491143e-08
Kwal_56.23743162501113e-08
Scas_564.4*237491116e-08
YLR093C (NYV1)253491091e-07
AGR054C248491091e-07
KLLA0F19448g23150922e-05
Kwal_47.1712120038660.095
Sklu_2258.720039630.25
AER109W20039630.27
CAGL0D03498g20539620.31
Scas_571.120039620.34
YKL196C (YKT6)20038620.37
KLLA0D02684g20038590.85
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_26.7054
         (74 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_26.7054                                                          109   3e-33
Scas_663.25                                                           108   9e-33
KLLA0A03883g join(344642..344725,344850..345098) similar to sp|P...   108   2e-32
YOR327C (SNC2) [5108] chr15 complement(930729..931076) Synaptobr...   108   2e-32
ADR355C [2096] [Homologous to ScYOR327C (SNC2) - SH; ScYAL030W (...   107   2e-32
CAGL0G06358g complement(612827..613168) no similarity, hypotheti...   105   2e-31
YAL030W (SNC1) [38] chr1 (87289..87390,87504..87755) Synaptobrev...   101   1e-29
CAGL0E05258g complement(511027..511353) highly similar to sp|P33...    96   2e-27
CAGL0C00429g 43086..43790 similar to tr|Q12255 Saccharomyces cer...    49   3e-08
Kwal_56.23743                                                          47   3e-08
Scas_564.4*                                                            47   6e-08
YLR093C (NYV1) [3508] chr12 complement(326514..327259,327401..32...    47   1e-07
AGR054C [4364] [Homologous to ScYLR093C (NYV1) - SH] (815110..81...    47   1e-07
KLLA0F19448g complement(1799571..1800266) similar to sgd|S000408...    40   2e-05
Kwal_47.17121                                                          30   0.095
Sklu_2258.7 YKL196C, Contig c2258 11983-12585 reverse complement       29   0.25 
AER109W [2614] [Homologous to ScYKL196C (YKT6) - SH] complement(...    29   0.27 
CAGL0D03498g complement(357058..357675) highly similar to sp|P36...    28   0.31 
Scas_571.1                                                             28   0.34 
YKL196C (YKT6) [3076] chr11 complement(74937..75539) Synaptobrev...    28   0.37 
KLLA0D02684g complement(228564..229166) highly similar to sp|P36...    27   0.85 

>Kwal_26.7054
          Length = 74

 Score =  109 bits (272), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 54/74 (72%), Positives = 54/74 (72%)

Query: 1  MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRXXXXXXXXX 60
          MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMR         
Sbjct: 1  MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRLCLVLVVII 60

Query: 61 XXXXXXXXXXXHFS 74
                     HFS
Sbjct: 61 LLVVIIVPIVVHFS 74

>Scas_663.25
          Length = 112

 Score =  108 bits (271), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 53/74 (71%), Positives = 54/74 (72%)

Query: 1   MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRXXXXXXXXX 60
           MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMR         
Sbjct: 39  MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRACLVLVIII 98

Query: 61  XXXXXXXXXXXHFS 74
                      HF+
Sbjct: 99  LLVVIIVPIVVHFT 112

>KLLA0A03883g join(344642..344725,344850..345098) similar to
           sp|P33328 Saccharomyces cerevisiae YOR327c SNC2
           synaptobrevin (v-SNARE) homolog present on post-Golgi
           vesicles or sp|P31109 Saccharomyces cerevisiae YAL030w
           SNC1 synaptic vesicle-associated membrane protein, start
           by similarity
          Length = 110

 Score =  108 bits (270), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 53/74 (71%), Positives = 54/74 (72%)

Query: 1   MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRXXXXXXXXX 60
           MRDNINKVAERGERLTSI+DKADNLAVSAQGFKRGANRVRKQMWWKDLKMR         
Sbjct: 37  MRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRMCLVLVVII 96

Query: 61  XXXXXXXXXXXHFS 74
                      HFS
Sbjct: 97  LLIVIIVPIAVHFS 110

>YOR327C (SNC2) [5108] chr15 complement(930729..931076)
           Synaptobrevin (v-SNARE) homolog present on post-Golgi
           vesicles [348 bp, 115 aa]
          Length = 115

 Score =  108 bits (270), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 53/74 (71%), Positives = 54/74 (72%)

Query: 1   MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRXXXXXXXXX 60
           MRDNINKVAERGERLTSIEDKADNLA+SAQGFKRGANRVRKQMWWKDLKMR         
Sbjct: 42  MRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRVRKQMWWKDLKMRMCLFLVVII 101

Query: 61  XXXXXXXXXXXHFS 74
                      HFS
Sbjct: 102 LLVVIIVPIVVHFS 115

>ADR355C [2096] [Homologous to ScYOR327C (SNC2) - SH; ScYAL030W
           (SNC1) - SH] (1333349..1333597,1333672..1333752) [330
           bp, 109 aa]
          Length = 109

 Score =  107 bits (268), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 54/74 (72%)

Query: 1   MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRXXXXXXXXX 60
           MRDNINKVAERGERLTSI+DKADNLAVSAQGFKRGANRVRKQMWWKDLKMR         
Sbjct: 36  MRDNINKVAERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRLCLVLVVVL 95

Query: 61  XXXXXXXXXXXHFS 74
                      HF+
Sbjct: 96  LLIVIIVPIVVHFT 109

>CAGL0G06358g complement(612827..613168) no similarity, hypothetical
           start
          Length = 113

 Score =  105 bits (263), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 51/74 (68%), Positives = 54/74 (72%)

Query: 1   MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRXXXXXXXXX 60
           MRDNINKVAERGERLTSIEDKADNLA+SAQGFKRGANRVRKQMW+KDLKM+         
Sbjct: 40  MRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRVRKQMWYKDLKMKFCLFVVIIC 99

Query: 61  XXXXXXXXXXXHFS 74
                      HFS
Sbjct: 100 LLVAIVVPIAVHFS 113

>YAL030W (SNC1) [38] chr1 (87289..87390,87504..87755)
          Synaptobrevin (v-SNARE) homolog present on post-Golgi
          vesicles [354 bp, 117 aa]
          Length = 117

 Score =  101 bits (252), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 48/51 (94%), Positives = 50/51 (98%)

Query: 1  MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMR 51
          MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRK MW+KDLKM+
Sbjct: 43 MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKAMWYKDLKMK 93

>CAGL0E05258g complement(511027..511353) highly similar to
          sp|P33328 Saccharomyces cerevisiae YOR327c SNC2, start
          by similarity
          Length = 108

 Score = 95.5 bits (236), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 50/51 (98%)

Query: 1  MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMR 51
          MR+NINKVAERGE LTSI+DKADNLA+SAQGFKRGANRVR+QMW+KDLKMR
Sbjct: 35 MRNNINKVAERGEMLTSIDDKADNLAMSAQGFKRGANRVRRQMWYKDLKMR 85

>CAGL0C00429g 43086..43790 similar to tr|Q12255 Saccharomyces
           cerevisiae YLR093c, hypothetical start
          Length = 234

 Score = 48.5 bits (114), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 20/49 (40%), Positives = 35/49 (71%)

Query: 1   MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLK 49
           M DNI+K  ER ER++ + DK  +L  +++ FKR A +++++MWW+ +K
Sbjct: 163 MNDNIDKFLERQERVSLLVDKTSHLNSNSRSFKRKAIKLKERMWWRRMK 211

>Kwal_56.23743
          Length = 162

 Score = 47.4 bits (111), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 34/50 (68%)

Query: 1   MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKM 50
           M DNI+K  +R ER++ + D+   L  S+  FKR A R++ +MWW+++K+
Sbjct: 91  MNDNIDKFLQRQERVSLLVDRTSKLNQSSYNFKRKAVRIKTKMWWQNVKL 140

>Scas_564.4*
          Length = 237

 Score = 47.4 bits (111), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 19/49 (38%), Positives = 33/49 (67%)

Query: 1   MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLK 49
           M +NI+K  ER ER++ + DK   L  ++  FK+ A R++++MWW+ +K
Sbjct: 166 MNNNIDKFLERQERISLLVDKTSQLNDNSHNFKKKAVRIKERMWWQRMK 214

>YLR093C (NYV1) [3508] chr12
           complement(326514..327259,327401..327416) Synaptobrevin
           (v-SNARE) homolog involved in vacuolar vesicle fusion
           [762 bp, 253 aa]
          Length = 253

 Score = 46.6 bits (109), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 20/49 (40%), Positives = 31/49 (63%)

Query: 1   MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLK 49
           M DNI+K  ER ER++ + DK   L  S+  F+R A  +++ MWW+ +K
Sbjct: 182 MNDNIDKFLERQERVSLLVDKTSQLNSSSNKFRRKAVNIKEIMWWQKVK 230

>AGR054C [4364] [Homologous to ScYLR093C (NYV1) - SH]
           (815110..815795,815928..815988) [747 bp, 248 aa]
          Length = 248

 Score = 46.6 bits (109), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/49 (38%), Positives = 33/49 (67%)

Query: 1   MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLK 49
           M DNI+K  +R ER++ + D+   L  S+  F+R A R++++MWW ++K
Sbjct: 178 MNDNIDKFLQRQERISLLVDQTSQLNQSSFNFQRKAVRIKRKMWWNNIK 226

>KLLA0F19448g complement(1799571..1800266) similar to sgd|S0004083
           Saccharomyces cerevisiae YLR093c NYV1 v-SNARE, vacuolar,
           start by similarity
          Length = 231

 Score = 40.0 bits (92), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 33/50 (66%)

Query: 1   MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKM 50
           M DNI+K  +R ER++ + D  + L  ++  F+R ++++ ++MWW ++K 
Sbjct: 161 MNDNIDKFLQRQERISLLVDNTNQLNENSFKFQRKSSKIMRKMWWNNVKF 210

>Kwal_47.17121
          Length = 200

 Score = 30.0 bits (66), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 25/38 (65%)

Query: 1   MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANR 38
           +   I  V +RGERL ++ DK+++L+ S++ F + A +
Sbjct: 155 LHKTIESVLQRGERLDNLVDKSESLSASSRMFYKQAKK 192

>Sklu_2258.7 YKL196C, Contig c2258 11983-12585 reverse complement
          Length = 200

 Score = 28.9 bits (63), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 25/39 (64%)

Query: 1   MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRV 39
           +   I  V +RGE+L ++ DK+++L+ S++ F + A + 
Sbjct: 155 LHKTIESVLQRGEKLDNLVDKSESLSASSRMFYKQAKKT 193

>AER109W [2614] [Homologous to ScYKL196C (YKT6) - SH]
           complement(841793..842395) [603 bp, 200 aa]
          Length = 200

 Score = 28.9 bits (63), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 25/39 (64%)

Query: 1   MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRV 39
           +   I  V +RGE+L ++ DK+++L+ S++ F + A + 
Sbjct: 155 LHKTIESVLQRGEKLDNLVDKSESLSASSRMFYKQAKKT 193

>CAGL0D03498g complement(357058..357675) highly similar to sp|P36015
           Saccharomyces cerevisiae YKL196c YKT6, start by
           similarity
          Length = 205

 Score = 28.5 bits (62), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 24/39 (61%)

Query: 1   MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRV 39
           +   I  V +RGE+L ++ DK+++L  S++ F + A + 
Sbjct: 160 LHKTIENVLQRGEKLDNLVDKSESLTASSKMFYKQAKKT 198

>Scas_571.1
          Length = 200

 Score = 28.5 bits (62), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 24/39 (61%)

Query: 1   MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRV 39
           +   I  V +RGE+L ++ DK+++L  S++ F + A + 
Sbjct: 155 LHKTIENVLQRGEKLDNLVDKSESLTASSKMFYKQAKKT 193

>YKL196C (YKT6) [3076] chr11 complement(74937..75539) Synaptobrevin
           (v-SNARE) homolog with similarity to Sec22p, Snc1p, and
           Snc2p, essential for endoplasmic reticulum-Golgi
           transport [603 bp, 200 aa]
          Length = 200

 Score = 28.5 bits (62), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 24/38 (63%)

Query: 1   MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANR 38
           +   I  V +RGE+L ++ DK+++L  S++ F + A +
Sbjct: 155 LHKTIENVLQRGEKLDNLVDKSESLTASSKMFYKQAKK 192

>KLLA0D02684g complement(228564..229166) highly similar to sp|P36015
           Saccharomyces cerevisiae YKL196c YKT6 SNARE protein for
           Endoplasmic Reticulum-Golgi transport singleton, start
           by similarity
          Length = 200

 Score = 27.3 bits (59), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 11/38 (28%), Positives = 25/38 (65%)

Query: 1   MRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANR 38
           +   I  V +RGE+L ++ DK+++L+ +++ F + A +
Sbjct: 155 LHKTIENVLQRGEKLDNLVDKSESLSAASRMFYKQAKK 192

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.130    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 1,488,343
Number of extensions: 37041
Number of successful extensions: 105
Number of sequences better than 10.0: 22
Number of HSP's gapped: 105
Number of HSP's successfully gapped: 22
Length of query: 74
Length of database: 16,596,109
Length adjustment: 46
Effective length of query: 28
Effective length of database: 15,003,681
Effective search space: 420103068
Effective search space used: 420103068
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)