Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.58351571567971e-110
KLLA0C08195g2431762412e-25
ADL069W2051762341e-24
Scas_704.31*2221771749e-16
YER063W (THO1)2181751652e-14
CAGL0J02992g2301931213e-08
CAGL0C01617g23850680.37
Scas_711.51710111670.62
YPR156C (TPO3)62245660.80
ACL011C28131650.94
YMR003W19846641.1
KLLA0C06072g25331641.3
Kwal_26.726033244622.2
ADR267W15760612.5
ADR056W50130613.0
KLLA0F08162g30744613.1
CAGL0E04576g682137604.4
Sklu_2406.321884595.1
YMR237W72441588.2
Sklu_2162.231444588.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.5835
         (156 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.5835                                                          311   e-110
KLLA0C08195g complement(719857..720588) some similarities with s...    97   2e-25
ADL069W [1672] [Homologous to ScYER063W (THO1) - SH] complement(...    95   1e-24
Scas_704.31*                                                           72   9e-16
YER063W (THO1) [1494] chr5 (281708..282364) Protein that suppres...    68   2e-14
CAGL0J02992g 286008..286700 similar to sp|P40040 Saccharomyces c...    51   3e-08
CAGL0C01617g 174618..175334 no similarity, hypothetical start          31   0.37 
Scas_711.51                                                            30   0.62 
YPR156C (TPO3) [5571] chr16 complement(837903..839771) Polyamine...    30   0.80 
ACL011C [1038] [Homologous to ScYMR003W - SH] (337457..338302) [...    30   0.94 
YMR003W (YMR003W) [3968] chr13 (273118..273714) Protein containi...    29   1.1  
KLLA0C06072g complement(534152..534913) no similarity, hypotheti...    29   1.3  
Kwal_26.7260                                                           28   2.2  
ADR267W [2008] [Homologous to ScYMR148W - SH] complement(1162212...    28   2.5  
ADR056W [1797] [Homologous to ScYBR162C (TOS1) - SH] complement(...    28   3.0  
KLLA0F08162g 763454..764377 highly similar to sp|P53252 Saccharo...    28   3.1  
CAGL0E04576g complement(440557..442605) similar to sp|P32325 Sac...    28   4.4  
Sklu_2406.3 YOR220W, Contig c2406 1777-2433 reverse complement         27   5.1  
YMR237W (YMR237W) [4193] chr13 (743748..745922) Protein with hig...    27   8.2  
Sklu_2162.2 YGR086C, Contig c2162 2407-3351 reverse complement         27   8.3  

>Kwal_23.5835
          Length = 157

 Score =  311 bits (797), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 156/156 (100%), Positives = 156/156 (100%)

Query: 1   MAPTTKYAEQTVEQLQNELQSRQLDSDGEKSQLVERLEADDAKKGQQNSDASGAAEPSKS 60
           MAPTTKYAEQTVEQLQNELQSRQLDSDGEKSQLVERLEADDAKKGQQNSDASGAAEPSKS
Sbjct: 1   MAPTTKYAEQTVEQLQNELQSRQLDSDGEKSQLVERLEADDAKKGQQNSDASGAAEPSKS 60

Query: 61  ETPEKAAEISPAPQKDPQALAIAHLERKLRRAKKFADDQATLDYLERQIARVRKFGLDTT 120
           ETPEKAAEISPAPQKDPQALAIAHLERKLRRAKKFADDQATLDYLERQIARVRKFGLDTT
Sbjct: 61  ETPEKAAEISPAPQKDPQALAIAHLERKLRRAKKFADDQATLDYLERQIARVRKFGLDTT 120

Query: 121 TELARELGLGKGPETAVPTRSVRSRTARKSNKNARG 156
           TELARELGLGKGPETAVPTRSVRSRTARKSNKNARG
Sbjct: 121 TELARELGLGKGPETAVPTRSVRSRTARKSNKNARG 156

>KLLA0C08195g complement(719857..720588) some similarities with
           sp|P40040 Saccharomyces cerevisiae YER063w THO1
           singleton, hypothetical start
          Length = 243

 Score = 97.4 bits (241), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 63/176 (35%), Positives = 88/176 (50%), Gaps = 46/176 (26%)

Query: 7   YAEQTVEQLQNELQSRQLDSDGEKSQLVERLEADDAKKGQQNSDASGAAE---------- 56
           Y+  TV QL+  L+ R L +DG K+ L+ RL+ DD+ K    ++ S  AE          
Sbjct: 48  YSGNTVAQLKELLKQRNLSTDGLKADLINRLQDDDSTKNSATNEPSSIAEVEATASATAA 107

Query: 57  ---------------------PSKSETP-------EKAAEISPAPQKDPQA-------LA 81
                                P     P       EK    +PAP K+P+         A
Sbjct: 108 AAPTITSSIPDAVPADASAAVPENENVPSTEEDKLEKTPPATPAP-KNPELSQDQLKQAA 166

Query: 82  IAHLERKLRRAKKFADDQATLDYLERQIARVRKFGLDTTTELARELGLGKGPETAV 137
           I HL++K+ RA+KF  D +T+D L+RQI R+ KFGLD +T+LA+ELG GKGP+ AV
Sbjct: 167 IDHLQKKIYRAEKFGQDDSTIDDLQRQINRIEKFGLDLSTQLAKELGFGKGPDAAV 222

>ADL069W [1672] [Homologous to ScYER063W (THO1) - SH]
           complement(558299..558916) [618 bp, 205 aa]
          Length = 205

 Score = 94.7 bits (234), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 66/176 (37%), Positives = 93/176 (52%), Gaps = 39/176 (22%)

Query: 5   TKYAEQTVEQLQNELQSRQLDSDGEKSQLVERLEADDAKKGQQNSDASGAAEPSKSET-- 62
           T YA  TV QL++ L+ R+L + G K+ LVERL         Q +DA+ AAEP+ + T  
Sbjct: 34  TDYASMTVAQLKDVLKERELPTQGLKAALVERL---------QQADAT-AAEPTDATTRP 83

Query: 63  -----------------------PEKAAEISP---APQKDPQALAIAHLERKLRRAKKFA 96
                                   E+ A   P   +P++  QA A+AHL +KL RA+KF 
Sbjct: 84  AAEEHTPEAAEPAATPAEAEAPVAEQRAAAEPRTLSPEEMKQA-AVAHLSKKLHRARKFG 142

Query: 97  DDQATLDYLERQIARVRKFGLDTTTELARELGLGKGPETAVPTRSVRSRTARKSNK 152
           +D A +  L++Q+AR+ KFGLD TT+LA+ELG G+GP  AV   +   R      K
Sbjct: 143 EDDAAVGALQKQLARLEKFGLDLTTQLAQELGFGRGPAAAVGKHAFHRRRGYHQGK 198

>Scas_704.31*
          Length = 222

 Score = 71.6 bits (174), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 80/177 (45%), Gaps = 48/177 (27%)

Query: 5   TKYAEQTVEQLQNELQSRQLDSDGEKSQLVERLEADDAKK----------------GQQN 48
           T+Y++ TV QL+  L  R L  +G K  LVERL  +DA+                  +  
Sbjct: 2   TEYSKLTVAQLKELLTQRSLPLEGLKKDLVERLVKNDAEATSSVGETTATPAEATVAEST 61

Query: 49  SDASGAAEPS------------KSETPEKAAEISPAP--------------------QKD 76
             +  AAEPS              E    AA ++ A                     Q++
Sbjct: 62  EQSEAAAEPSVETAAPAPAVTAPVEPATNAAPVTAATETKEGEPTKPEEKEEKKPLTQEE 121

Query: 77  PQALAIAHLERKLRRAKKFADDQATLDYLERQIARVRKFGLDTTTELARELGLGKGP 133
            + +A+  L +K+ RAKKFA +Q+++D LER I R+ KFGLD  + LA ELGL   P
Sbjct: 122 MKTMALELLNKKIHRAKKFAAEQSSIDELERMITRIEKFGLDLNSTLAVELGLAPKP 178

>YER063W (THO1) [1494] chr5 (281708..282364) Protein that suppresses
           the transcriptional defects of hpr1 null mutant upon
           overproduction [657 bp, 218 aa]
          Length = 218

 Score = 68.2 bits (165), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/175 (33%), Positives = 79/175 (45%), Gaps = 53/175 (30%)

Query: 7   YAEQTVEQLQNELQSRQLDSDGEKSQLVERLEADDAK-KGQ-----------QNSDASGA 54
           Y+  TV QL++ L  R L   G K++LV+RL  DD + KG+           Q S+ +  
Sbjct: 4   YSSLTVVQLKDLLTKRNLSVGGLKNELVQRLIKDDEESKGESEVSPQEQNQEQGSEPAAI 63

Query: 55  AEPSKSETPEKAAEISPAPQ---------KDPQ--------------------------- 78
            EP+     EK  E+S  P+         KD Q                           
Sbjct: 64  EEPASQNITEKK-EVSSEPKETNEPKEENKDVQKPSDGPSATASENEQAAASTAAPALSP 122

Query: 79  ----ALAIAHLERKLRRAKKFADDQATLDYLERQIARVRKFGLDTTTELARELGL 129
               A A+  L +KL RA KF  DQA +D L+RQI RV KFG+D  ++LA ELGL
Sbjct: 123 EEIKAKALDLLNKKLHRANKFGQDQADIDSLQRQINRVEKFGVDLNSKLAEELGL 177

>CAGL0J02992g 286008..286700 similar to sp|P40040 Saccharomyces
           cerevisiae YER063w THO1, start by similarity
          Length = 230

 Score = 51.2 bits (121), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 75/193 (38%), Gaps = 61/193 (31%)

Query: 4   TTKYAEQTVEQLQNELQSRQLDSDGEKSQLVERLEADDAKKGQQNSD------------- 50
            + Y+  TV QL+  L  R L   G K+QLVERL  DD  K                   
Sbjct: 1   MSNYSALTVVQLKELLTERNLSVAGLKNQLVERLTNDDKAKEAAGEAAPAPVTEEAAPAP 60

Query: 51  ---------------------------ASGAAEPS-KSETPEKAAEISPA---------- 72
                                      AS  A P+  SE P +A+E  PA          
Sbjct: 61  AAAPVAAEVEEAKPEEAKPEEETKAEPASNEAAPAVASEQPAEASEDKPAEVQEKAPEVK 120

Query: 73  -PQKDPQALAIAH---------LERKLRRAKKFADDQATLDYLERQIARVRKFGLDTTTE 122
            P+K+   +  A          +++KL RAKKF  +Q  +D LE+   R+ +FG+D    
Sbjct: 121 EPEKELFDILTAEEIKQRATELIDKKLHRAKKFGAEQDQIDSLEKLKVRIDRFGVDRNMS 180

Query: 123 LARELGLGKGPET 135
           +A ELGL K  E 
Sbjct: 181 IALELGLVKPKEV 193

>CAGL0C01617g 174618..175334 no similarity, hypothetical start
          Length = 238

 Score = 30.8 bits (68), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 7/50 (14%)

Query: 73  PQKDPQALAIAHLERKLRRAKKFADDQATLDYLERQIARVR---KFGLDT 119
           PQ +    AIA L R LR  +K   D+ T+DY+E ++ R++   K+ LDT
Sbjct: 77  PQNELATKAIATLFR-LRLTEK---DEVTIDYMEDRLFRIKNTLKYALDT 122

>Scas_711.51
          Length = 710

 Score = 30.4 bits (67), Expect = 0.62,   Method: Composition-based stats.
 Identities = 30/111 (27%), Positives = 51/111 (45%), Gaps = 13/111 (11%)

Query: 5   TKYAEQTVEQLQNELQSRQLDSDGEKS-QLVERLEADDAKKGQQNSDASGAAEPSKSETP 63
           T  ++Q+  + ++E QSR+ D    +S QL++RL+  DAK  + N+       P   E P
Sbjct: 570 TIMSKQSDLRRKSEEQSRRWDDQTSRSSQLIKRLQDLDAKILEINN------SPKLKEYP 623

Query: 64  EKAAEISPAPQKDPQALAIAHLERKLRRAKKFADDQATLDYLERQIARVRK 114
               E+    +   Q L         R      D Q  L++L++ +AR+ K
Sbjct: 624 INDKELEWFKEIRNQVLKFNSFVHNQR------DAQEELNHLKKDLARISK 668

>YPR156C (TPO3) [5571] chr16 complement(837903..839771) Polyamine
           transport protein, member of the multidrug-resistance
           12-spanner (DHA12) family of the major facilitator
           superfamily (MFS-MDR) [1869 bp, 622 aa]
          Length = 622

 Score = 30.0 bits (66), Expect = 0.80,   Method: Composition-based stats.
 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 20  QSRQLDSDGEKSQLVERLEADDAKKGQQNSDASGAAEPSKSETPE 64
           ++RQ+D     S   + LE+D+ +KG++  D+SGA + +    PE
Sbjct: 113 RTRQIDGASSPSSNEDALESDNNEKGKE-GDSSGANDEAPDLDPE 156

>ACL011C [1038] [Homologous to ScYMR003W - SH] (337457..338302) [846
           bp, 281 aa]
          Length = 281

 Score = 29.6 bits (65), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 20/31 (64%)

Query: 7   YAEQTVEQLQNELQSRQLDSDGEKSQLVERL 37
           ++   ++ L+NE +SR L   G KS L+ER+
Sbjct: 72  FSAMNLKALRNECRSRGLQVSGRKSDLIERI 102

>YMR003W (YMR003W) [3968] chr13 (273118..273714) Protein containing
           a SAP domain, which may bind DNA [597 bp, 198 aa]
          Length = 198

 Score = 29.3 bits (64), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%)

Query: 4   TTKYAEQTVEQLQNELQSRQLDSDGEKSQLVERLEADDAKKGQQNS 49
            T + + TV+ L+ + +SR L   G KS L++RL   D+   +++S
Sbjct: 66  ITPFQKFTVKVLKEQCKSRGLKLSGRKSDLLQRLITHDSCSNKKSS 111

>KLLA0C06072g complement(534152..534913) no similarity,
          hypothetical start
          Length = 253

 Score = 29.3 bits (64), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 22/31 (70%)

Query: 7  YAEQTVEQLQNELQSRQLDSDGEKSQLVERL 37
          +   +++ L+NE ++R L   G+K++LVER+
Sbjct: 57 FTRMSLKTLKNECRTRGLKVSGKKTELVERI 87

>Kwal_26.7260
          Length = 332

 Score = 28.5 bits (62), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%)

Query: 50  DASGAAEPSKSETPEKAAEISPAPQKDPQALAIAHLERKLRRAK 93
           D  G+ EPS+    +   +I+    KDPQ+  I  LE++L RA+
Sbjct: 134 DIEGSVEPSRDRKAKITDKIAYLKYKDPQSTKIEILEQELVRAE 177

>ADR267W [2008] [Homologous to ScYMR148W - SH]
           complement(1162212..1162685) [474 bp, 157 aa]
          Length = 157

 Score = 28.1 bits (61), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 25/60 (41%), Gaps = 4/60 (6%)

Query: 40  DDAKKGQQNSDASGAAEPSKSETPEKAAEISPAPQKDPQALAIAHLERKLRRAKKFADDQ 99
           D +  G      SG   P     PE  +E+S +P  +  AL +AH +R  RR    A   
Sbjct: 102 DSSSYGATTQTGSG---PESGPVPELGSEVSASPSPELAALPVAH-KRSGRRTGTLASGM 157

>ADR056W [1797] [Homologous to ScYBR162C (TOS1) - SH]
           complement(808605..810110) [1506 bp, 501 aa]
          Length = 501

 Score = 28.1 bits (61), Expect = 3.0,   Method: Composition-based stats.
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 44  KGQQNSDASGAAEPSKSETPEKAAEISPAP 73
           KG  +++   AA P+ +  P KA E +PAP
Sbjct: 140 KGGAHAETPVAAAPASTSEPAKAVESAPAP 169

>KLLA0F08162g 763454..764377 highly similar to sp|P53252
           Saccharomyces cerevisiae YGR086c, start by similarity
          Length = 307

 Score = 28.1 bits (61), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 26/44 (59%)

Query: 50  DASGAAEPSKSETPEKAAEISPAPQKDPQALAIAHLERKLRRAK 93
           D  G+ +PS+    + A +I+    KDPQ+  I  LE++L RA+
Sbjct: 134 DIEGSVQPSRERRAKIADKIAYLKYKDPQSPKIEVLEQELVRAE 177

>CAGL0E04576g complement(440557..442605) similar to sp|P32325
           Saccharomyces cerevisiae YDR052c DBF4 regulatory subunit
           for CDC7P protein kinase, hypothetical start
          Length = 682

 Score = 27.7 bits (60), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 63/137 (45%), Gaps = 20/137 (14%)

Query: 9   EQTVEQLQNELQSRQLDSDGEKSQLVERLEADDAKKGQQNSDASGAAEPSKSETPEKAAE 68
           E  + Q + E+   ++D+D  +S++ E   A+++K  Q++S   G     K E  +++  
Sbjct: 416 ESEIRQNEKEISIGKIDNDNGESKIEEI--AENSKLVQRDSVWKGIVPTVKLEQSKRSL- 472

Query: 69  ISPAPQKDPQALAIAHLERKLRRAKKFADDQATLDYLERQIARVRKFGLDTTTELARELG 128
               PQ + Q              ++F DD  T+    R    ++  G+  + ++A   G
Sbjct: 473 ----PQLNRQ------------ETEEFPDDLCTVKKYSRDQYEIKASGVHQSNDIATSFG 516

Query: 129 LGKGPETA-VPTRSVRS 144
            G GP  A V +++++S
Sbjct: 517 NGLGPTRASVMSKNMKS 533

>Sklu_2406.3 YOR220W, Contig c2406 1777-2433 reverse complement
          Length = 218

 Score = 27.3 bits (59), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 37/84 (44%), Gaps = 3/84 (3%)

Query: 37  LEADDAKKGQQNSDASGAAEPSKSETPEKAAEISPAPQKDPQALAIAHLERKLRRAKKFA 96
           L  D A     NS AS     S S +P+K+   SP   + P    + + +  L +    A
Sbjct: 112 LSIDTAASVTNNSSASLG---SPSLSPDKSTLQSPTRLRFPHDSKVHYYQEPLPKHLGSA 168

Query: 97  DDQATLDYLERQIARVRKFGLDTT 120
           D+   +D+  + + R R   ++TT
Sbjct: 169 DNGQHIDHTTKFLYRPRNLNINTT 192

>YMR237W (YMR237W) [4193] chr13 (743748..745922) Protein with high
           similarity to S. cerevisiae Bud7p, which is required for
           bipolar budding pattern [2175 bp, 724 aa]
          Length = 724

 Score = 26.9 bits (58), Expect = 8.2,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 21/41 (51%)

Query: 6   KYAEQTVEQLQNELQSRQLDSDGEKSQLVERLEADDAKKGQ 46
           KY    +  +   +Q+  ++SDGE+SQL    EA   +  Q
Sbjct: 145 KYDVNIIVHIPGTVQTYIINSDGEQSQLPSVAEASSGRNSQ 185

>Sklu_2162.2 YGR086C, Contig c2162 2407-3351 reverse complement
          Length = 314

 Score = 26.9 bits (58), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (56%)

Query: 50  DASGAAEPSKSETPEKAAEISPAPQKDPQALAIAHLERKLRRAK 93
           D  G+ +PS+    +   +I+    KDPQ+  I  LE++L RA+
Sbjct: 134 DIEGSVQPSRDRKAKITDKIAYLKYKDPQSPKIEVLEQELVRAE 177

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.306    0.122    0.318 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,726,479
Number of extensions: 182194
Number of successful extensions: 1116
Number of sequences better than 10.0: 136
Number of HSP's gapped: 1107
Number of HSP's successfully gapped: 138
Length of query: 156
Length of database: 16,596,109
Length adjustment: 93
Effective length of query: 63
Effective length of database: 13,376,635
Effective search space: 842728005
Effective search space used: 842728005
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 57 (26.6 bits)