Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.583124924611721e-165
YER062C (HOR2)25024310451e-145
YIL053W (RHR2)27124310441e-145
CAGL0M12430g24924610391e-144
Scas_701.825024310321e-143
CAGL0M11660g24824310311e-143
ADL071C2532429291e-128
CAGL0I05874g2472449141e-125
KLLA0C08217g2562459001e-123
Scas_704.322472448831e-121
Sklu_2394.32432282744e-29
CAGL0D04092g2512342702e-28
Scas_690.302592262623e-27
CAGL0M12925g2462252581e-26
YHR043C (DOG2)2462252544e-26
YHR044C (DOG1)2462252465e-25
Scas_690.312442242404e-24
KLLA0C11143g2682262329e-23
AAL123W2892382293e-22
KLLA0F21802g610127800.037
CAGL0L01969g237182750.12
Kwal_26.808022393652.1
KLLA0F05049g69355643.8
CAGL0A01386g110229635.0
Scas_714.22221151599.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.5831
         (246 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.5831                                                          456   e-165
YER062C (HOR2) [1493] chr5 complement(279928..280680) DL-glycero...   407   e-145
YIL053W (RHR2) [2614] chr9 (255050..255865) DL-glycerol phosphat...   406   e-145
CAGL0M12430g complement(1238150..1238899) highly similar to sp|P...   404   e-144
Scas_701.8                                                            402   e-143
CAGL0M11660g complement(1158566..1159312) highly similar to sp|P...   401   e-143
ADL071C [1670] [Homologous to ScYIL053W (RHR2) - SH; ScYER062C (...   362   e-128
CAGL0I05874g complement(558102..558845) highly similar to sp|P41...   356   e-125
KLLA0C08217g 721753..722523 highly similar to sp|P41277 Saccharo...   351   e-123
Scas_704.32                                                           344   e-121
Sklu_2394.3 YHR043C, Contig c2394 2120-2851 reverse complement        110   4e-29
CAGL0D04092g 405613..406368 similar to sp|P38773 Saccharomyces c...   108   2e-28
Scas_690.30                                                           105   3e-27
CAGL0M12925g 1274919..1275659 similar to sp|P38773 Saccharomyces...   103   1e-26
YHR043C (DOG2) [2331] chr8 complement(192797..193537) 2-Deoxyglu...   102   4e-26
YHR044C (DOG1) [2332] chr8 complement(194060..194800) 2-Deoxyglu...    99   5e-25
Scas_690.31                                                            97   4e-24
KLLA0C11143g 956474..957280 similar to sp|P38773 Saccharomyces c...    94   9e-23
AAL123W [64] [Homologous to ScYHR043C (DOG2) - SH; ScYHR044C (DO...    93   3e-22
KLLA0F21802g 2029687..2031519 similar to sp|P38767 Saccharomyces...    35   0.037
CAGL0L01969g 228760..229473 similar to tr|Q86ZR7 Saccharomyces c...    33   0.12 
Kwal_26.8080                                                           30   2.1  
KLLA0F05049g 494045..496126 similar to sp|P48445 Saccharomyces c...    29   3.8  
CAGL0A01386g 136693..140001 some similarities with sp|P08640 Sac...    29   5.0  
Scas_714.22                                                            27   9.8  

>Kwal_23.5831
          Length = 249

 Score =  456 bits (1172), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 227/246 (92%), Positives = 227/246 (92%)

Query: 1   MTLSKPLSFKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHESHGWRTYDA 60
           MTLSKPLSFKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHESHGWRTYDA
Sbjct: 1   MTLSKPLSFKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHESHGWRTYDA 60

Query: 61  IAKFAPDFADEDYATQLEAEIPEKYGEHSIEVPGAVKLCKDLNALPKEKWAVATSGTRPM 120
           IAKFAPDFADEDYATQLEAEIPEKYGEHSIEVPGAVKLCKDLNALPKEKWAVATSGTRPM
Sbjct: 61  IAKFAPDFADEDYATQLEAEIPEKYGEHSIEVPGAVKLCKDLNALPKEKWAVATSGTRPM 120

Query: 121 ASKWFEHLGIEKPEYFITANDVKQGKPFPEPYLKGRNGLGFPINEQDPSKSKVIVFEDXX 180
           ASKWFEHLGIEKPEYFITANDVKQGKPFPEPYLKGRNGLGFPINEQDPSKSKVIVFED  
Sbjct: 121 ASKWFEHLGIEKPEYFITANDVKQGKPFPEPYLKGRNGLGFPINEQDPSKSKVIVFEDAP 180

Query: 181 XXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKDHESIRVGGYDAETDEVEFIFDDFL 240
                            TTFDLDFLKEKGCDIIVKDHESIRVGGYDAETDEVEFIFDDFL
Sbjct: 181 AGIAAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKDHESIRVGGYDAETDEVEFIFDDFL 240

Query: 241 YAKDDL 246
           YAKDDL
Sbjct: 241 YAKDDL 246

>YER062C (HOR2) [1493] chr5 complement(279928..280680) DL-glycerol
           phosphate phosphatase (sn-glycerol-3-phosphatase) [753
           bp, 250 aa]
          Length = 250

 Score =  407 bits (1045), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 199/243 (81%), Positives = 211/243 (86%)

Query: 4   SKPLSFKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHESHGWRTYDAIAK 63
           +KPLS KVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVI  SHGWRT+DAIAK
Sbjct: 5   TKPLSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFDAIAK 64

Query: 64  FAPDFADEDYATQLEAEIPEKYGEHSIEVPGAVKLCKDLNALPKEKWAVATSGTRPMASK 123
           FAPDFA+E+Y  +LEAEIP KYGE SIEVPGAVKLC  LNALPKEKWAVATSGTR MA K
Sbjct: 65  FAPDFANEEYVNKLEAEIPVKYGEKSIEVPGAVKLCNALNALPKEKWAVATSGTRDMAQK 124

Query: 124 WFEHLGIEKPEYFITANDVKQGKPFPEPYLKGRNGLGFPINEQDPSKSKVIVFEDXXXXX 183
           WFEHLGI +P+YFITANDVKQGKP PEPYLKGRNGLG+PINEQDPSKSKV+VFED     
Sbjct: 125 WFEHLGIRRPKYFITANDVKQGKPHPEPYLKGRNGLGYPINEQDPSKSKVVVFEDAPAGI 184

Query: 184 XXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKDHESIRVGGYDAETDEVEFIFDDFLYAK 243
                         TTFDLDFLKEKGCDIIVK+HESIRVGGY+AETDEVEFIFDD+LYAK
Sbjct: 185 AAGKAAGCKIIGIATTFDLDFLKEKGCDIIVKNHESIRVGGYNAETDEVEFIFDDYLYAK 244

Query: 244 DDL 246
           DDL
Sbjct: 245 DDL 247

>YIL053W (RHR2) [2614] chr9 (255050..255865) DL-glycerol phosphate
           phosphatase (sn-glycerol-3-phosphatase) [816 bp, 271 aa]
          Length = 271

 Score =  406 bits (1044), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 199/243 (81%), Positives = 210/243 (86%)

Query: 4   SKPLSFKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHESHGWRTYDAIAK 63
           +KPLS K+NAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIH SHGWRTYDAIAK
Sbjct: 26  TKPLSLKINAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAK 85

Query: 64  FAPDFADEDYATQLEAEIPEKYGEHSIEVPGAVKLCKDLNALPKEKWAVATSGTRPMASK 123
           FAPDFADE+Y  +LE EIPEKYGEHSIEVPGAVKLC  LNALPKEKWAVATSGTR MA K
Sbjct: 86  FAPDFADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCNALNALPKEKWAVATSGTRDMAKK 145

Query: 124 WFEHLGIEKPEYFITANDVKQGKPFPEPYLKGRNGLGFPINEQDPSKSKVIVFEDXXXXX 183
           WF+ L I++PEYFITANDVKQGKP PEPYLKGRNGLGFPINEQDPSKSKV+VFED     
Sbjct: 146 WFDILKIKRPEYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKVVVFEDAPAGI 205

Query: 184 XXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKDHESIRVGGYDAETDEVEFIFDDFLYAK 243
                         TTFDLDFLKEKGCDIIVK+HESIRVG Y+AETDEVE IFDD+LYAK
Sbjct: 206 AAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVGEYNAETDEVELIFDDYLYAK 265

Query: 244 DDL 246
           DDL
Sbjct: 266 DDL 268

>CAGL0M12430g complement(1238150..1238899) highly similar to
           sp|P41277 Saccharomyces cerevisiae YIL053w RHR2 or
           sp|P40106 Saccharomyces cerevisiae YER062c GPP2,
           hypothetical start
          Length = 249

 Score =  404 bits (1039), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 196/246 (79%), Positives = 214/246 (86%)

Query: 1   MTLSKPLSFKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHESHGWRTYDA 60
           M+L+KP+S KVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIH SHGWRTYDA
Sbjct: 1   MSLAKPVSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDA 60

Query: 61  IAKFAPDFADEDYATQLEAEIPEKYGEHSIEVPGAVKLCKDLNALPKEKWAVATSGTRPM 120
           IAKFAPD+ADE+Y  +LE EIPEKYGEHSIEVPGAVKLC DLN LPKEKWAVATSGTR M
Sbjct: 61  IAKFAPDYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNKLPKEKWAVATSGTRDM 120

Query: 121 ASKWFEHLGIEKPEYFITANDVKQGKPFPEPYLKGRNGLGFPINEQDPSKSKVIVFEDXX 180
           A KWF+ L I++PEYFITANDVKQGKPFPEPY+KGR GLG+PIN++DPSKSKV+VFED  
Sbjct: 121 AQKWFKFLNIDRPEYFITANDVKQGKPFPEPYIKGREGLGYPINKEDPSKSKVVVFEDAP 180

Query: 181 XXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKDHESIRVGGYDAETDEVEFIFDDFL 240
                            TTFD+DFLKEKGCDIIVK+HESIRVGGY+ ETDEVEFIFDD+L
Sbjct: 181 AGIAAGQAAGCKIIGIATTFDVDFLKEKGCDIIVKNHESIRVGGYNPETDEVEFIFDDYL 240

Query: 241 YAKDDL 246
           YAKDDL
Sbjct: 241 YAKDDL 246

>Scas_701.8
          Length = 250

 Score =  402 bits (1032), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 198/243 (81%), Positives = 209/243 (86%)

Query: 4   SKPLSFKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHESHGWRTYDAIAK 63
           +KPLS KVNAALFDVDGTIIISQ AIAAFWRDFGKDKPYFDAEHVIH SHGWRTYDAIAK
Sbjct: 5   TKPLSLKVNAALFDVDGTIIISQGAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAK 64

Query: 64  FAPDFADEDYATQLEAEIPEKYGEHSIEVPGAVKLCKDLNALPKEKWAVATSGTRPMASK 123
           FAPDFADE+  ++LE EIPEKYGEHSIEVPGAVKLC DLN LPKEKWAVATSGTR MA+K
Sbjct: 65  FAPDFADEELVSKLEGEIPEKYGEHSIEVPGAVKLCNDLNKLPKEKWAVATSGTREMATK 124

Query: 124 WFEHLGIEKPEYFITANDVKQGKPFPEPYLKGRNGLGFPINEQDPSKSKVIVFEDXXXXX 183
           WF+ L I++P+YFITANDVKQGKP PEPYLKGRNGLGFPINEQDPSKSK IVFED     
Sbjct: 125 WFDLLKIKRPQYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKAIVFEDAPAGI 184

Query: 184 XXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKDHESIRVGGYDAETDEVEFIFDDFLYAK 243
                         TTFDLDFLKEKGCDIIVK+HESIRVGGYD  TDEVEFIFDD+LYAK
Sbjct: 185 VAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVGGYDPVTDEVEFIFDDYLYAK 244

Query: 244 DDL 246
           DDL
Sbjct: 245 DDL 247

>CAGL0M11660g complement(1158566..1159312) highly similar to
           sp|P41277 Saccharomyces cerevisiae YIL053w RHR2 or
           sp|P40106 Saccharomyces cerevisiae YER062c GPP2,
           hypothetical start
          Length = 248

 Score =  401 bits (1031), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 196/243 (80%), Positives = 210/243 (86%)

Query: 4   SKPLSFKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHESHGWRTYDAIAK 63
           + P+S KVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIH SHGWRTYDAIAK
Sbjct: 3   TSPVSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAK 62

Query: 64  FAPDFADEDYATQLEAEIPEKYGEHSIEVPGAVKLCKDLNALPKEKWAVATSGTRPMASK 123
           FAPD+ADE+Y  +LE EIPEKYGEHSIEVPGAVKLC DLN LPKEKWAVATSGTR MA K
Sbjct: 63  FAPDYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNKLPKEKWAVATSGTRDMAQK 122

Query: 124 WFEHLGIEKPEYFITANDVKQGKPFPEPYLKGRNGLGFPINEQDPSKSKVIVFEDXXXXX 183
           WF+ L IE+PEYFITANDVKQGKPFPEPYLKGR GLGFPIN++DPSKSKV+VFED     
Sbjct: 123 WFKILNIERPEYFITANDVKQGKPFPEPYLKGREGLGFPINKEDPSKSKVVVFEDAPAGI 182

Query: 184 XXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKDHESIRVGGYDAETDEVEFIFDDFLYAK 243
                         TTFD+DFLKEKGCDIIVK+HESIRVGGY+ ETDEVEFIFDD+LYAK
Sbjct: 183 AAGKAAGCKIIGIATTFDVDFLKEKGCDIIVKNHESIRVGGYNPETDEVEFIFDDYLYAK 242

Query: 244 DDL 246
           DDL
Sbjct: 243 DDL 245

>ADL071C [1670] [Homologous to ScYIL053W (RHR2) - SH; ScYER062C
           (HOR2) - SH] (556136..556897) [762 bp, 253 aa]
          Length = 253

 Score =  362 bits (929), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 173/242 (71%), Positives = 196/242 (80%)

Query: 5   KPLSFKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHESHGWRTYDAIAKF 64
           +P+S KVN ALFDVDGTIIISQPA+AAFWR+FGKDKPYFDAEHVI  +HGWRTYDAIA F
Sbjct: 9   QPISLKVNGALFDVDGTIIISQPALAAFWREFGKDKPYFDAEHVISATHGWRTYDAIATF 68

Query: 65  APDFADEDYATQLEAEIPEKYGEHSIEVPGAVKLCKDLNALPKEKWAVATSGTRPMASKW 124
           APD+  E+Y T+LE EIP+KYG+ S+EVPGAV LC  LN LPKEKWAV TSGT  MA KW
Sbjct: 69  APDYLSEEYVTRLEGEIPDKYGKFSVEVPGAVTLCNALNELPKEKWAVGTSGTFEMAHKW 128

Query: 125 FEHLGIEKPEYFITANDVKQGKPFPEPYLKGRNGLGFPINEQDPSKSKVIVFEDXXXXXX 184
           F+ LGI++P  FITANDVKQGKP PEPY+KGRN LGFPINEQ+P  SKVIVFED      
Sbjct: 129 FDVLGIKRPSTFITANDVKQGKPHPEPYIKGRNALGFPINEQNPKGSKVIVFEDAPAGIA 188

Query: 185 XXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKDHESIRVGGYDAETDEVEFIFDDFLYAKD 244
                        TTFD+++LKE+GCDIIVKDH SIRVGGY+ ETDEVEF+FDD+LYAKD
Sbjct: 189 AGKAAGCKIVGVATTFDVEYLKERGCDIIVKDHRSIRVGGYNPETDEVEFVFDDYLYAKD 248

Query: 245 DL 246
           DL
Sbjct: 249 DL 250

>CAGL0I05874g complement(558102..558845) highly similar to sp|P41277
           Saccharomyces cerevisiae YIL053w RHR2 or sp|P40106
           Saccharomyces cerevisiae YER062c GPP2, hypothetical
           start
          Length = 247

 Score =  356 bits (914), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 170/244 (69%), Positives = 193/244 (79%)

Query: 3   LSKPLSFKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHESHGWRTYDAIA 62
           + +P++ +VNAALFDVDGTIIISQPA+AAFWRDFGKDKPYFDAEHVIH SHGWRTYDAIA
Sbjct: 1   MPEPITLRVNAALFDVDGTIIISQPALAAFWRDFGKDKPYFDAEHVIHVSHGWRTYDAIA 60

Query: 63  KFAPDFADEDYATQLEAEIPEKYGEHSIEVPGAVKLCKDLNALPKEKWAVATSGTRPMAS 122
           KFAPDFADE+  T+LE EIP+KYG+ +IEV GAVKLC   N LPKEKWAVATSGTR MAS
Sbjct: 61  KFAPDFADEETVTKLEGEIPDKYGKEAIEVAGAVKLCNSFNELPKEKWAVATSGTREMAS 120

Query: 123 KWFEHLGIEKPEYFITANDVKQGKPFPEPYLKGRNGLGFPINEQDPSKSKVIVFEDXXXX 182
           KWF  LGI+KP YFITANDVK+GKP PEPYLKGR GLG+PIN   P KSKV+VFED    
Sbjct: 121 KWFAVLGIKKPTYFITANDVKKGKPNPEPYLKGREGLGYPINTHYPEKSKVVVFEDAPAG 180

Query: 183 XXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKDHESIRVGGYDAETDEVEFIFDDFLYA 242
                          TTF    L+EKGCDI++KDH S+RV GYD ETDEV  +FDD+LY 
Sbjct: 181 IAAGKAAGCKIIGIATTFSASSLREKGCDIVIKDHRSVRVAGYDKETDEVILVFDDYLYV 240

Query: 243 KDDL 246
           +DD+
Sbjct: 241 RDDI 244

>KLLA0C08217g 721753..722523 highly similar to sp|P41277
           Saccharomyces cerevisiae YIL053w RHR2 DL-glycerol
           phosphatase, start by similarity
          Length = 256

 Score =  351 bits (900), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 166/245 (67%), Positives = 195/245 (79%)

Query: 2   TLSKPLSFKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHESHGWRTYDAI 61
           T  +P+S +VNAALFDVDGT+IISQPAIA FWRDFGKDKPYFD++HVI  SHGWRTYD I
Sbjct: 9   TAQQPISLRVNAALFDVDGTLIISQPAIAEFWRDFGKDKPYFDSQHVIDISHGWRTYDVI 68

Query: 62  AKFAPDFADEDYATQLEAEIPEKYGEHSIEVPGAVKLCKDLNALPKEKWAVATSGTRPMA 121
            +FAPD+A+E+Y T+LE EIPEK+G+H+IEVPGA KLC +LN LPKEKWAVATSGT  MA
Sbjct: 69  KQFAPDYANEEYVTKLEGEIPEKFGQHAIEVPGASKLCGELNKLPKEKWAVATSGTYEMA 128

Query: 122 SKWFEHLGIEKPEYFITANDVKQGKPFPEPYLKGRNGLGFPINEQDPSKSKVIVFEDXXX 181
            KWF+ LGI++P  FITANDVK GKP PEPYLKGRNGL +PIN+++P+ SKVIVFED   
Sbjct: 129 HKWFDILGIKRPSNFITANDVKNGKPHPEPYLKGRNGLSYPINKENPAASKVIVFEDAPA 188

Query: 182 XXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKDHESIRVGGYDAETDEVEFIFDDFLY 241
                           TTFD +FL EKGCDI++KDH  +RV  Y  ETDEVEFIFD++LY
Sbjct: 189 GILAGKAAGCKIVGIATTFDKEFLIEKGCDIVIKDHTKLRVAAYHPETDEVEFIFDEYLY 248

Query: 242 AKDDL 246
           AKDDL
Sbjct: 249 AKDDL 253

>Scas_704.32
          Length = 247

 Score =  344 bits (883), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 162/244 (66%), Positives = 195/244 (79%)

Query: 3   LSKPLSFKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHESHGWRTYDAIA 62
           ++ P++ +VNAALFDVDGTIIISQPA+AAFW+ FG+DKPYFDA+ V H +HGWRTYDAI 
Sbjct: 1   MNNPIALRVNAALFDVDGTIIISQPALAAFWKHFGEDKPYFDADLVTHATHGWRTYDAIE 60

Query: 63  KFAPDFADEDYATQLEAEIPEKYGEHSIEVPGAVKLCKDLNALPKEKWAVATSGTRPMAS 122
           KFAPD+AD +Y TQLE EIP K+G+H++EVPGAVKLC + N LPKE+WAVATSGT  MAS
Sbjct: 61  KFAPDWADREYVTQLEGEIPTKFGQHALEVPGAVKLCNEFNKLPKERWAVATSGTFEMAS 120

Query: 123 KWFEHLGIEKPEYFITANDVKQGKPFPEPYLKGRNGLGFPINEQDPSKSKVIVFEDXXXX 182
           KWFE L IE+P  FITANDV++GKP P+PYLKGRNGLGFPIN  +PSKSKV+VFED    
Sbjct: 121 KWFELLKIERPTNFITANDVERGKPHPDPYLKGRNGLGFPINATNPSKSKVVVFEDAPAG 180

Query: 183 XXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKDHESIRVGGYDAETDEVEFIFDDFLYA 242
                          TTFD +FLKEKGCD+IV +HESI++ GY  ETDE+E +F D+L+A
Sbjct: 181 IESGKAAGCKIVGVATTFDEEFLKEKGCDLIVSNHESIKLNGYYPETDEIELVFHDYLFA 240

Query: 243 KDDL 246
           KDDL
Sbjct: 241 KDDL 244

>Sklu_2394.3 YHR043C, Contig c2394 2120-2851 reverse complement
          Length = 243

 Score =  110 bits (274), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 112/228 (49%), Gaps = 20/228 (8%)

Query: 9   FKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHESHGWRTYDAIAKFAP-- 66
           FKVN  LFD+DGTI+ +  A  + W++  K K   D E +   SHG RT +  +KF P  
Sbjct: 4   FKVNLCLFDLDGTIVSTTIAAESAWKELCK-KHGVDPEELFKCSHGARTSEIFSKFFPSI 62

Query: 67  DFADEDYATQLEAEIPEKYGEHSIEVPGAVKL------CKD--LNALPKEKWAVATSGTR 118
           D  D     +LE  I   Y +    +PGA +L      C D   +   K KWA+ TSG+ 
Sbjct: 63  DNTDNQAVKKLELAIAHDYLDSVGLIPGASELLLSLDKCSDPPFDNFSKRKWAIVTSGSS 122

Query: 119 PMASKWF----EHLGIEKPEYFITANDVKQGKPFPEPYLKGRNGLGFPINEQDPSKSKVI 174
            +A  WF    +H+G  KP+ FITA DV +GKP PE Y K R+ L    + + P   +++
Sbjct: 123 DLAFSWFDTILQHIG--KPDVFITAFDVVKGKPDPEGYSKARDQLSKIWSLEFP---EIV 177

Query: 175 VFEDXXXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKDHESIRV 222
           VFED                   +T+  D L E G D +V D  ++ V
Sbjct: 178 VFEDAPVGIKAGKEIGAITVGITSTYSKDVLFEAGADYVVSDLTNVIV 225

>CAGL0D04092g 405613..406368 similar to sp|P38773 Saccharomyces
           cerevisiae YHR043c DOG2 2-deoxyglucose-6-phosphate
           phosphatase, hypothetical start
          Length = 251

 Score =  108 bits (270), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 78/234 (33%), Positives = 110/234 (47%), Gaps = 14/234 (5%)

Query: 1   MTLSKPLSFKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHESHGWRTYDA 60
           MT+ K   F V+  LFD+DGTI+ +  A  + WR     K   D E +   SHG RT + 
Sbjct: 1   MTVKKDNQFSVDVCLFDLDGTIVSTTVAAESAWRMLCA-KEGVDPEELFKFSHGVRTSEV 59

Query: 61  IAKFAP--DFADEDYATQLEAEIPEKYGEHSIEVPGAVKLCKDLNA--------LPKEKW 110
           +AKF P  D  D     +LE  +   + +    +PGA  L   L+           + KW
Sbjct: 60  LAKFFPNIDNTDNKMTRELELSMANNFLDTVSLIPGAKDLLLTLDKDTARQGAKFNERKW 119

Query: 111 AVATSGTRPMASKWFEHLGIE--KPEYFITANDVKQGKPFPEPYLKGRNGLGFPINEQDP 168
           A+ TSG+  +A  WF+ +  E  KP+ FITA DV +GKP PE Y K +  L   +  +  
Sbjct: 120 AIVTSGSPDLAFSWFKTILKEVGKPDVFITAFDVTKGKPDPEGYAKAKKLLCERLQYESA 179

Query: 169 SKSKVIVFEDXXXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKDHESIRV 222
           S + V VFED                   +T+DL  L + G D +VKD   + V
Sbjct: 180 SATSV-VFEDAPAGIKAGKAMGAITVGITSTYDLQTLIDAGADYVVKDLTQVEV 232

>Scas_690.30
          Length = 259

 Score =  105 bits (262), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 73/226 (32%), Positives = 109/226 (48%), Gaps = 13/226 (5%)

Query: 8   SFKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHESHGWRTYDAIAKFAP- 66
           SF V+  LFD+DGT++ +  A  A W D   +    + + +   SHG +T + +A++ P 
Sbjct: 5   SFNVDVCLFDLDGTLVNTIKASEAVWTDLCNEHG-VNPQELFKHSHGVKTSEVLAEWFPM 63

Query: 67  -DFADEDYATQLEAEIPEKYGEHSIEVPGAVKLCKDLN-------ALPKEKWAVATSGTR 118
            D  D+     LE  +   +      VPGA+ L K L+           +KWA+ TSG+ 
Sbjct: 64  LDNTDDKAVKYLEESMGRDHLSSVFAVPGAIDLLKQLDIDTDTGKKFKDKKWAIVTSGST 123

Query: 119 PMASKWFEHL--GIEKPEYFITANDVKQGKPFPEPYLKGRNGLGFPINEQDPSKSKVIVF 176
            +A  WF+ +   +EKPE F+TA DVK GKP PE Y K R+ L    N  D   +K +VF
Sbjct: 124 YIAFGWFKSILSELEKPEVFVTAFDVKNGKPDPEGYSKARDELCKTWN-FDVKTAKSVVF 182

Query: 177 EDXXXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKDHESIRV 222
           ED                   +T+D   L + G D +V+D   I +
Sbjct: 183 EDAPVGIQAGKAMGAITVGITSTYDKKVLFDAGADYVVRDLSQITI 228

>CAGL0M12925g 1274919..1275659 similar to sp|P38773 Saccharomyces
           cerevisiae YHR043c DOG2 2-deoxyglucose-6-phosphate
           phosphatase, hypothetical start
          Length = 246

 Score =  103 bits (258), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 71/225 (31%), Positives = 105/225 (46%), Gaps = 14/225 (6%)

Query: 9   FKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHESHGWRTYDAIAKFAPDF 68
           F V+  LFD+DGTI+ +  A+   W+    +    D E +   SHG RT +  AKF PD 
Sbjct: 5   FTVDLCLFDLDGTIVSTTRAVEMTWKKLCAEHD-VDPEELFRFSHGTRTGEVFAKFFPDI 63

Query: 69  --ADEDYATQLEAEIPEKYGEHSIEVPGAVKL-------CKDLNALPKEKWAVATSGTRP 119
                  A   E  I +     S+ +PGA +L         D +A+ + KWA+ TSG+  
Sbjct: 64  DNTGNRAAVAFELSIADDLSLISL-IPGAQELLLKLDKNTTDGSAVGERKWAIVTSGSPE 122

Query: 120 MASKWFEHL--GIEKPEYFITANDVKQGKPFPEPYLKGRNGLGFPINEQDPSKSKVIVFE 177
           +   WF+++   + +P  FI+  DV +GKP PE Y  GRN L   +   D S ++ +VFE
Sbjct: 123 LTLSWFDNVLKEVGRPPVFISGADVAKGKPDPEGYYTGRNLLCQKLG-LDASHARTVVFE 181

Query: 178 DXXXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKDHESIRV 222
           D                    T+D D L   G D +V D   ++V
Sbjct: 182 DAPVGIMAGKAIGAITVGIAGTYDKDLLYSAGADYVVSDLNQVKV 226

>YHR043C (DOG2) [2331] chr8 complement(192797..193537)
           2-Deoxyglucose-6-phosphate phosphatase, converts
           2-deoxy-D-glucose 6-phosphate to 2-deoxy-D-glucose and
           orthophosphate [741 bp, 246 aa]
          Length = 246

 Score =  102 bits (254), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 69/225 (30%), Positives = 103/225 (45%), Gaps = 12/225 (5%)

Query: 9   FKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHESHGWRTYDAIAKFAP-- 66
           F V+  LFD+DGTI+ +  A  + W+   +     D   +   SHG R+ + + KF P  
Sbjct: 4   FSVDLCLFDLDGTIVSTTTAAESAWKKLCRQHG-VDPVELFKHSHGARSQEMMKKFFPKL 62

Query: 67  DFADEDYATQLEAEIPEKYGEHSIEVPGAVKLCKDLNA-------LPKEKWAVATSGTRP 119
           D  D      LE ++ + Y +    +PGA  L   L+        LP+ KWA+ TSG+  
Sbjct: 63  DNTDNKGVLALEKDMADNYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPY 122

Query: 120 MASKWFEHL--GIEKPEYFITANDVKQGKPFPEPYLKGRNGLGFPINEQDPSKSKVIVFE 177
           +A  WFE +   + KP+ FIT  DVK GKP PE Y + R+ L   +        K +VFE
Sbjct: 123 LAFSWFETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFE 182

Query: 178 DXXXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKDHESIRV 222
           D                   +++D   L + G D +V D   + V
Sbjct: 183 DAPVGIKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSV 227

>YHR044C (DOG1) [2332] chr8 complement(194060..194800)
           2-Deoxyglucose-6-phosphate phosphatase [741 bp, 246 aa]
          Length = 246

 Score = 99.4 bits (246), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 69/225 (30%), Positives = 99/225 (44%), Gaps = 12/225 (5%)

Query: 9   FKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHESHGWRTYDAIAKFAPDF 68
           F  +  LFD+DGTI+ +  A    W     +    D   +   SHG RT + + +F P  
Sbjct: 4   FSADLCLFDLDGTIVSTTVAAEKAWTKLCYEYG-VDPSELFKHSHGARTQEVLRRFFPKL 62

Query: 69  ADEDY--ATQLEAEIPEKYGEHSIEVPGAVKLCKDLNA-------LPKEKWAVATSGTRP 119
            D D      LE +I   Y +    +PGA  L   L+        LP+ KWA+ TSG+  
Sbjct: 63  DDTDNKGVLALEKDIAHSYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPY 122

Query: 120 MASKWFEHL--GIEKPEYFITANDVKQGKPFPEPYLKGRNGLGFPINEQDPSKSKVIVFE 177
           +A  WFE +   + KP+ FIT  DVK GKP PE Y + R+ L   +        K +VFE
Sbjct: 123 LAFSWFETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFE 182

Query: 178 DXXXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKDHESIRV 222
           D                   +++D   L + G D +V D   + V
Sbjct: 183 DAPVGIKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSV 227

>Scas_690.31
          Length = 244

 Score = 97.1 bits (240), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 71/224 (31%), Positives = 105/224 (46%), Gaps = 11/224 (4%)

Query: 8   SFKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHESHGWRTYDAIAKFAPD 67
           +F V+  LFD+DGTI+ +  A+   W  F K K   +AE +   SHG R+ + +A+F P 
Sbjct: 3   TFTVDLCLFDLDGTIVSTTIAVERAWIKFCK-KHNVNAEELFEHSHGARSGEIMARFFPH 61

Query: 68  FADEDYATQLEAEIPEKYGEHSIE--VPGAVKLCKDLNALP-----KEKWAVATSGTRPM 120
             + D     E E+   Y        +PG+ KL   L+        K KWA+ TSG+  +
Sbjct: 62  VDNTDNKATKELELSMAYDNIDTVSLIPGSEKLLLALDKATTKDATKRKWAIVTSGSPYL 121

Query: 121 ASKWFEHL--GIEKPEYFITANDVKQGKPFPEPYLKGRNGLGFPINEQDPSKSKVIVFED 178
           A  WF+ +   + KP+ FIT  DV++GKP PE Y K R+ L       D    + +VFED
Sbjct: 122 AFSWFDTILKDVGKPDVFITGFDVEKGKPDPEGYGKARDQLCKNWG-PDNKHVRTVVFED 180

Query: 179 XXXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKDHESIRV 222
                               T+D + L + G D +V D   + V
Sbjct: 181 APVGIKAGKAIGAITVGITFTYDKNLLFDAGADYVVADLTHVSV 224

>KLLA0C11143g 956474..957280 similar to sp|P38773 Saccharomyces
           cerevisiae YHR043c DOG2 2-deoxyglucose-6-phosphate
           phosphatase, start by similarity
          Length = 268

 Score = 94.0 bits (232), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 73/226 (32%), Positives = 104/226 (46%), Gaps = 15/226 (6%)

Query: 8   SFKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHESHGWRTYDAIAKFAP- 66
           S  V+  LFD+DGT++ S  A    W     DK   D   +   SHG RT + +AKF P 
Sbjct: 3   SIAVDYVLFDLDGTLVSSTDAAEEAWNKLC-DKYGVDYSTLSKVSHGSRTAEILAKFFPN 61

Query: 67  -DFADEDYATQLEAEIPEKYGEHSIEVPGAVKLCKDLN----ALPKE-----KWAVATSG 116
            D  +     + E  I   Y +    +PG++ L   L+    A P E     KWAV TSG
Sbjct: 62  VDNTNNQAVKEFELSIANDYMDIVCLIPGSIDLLISLDRPTGAHPGEVFHHRKWAVVTSG 121

Query: 117 TRPMASKWFEHL--GIEKPEYFITANDVKQGKPFPEPYLKGRNGLGFPINEQDPSKSKVI 174
           +  +A  WF++L   I+KPE FITA DV +GKP P  +      L   I + D  + + +
Sbjct: 122 SPWVAHAWFDNLLKSIKKPEVFITAFDVSKGKPDPAGFALATKRLK-EIWQDDRKEVRTV 180

Query: 175 VFEDXXXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKDHESI 220
           VFED                   +T+D + L   G D +V+D   +
Sbjct: 181 VFEDAPVGVQAGKANGSIVVALTSTYDKELLFAAGADYVVEDLSQV 226

>AAL123W [64] [Homologous to ScYHR043C (DOG2) - SH; ScYHR044C (DOG1)
           - SH] complement(131449..132318) [870 bp, 289 aa]
          Length = 289

 Score = 92.8 bits (229), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 73/238 (30%), Positives = 106/238 (44%), Gaps = 18/238 (7%)

Query: 9   FKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHESHGWRTYDAIAKFAPDF 68
             V+  LFD+DGTI+ +  A+ A W+  G+     DA  +   SHG R  +   ++ PD 
Sbjct: 4   ITVDVCLFDLDGTIVDTTDAVEAAWQKVGR-AHQVDAAKIRRNSHGRRASETFKQYFPD- 61

Query: 69  ADEDYATQLEAEIPEKYGEHSIE-VPGAVKL---------CKDLNALPKEKWAVATSGTR 118
           AD D A + E E       H +  +PGA  L         C         +WA+ TS T 
Sbjct: 62  ADNDAAVK-EFEHALVSQSHYVGLIPGANDLLLTLDRPSGCNPGEVFRDNRWAIVTSATP 120

Query: 119 PMASKWFEHL--GIEKPEYFITANDVKQGKPFPEPYLKGRNGLGFPINEQDPSKSKVIVF 176
            +A  WF  L   ++ P+ FIT+ DV +GKP PE Y K ++ L   I   +  K + +VF
Sbjct: 121 SLARSWFNTLLKKVKPPKVFITSADVAKGKPDPEGYQKAKDQLA-DILGLNKDKVRAVVF 179

Query: 177 EDXXXXXXXXXXXXXXXXXXXTTFDLDFLKEKGCDIIVKDHESIRV--GGYDAETDEV 232
           ED                   +T+  D L   G D +V+D   + V   G D  T E+
Sbjct: 180 EDSALGIRAAKAMGAIAVGITSTYSKDVLYRSGADYVVEDLAQVCVMQNGPDGITLEI 237

>KLLA0F21802g 2029687..2031519 similar to sp|P38767 Saccharomyces
           cerevisiae YHR032w ERC1 ethionine resistance protein,
           start by similarity
          Length = 610

 Score = 35.4 bits (80), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 49/127 (38%), Gaps = 26/127 (20%)

Query: 34  RDFGKDKPYFDAEHVIHESHGWRTYDAIAKFAPDFADEDYATQLEAEIPEKYGEHSIEVP 93
           RD   D   +++ H +H    + T D  + FAP  + ED       E+ E + +      
Sbjct: 95  RDLLMDNKLYNSNHALHNHAAYSTNDPNSSFAPTSSIED------QEVIETWED------ 142

Query: 94  GAVKLCKDLNALPKEKWAVATSGTRPMASKWFEHLGIEKPEYFITANDVKQGKPFPEPYL 153
            A++  KD+N   K +  V TS   P+               FI  N +     F   +L
Sbjct: 143 -AIESGKDINTTFKREAIVITSNASPLVLT------------FILQNSLSLASIFSVSHL 189

Query: 154 KGRNGLG 160
            G N LG
Sbjct: 190 -GSNELG 195

>CAGL0L01969g 228760..229473 similar to tr|Q86ZR7 Saccharomyces
           cerevisiae YKL033wa, hypothetical start
          Length = 237

 Score = 33.5 bits (75), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 76/182 (41%), Gaps = 18/182 (9%)

Query: 10  KVNAALFDVDGTII----ISQPAIAAFWRDFGKDKPYFDAEHVIHESHGWRTYDAIAKFA 65
           +V A LFD+DG +I    I    +    +++G     +D   V  +  G    +A  K  
Sbjct: 7   RVKACLFDMDGLLINTEDIYTLTLNRILKEYGLGPLTWD---VKIQLQGLPGPEAGKKII 63

Query: 66  PDFADEDYATQLEA---EIPEKYGEHSIEVPGAVKLCKDLNALPKEKWAVATSGTRPMAS 122
             +       +LE    EI   Y   +  +PGA++L K L +      A+ TS  +    
Sbjct: 64  ETYKLPLTPKELETKNIEIQNDYWPTAAFLPGALELLKYLKS-KNIPIALCTSSNKIKFK 122

Query: 123 KWFEHL--GIEKPEYFITANDVK----QGKPFPEPYLKGRNGLGFPINEQDPSKSKVIVF 176
               HL  G    +  +T +D +    +GKPFP+ +  G   L    N    S S+ +VF
Sbjct: 123 GKTSHLGEGFNLFDAIVTGDDERIPSGRGKPFPDVWQVGLKSLNDKFN-TSISPSECLVF 181

Query: 177 ED 178
           ED
Sbjct: 182 ED 183

>Kwal_26.8080
          Length = 223

 Score = 29.6 bits (65), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 45/93 (48%), Gaps = 8/93 (8%)

Query: 92  VPGAVKLCKDLNALPKEKWAVATSGTRPMASKWFEHL--GIEKPEYFITANDVK----QG 145
           +PGA+ L + L++  K   A+ TS  +        HL  G E  +  IT +D +    +G
Sbjct: 79  LPGALDLIRYLHS-KKVPIALCTSSGKQKYIGKTSHLQHGFELFDVIITGDDPRIPPGRG 137

Query: 146 KPFPEPYLKGRNGLGFPINEQDPSKSKVIVFED 178
           KP+P+ +  G  GL    N  D    + ++FED
Sbjct: 138 KPYPDIWQLGLKGLNEKFN-TDIKPEECLIFED 169

>KLLA0F05049g 494045..496126 similar to sp|P48445 Saccharomyces
           cerevisiae YDL141w BPL1 biotin holocarboxylase
           synthetase singleton, start by similarity
          Length = 693

 Score = 29.3 bits (64), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 8/55 (14%)

Query: 119 PMASKWFEHLGIEKPEYFITANDVKQGKPFPEPYLKGRNGLGFPINEQDPSKSKV 173
           P+  KW   L   KP+Y+   N    GK FP       NGL  P+++ DP+  KV
Sbjct: 489 PVKIKWPNDLYAMKPQYYYNNNMKLLGKEFP-------NGL-IPLDDVDPAFVKV 535

>CAGL0A01386g 136693..140001 some similarities with sp|P08640
           Saccharomyces cerevisiae YIR019c STA1, hypothetical
           start
          Length = 1102

 Score = 28.9 bits (63), Expect = 5.0,   Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 217 HESIRVGGYDAETDEVEFIFDDFLYAKDD 245
           H    VG Y   T+E+ + FD +LY  DD
Sbjct: 260 HSKFMVGFYPPNTEEITYDFDGYLYMLDD 288

>Scas_714.22
          Length = 221

 Score = 27.3 bits (59), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 64/151 (42%), Gaps = 27/151 (17%)

Query: 11  VNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHESHGW--RTYDAIAKFAPDF 68
           + A +FD+DGT+ + QP     W         F A   + E+ G   ++ D +A +  D 
Sbjct: 18  IKAVVFDMDGTLCLPQP-----W--------MFPA---MREAIGLHDKSVDILA-YIDDM 60

Query: 69  ADEDYATQLEA-----EIPEKYGEHSIEVPGAVKLCKDLNALPKEKWAVATSGTRPMASK 123
           + E+   +LEA     E+ ++  +     PG V+L + L      K     +  +P+   
Sbjct: 61  STEE--AKLEANRQLEEVEDRAMKQMEPQPGLVELLRFLTLNNMSKNICTRNVIKPVQYL 118

Query: 124 WFEHLGIEKPEY-FITANDVKQGKPFPEPYL 153
               +  E   + +I   D +  KP P+P L
Sbjct: 119 ISNFVPKEYSNFEYIVTRDFRPAKPNPDPLL 149

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.138    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,447,387
Number of extensions: 358139
Number of successful extensions: 747
Number of sequences better than 10.0: 30
Number of HSP's gapped: 707
Number of HSP's successfully gapped: 30
Length of query: 246
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 147
Effective length of database: 13,168,927
Effective search space: 1935832269
Effective search space used: 1935832269
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)