Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.582842441921030.0
Scas_715.4844844711461e-155
YER061C (CEM1)44243911121e-150
ADL072C43343511111e-150
CAGL0J02970g44845010101e-134
KLLA0C08239g4294298651e-113
Kwal_23.48621731152860.018
CAGL0E06138g188398740.51
YPL231W (FAS2)188798720.87
KLLA0C15983g189341691.9
AFL138W189198682.5
Kwal_56.24248877100638.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.5828
         (419 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.5828                                                          814   0.0  
Scas_715.48                                                           446   e-155
YER061C (CEM1) [1492] chr5 complement(278296..279624) Beta-ketoa...   432   e-150
ADL072C [1669] [Homologous to ScYER061C (CEM1) - SH] (554605..55...   432   e-150
CAGL0J02970g complement(284370..285716) similar to sp|P39525 Sac...   393   e-134
KLLA0C08239g 723077..724366 similar to sp|P39525 Saccharomyces c...   337   e-113
Kwal_23.4862                                                           38   0.018
CAGL0E06138g complement(611598..617249) highly similar to sp|P19...    33   0.51 
YPL231W (FAS2) [5218] chr16 (108652..114315) Fatty-acyl-CoA synt...    32   0.87 
KLLA0C15983g 1389936..1395617 highly similar to sp|P19097 Saccha...    31   1.9  
AFL138W [3057] [Homologous to ScYPL231W (FAS2) - SH] complement(...    31   2.5  
Kwal_56.24248                                                          29   8.8  

>Kwal_23.5828
          Length = 424

 Score =  814 bits (2103), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/419 (95%), Positives = 399/419 (95%)

Query: 1   MTSRVVVTGLGAITPLGRTVSESWRALLAGKSGIRPIRDLPNAKSYEGHCPASVAVADIP 60
           MTSRVVVTGLGAITPLGRTVSESWRALLAGKSGIRPIRDLPNAKSYEGHCPASVAVADIP
Sbjct: 1   MTSRVVVTGLGAITPLGRTVSESWRALLAGKSGIRPIRDLPNAKSYEGHCPASVAVADIP 60

Query: 61  DFDPQAYGDLFTSQDLRRMSQFTQFAMVAAQEALQDADILQMLAESKNDRVGCVXXXXXX 120
           DFDPQAYGDLFTSQDLRRMSQFTQFAMVAAQEALQDADILQMLAESKNDRVGCV      
Sbjct: 61  DFDPQAYGDLFTSQDLRRMSQFTQFAMVAAQEALQDADILQMLAESKNDRVGCVIGSGIG 120

Query: 121 XXQDMYDTIVDFERGKRVAPTFVPKILANMACGNISIKFQLRGVSHCVSTACATGNNAIG 180
             QDMYDTIVDFERGKRVAPTFVPKILANMACGNISIKFQLRGVSHCVSTACATGNNAIG
Sbjct: 121 SIQDMYDTIVDFERGKRVAPTFVPKILANMACGNISIKFQLRGVSHCVSTACATGNNAIG 180

Query: 181 DAYNFIRLGYNDVCLAGASEASVHPLSLAGFLRAKSITTSGVSRPFDKERDGFVLGEGAG 240
           DAYNFIRLGYNDVCLAGASEASVHPLSLAGFLRAKSITTSGVSRPFDKERDGFVLGEGAG
Sbjct: 181 DAYNFIRLGYNDVCLAGASEASVHPLSLAGFLRAKSITTSGVSRPFDKERDGFVLGEGAG 240

Query: 241 LVVLESLEHAQRRGARIYAEIEGYGLTSDAHHITAPSENGEGARRAMEMALKNHDPRKVD 300
           LVVLESLEHAQRRGARIYAEIEGYGLTSDAHHITAPSENGEGARRAMEMALKNHDPRKVD
Sbjct: 241 LVVLESLEHAQRRGARIYAEIEGYGLTSDAHHITAPSENGEGARRAMEMALKNHDPRKVD 300

Query: 301 YINAHATSTVLGDRAESQAISSLFSTPNPSTLKVSSNKXXXXXXXXXXXXVESIFTIKSL 360
           YINAHATSTVLGDRAESQAISSLFSTPNPSTLKVSSNK            VESIFTIKSL
Sbjct: 301 YINAHATSTVLGDRAESQAISSLFSTPNPSTLKVSSNKGAIGHLLGAAGAVESIFTIKSL 360

Query: 361 QEGIIPHTLNLSNIGGAKGDEADTFNSLDLVRDKPAVHDIQLALNNSFGFGGINSSLLF 419
           QEGIIPHTLNLSNIGGAKGDEADTFNSLDLVRDKPAVHDIQLALNNSFGFGGINSSLLF
Sbjct: 361 QEGIIPHTLNLSNIGGAKGDEADTFNSLDLVRDKPAVHDIQLALNNSFGFGGINSSLLF 419

>Scas_715.48
          Length = 448

 Score =  446 bits (1146), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 241/447 (53%), Positives = 301/447 (67%), Gaps = 33/447 (7%)

Query: 1   MTSRVVVTGLGAITPLGRTVSESWRALLAGKSGIRPIRDLPNAKS----YEGHCPASVAV 56
           M+ RVVVTGLG  TPLG T+ ESW+ LL  KSGI PI  L N +S    +  H P +++V
Sbjct: 1   MSRRVVVTGLGCATPLGNTLRESWKNLLKSKSGIVPITSLENYESDYEPFAKHIPRTISV 60

Query: 57  ADIP---DFDPQAYGDLFTSQDLRRMSQFTQFAMVAAQEALQDADILQMLAESKN----- 108
             IP   + D Q    LFTSQ+ RR S+F + A+ +  EAL+ A++L   +   N     
Sbjct: 61  GRIPTPTESDQQELDQLFTSQEERRYSKFIKLAIQSTYEALKSANLLTHKSSPSNPEIDI 120

Query: 109 -----DRVGCVXXXXXXXXQDMYDTIVDFERGKRVAPTFVPKILANMACGNISIKFQLRG 163
                ++ GCV         D+Y T + F+ GK+++P FVPKIL NMA GN+SIKF LRG
Sbjct: 121 THCNMEKFGCVIGSGIGSISDIYSTTLQFQNGKKISPYFVPKILTNMAAGNVSIKFNLRG 180

Query: 164 VSHCVSTACATGNNAIGDAYNFIRLGYNDVCLAGASEASVHPLSLAGFLRAKSITTSGVS 223
           +SH VSTACATGNN+IGDAYNFIRLG  D+C+AGASEAS+HPLSLAGFLRAKSITT G+S
Sbjct: 181 LSHSVSTACATGNNSIGDAYNFIRLGMQDICVAGASEASIHPLSLAGFLRAKSITTDGIS 240

Query: 224 RPFDKERDGFVLGEGAGLVVLESLEHAQRRGARIYAEIEGYGLTSDAHHITAPSENGEGA 283
           RPFD ER GFVLGEGAG+VVLESLEHA++R A+I+ EI+GYGL+SDA+HIT+P  +G GA
Sbjct: 241 RPFDLERSGFVLGEGAGMVVLESLEHAKKRNAKIFCEIKGYGLSSDAYHITSPPSDGNGA 300

Query: 284 RRAMEMALKNHDPRK--VDYINAHATSTVLGDRAESQAISS------LFSTPNPST--LK 333
           RRAM+MA+ +    +  +DY+NAHATST +GD  E +AI S      +F   N  T  L 
Sbjct: 301 RRAMDMAINSSSISRDEIDYVNAHATSTPVGDITEVKAIYSSFINENIFDKSNTRTKPLY 360

Query: 334 VSSNKXXXXXXXXXXXXVESIFTIKSLQEGIIPHTLNLSNIGGAKGDEADTFNSLDLVRD 393
           VSSNK            VESIFTI SL+E IIPHTLNL     A   E  +   L+LV D
Sbjct: 361 VSSNKGSIGHLLGAAGAVESIFTIMSLREKIIPHTLNL-----AHPIEEVSSELLELVMD 415

Query: 394 KPAV-HDIQLALNNSFGFGGINSSLLF 419
           +PA    +  AL NSFGFGG+N++LLF
Sbjct: 416 EPASPKQVNSALCNSFGFGGVNTALLF 442

>YER061C (CEM1) [1492] chr5 complement(278296..279624)
           Beta-ketoacyl-ACP synthase, mitochondrial
           (3-oxoacyl-[Acyl-carrier-protein] synthase) [1329 bp,
           442 aa]
          Length = 442

 Score =  432 bits (1112), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 235/439 (53%), Positives = 297/439 (67%), Gaps = 23/439 (5%)

Query: 1   MTSRVVVTGLGAITPLGRTVSESWRALLAGKSGIRPIRDLPNA----KSYEGHCPASVAV 56
           M+ RVV+TGLG +TPLGR++SESW  LL+ K+G+ PI  LPN     K  E   P+++ V
Sbjct: 1   MSRRVVITGLGCVTPLGRSLSESWGNLLSSKNGLTPITSLPNYNEDYKLREKSIPSTITV 60

Query: 57  ADIPD-FDPQAYGD---LFTSQDLRRMSQFTQFAMVAAQEALQDADILQMLAESKN---- 108
             IP+ F  +       LFTSQD RR S F + A+    EAL +A +L     + N    
Sbjct: 61  GKIPENFQNENSAINKLLFTSQDERRTSSFIKLALRTTYEALHNAGLLNPNDITINTSLC 120

Query: 109 --DRVGCVXXXXXXXXQDMYDTIVDFER-GKRVAPTFVPKILANMACGNISIKFQLRGVS 165
             D  GC+        QD+Y T + F    KR+ P FVPKIL NMA GN+SIKF LRG+S
Sbjct: 121 NLDHFGCLIGSGIGSIQDIYQTSLQFHNDNKRINPYFVPKILTNMAAGNVSIKFNLRGLS 180

Query: 166 HCVSTACATGNNAIGDAYNFIRLGYNDVCLAGASEASVHPLSLAGFLRAKSITTSGVSRP 225
           H VSTACATGNN+IGDA+NFIRLG  D+C+AGASE S+HPLSLAGF+RAKSITT+G+SRP
Sbjct: 181 HSVSTACATGNNSIGDAFNFIRLGMQDICVAGASETSLHPLSLAGFIRAKSITTNGISRP 240

Query: 226 FDKERDGFVLGEGAGLVVLESLEHAQRRGARIYAEIEGYGLTSDAHHITAPSENGEGARR 285
           FD +R GFVLGEG G++V+ESLEHAQ+R A I +E+ GYGL+SDA HIT+P  +G GA+R
Sbjct: 241 FDTQRSGFVLGEGCGMIVMESLEHAQKRNANIISELVGYGLSSDACHITSPPADGNGAKR 300

Query: 286 AMEMALK--NHDPRKVDYINAHATSTVLGDRAESQAISS--LFSTPNPSTLKVSSNKXXX 341
           A+EMALK    +P  VDY+NAHATST+LGD+AE  A++S  L        L +SSNK   
Sbjct: 301 AIEMALKMARLEPTDVDYVNAHATSTLLGDKAECLAVASALLPGRSKSKPLYISSNKGAI 360

Query: 342 XXXXXXXXXVESIFTIKSLQEGIIPHTLNLSNIGGAKGDEADTFNSLDLVRDKPAV-HDI 400
                    VESIFTI SL++  +PHTLNL N+   + +EAD    L  +RDKP V  + 
Sbjct: 361 GHLLGARGAVESIFTICSLKDDKMPHTLNLDNVLTLENNEAD---KLHFIRDKPIVGANP 417

Query: 401 QLALNNSFGFGGINSSLLF 419
           + AL NSFGFGG+N+SLLF
Sbjct: 418 KYALCNSFGFGGVNTSLLF 436

>ADL072C [1669] [Homologous to ScYER061C (CEM1) - SH]
           (554605..555906) [1302 bp, 433 aa]
          Length = 433

 Score =  432 bits (1111), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 229/435 (52%), Positives = 296/435 (68%), Gaps = 21/435 (4%)

Query: 1   MTSRVVVTGLGAITPLGRTVSESWRALLAGKSGIRPIRDLPNAKSYEG-HCPASVAVADI 59
           M  RVVVTG+G  TPLG ++++SW+ LL G SG+  ++DL     YEG + P S  ++  
Sbjct: 1   MHPRVVVTGIGCYTPLGPSLAQSWKELLRGTSGLVRLQDL---AEYEGDYKPLSRLISG- 56

Query: 60  PDFDPQAYG------DLFTSQDLRRMSQFTQFAMVAAQEALQDADIL---QMLAESKNDR 110
            D      G      +L +SQ+ RR S+  Q AMV A+EAL+ A +L    ++A    +R
Sbjct: 57  -DLRVGKVGFEARDQELLSSQEQRRTSRAAQLAMVTAEEALRHAGLLSGSHLVASVDRNR 115

Query: 111 VGCVXXXXXXXXQDMYDTIVDFERGKR--VAPTFVPKILANMACGNISIKFQLRGVSHCV 168
            GC+        +D+          +R  V+P F+PK+L NMA GN++IKFQLRG S+C 
Sbjct: 116 AGCIIGAGLPSMEDISQATASLSSARRPSVSPFFIPKMLNNMAAGNVAIKFQLRGASNCP 175

Query: 169 STACATGNNAIGDAYNFIRLGYNDVCLAGASEASVHPLSLAGFLRAKSITTSGVSRPFDK 228
           STACA+GNNAIGDAYNFIRLGY+DV +AGASE SVHPL+LAGF++AKSI+ SG+SRPFD 
Sbjct: 176 STACASGNNAIGDAYNFIRLGYSDVIVAGASELSVHPLALAGFVKAKSISASGISRPFDA 235

Query: 229 ERDGFVLGEGAGLVVLESLEHAQRRGARIYAEIEGYGLTSDAHHITAPSENGEGARRAME 288
            RDGFVLGEG GL+VLESLEHA+ RGA I AE+ GYG+ SDAHHIT+PSE G+GARRAM 
Sbjct: 236 RRDGFVLGEGCGLLVLESLEHARHRGAEIIAEVVGYGVCSDAHHITSPSEGGDGARRAMH 295

Query: 289 MALKN---HDPR-KVDYINAHATSTVLGDRAESQAISSLFSTPNPSTLKVSSNKXXXXXX 344
           MAL++    D R +V Y+NAHATST LGDRAE++AI ++F      +  VSSNK      
Sbjct: 296 MALQDAGIWDTRDQVGYVNAHATSTPLGDRAEARAIQAVFGATGTGSTLVSSNKGHMGHL 355

Query: 345 XXXXXXVESIFTIKSLQEGIIPHTLNLSNIGGAKGDEADTFNSLDLVRDKPAVHDIQLAL 404
                 VE++FT++SL+EGI+PHTLNL  +G    D+ D F  +  V+D P    +  A+
Sbjct: 356 LGAAGAVEAVFTVQSLREGIVPHTLNLQTVGEGLADKKDGFGGITFVQDNPVPAPLTYAM 415

Query: 405 NNSFGFGGINSSLLF 419
           NNSFGFGGINSSLLF
Sbjct: 416 NNSFGFGGINSSLLF 430

>CAGL0J02970g complement(284370..285716) similar to sp|P39525
           Saccharomyces cerevisiae YER061c CEM1, start by
           similarity
          Length = 448

 Score =  393 bits (1010), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 227/450 (50%), Positives = 287/450 (63%), Gaps = 38/450 (8%)

Query: 1   MTSRVVVTGLGAITPLGRTVSESWRALLAGKS-GIRPIRDLPNAK--SYEGHCPASV--- 54
           M+ RVVVTGLG +TPLG++V ESW  LL   S G+  +  L       + G  P  +   
Sbjct: 1   MSRRVVVTGLGCVTPLGKSVKESWHRLLQRDSNGLVKLDQLTKGDFAKWRGIFPPELRVG 60

Query: 55  AVADIPDFDPQAYGDLFTSQDLRRMSQFTQFAMVAAQEALQDADILQMLAESKND----- 109
           AV+ I  F+  +   LFTSQD RRMS+F + A +A+ EAL  + ++    +   D     
Sbjct: 61  AVSPIESFEVNS--QLFTSQDDRRMSRFIKLATIASYEALVSSGLVNKETKMSEDGRIPI 118

Query: 110 ----------RVGCVXXXXXXXXQDMYDTIVDFE---RGKRVAPTFVPKILANMACGNIS 156
                     +VGC+        +D+Y+T V F+   +  R+ P FVP+IL NMA GNI+
Sbjct: 119 DQHNQGIDPDKVGCLIGSGIGSIEDIYETSVTFDSNTKKNRINPYFVPRILTNMAAGNIA 178

Query: 157 IKFQLRGVSHCVSTACATGNNAIGDAYNFIRLGYNDVCLAGASEASVHPLSLAGFLRAKS 216
           IKF LRG +H VSTACATGNNAIGD YN I+LG  D+CLAGASEASVHPLSLAGFLRAKS
Sbjct: 179 IKFNLRGPTHSVSTACATGNNAIGDGYNMIKLGMQDICLAGASEASVHPLSLAGFLRAKS 238

Query: 217 ITTSGVSRPFDKERDGFVLGEGAGLVVLESLEHAQRRGARIYAEIEGYGLTSDAHHITAP 276
           ++  G+SRPFD+ER+GFVLGEGAG+VVLESLE A+RRGA I AEI GYGL+ DAHHIT+P
Sbjct: 239 LSPDGISRPFDEERNGFVLGEGAGIVVLESLESAERRGAPILAEIVGYGLSCDAHHITSP 298

Query: 277 SENGEGARRAMEMALK----NHDPRKVDYINAHATSTVLGDRAESQAI-SSLFSTPN-PS 330
             +GEGA RA++MAL     N + R ++Y+NAHATST LGD  E  AI ++L    N   
Sbjct: 299 PNDGEGASRAIKMALDLSHGNVNARDIEYVNAHATSTKLGDNTECCAIQNTLIDNVNRQK 358

Query: 331 TLKVSSNKXXXXXXXXXXXXVESIFTIKSLQEGIIPHTLNLSNIGGAKGDEADTFNSLDL 390
            L +SSNK             ESIFTI SL    IPHT NL N+ G         +S+  
Sbjct: 359 PLYISSNKGSIGHLLGAAGAAESIFTILSLYNRTIPHTYNLKNVLGNFES-----SSMRF 413

Query: 391 VRDKP-AVHDIQLALNNSFGFGGINSSLLF 419
           V+ +P  V D++ AL NSFGFGG+N+SLLF
Sbjct: 414 VKSQPHKVADLEYALCNSFGFGGVNTSLLF 443

>KLLA0C08239g 723077..724366 similar to sp|P39525 Saccharomyces
           cerevisiae YER061c CEM1 beta-keto-acyl-ACP synthase,
           mitochondrial singleton, start by similarity
          Length = 429

 Score =  337 bits (865), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/429 (44%), Positives = 263/429 (61%), Gaps = 22/429 (5%)

Query: 4   RVVVTGLGAITPLGRTVSESWRALLAGKSGIRPIRDLPNAKSY---EGHCPASVAVADIP 60
           RVVVTGLGA TPLG TVS+SW  LLA K  + P+    N + +   +   P   AV+ + 
Sbjct: 5   RVVVTGLGAYTPLGSTVSKSWAGLLAAKQSLIPLDAFYNREDFAKVKKLVPLDTAVSRL- 63

Query: 61  DFDPQAYGDLFTSQDLRRMSQFTQFAMVAAQEALQDADI-----LQMLAESKND-RVGCV 114
             DP    D F   D RRM+   Q  +   +EAL  A++     L  L E  +  +VGCV
Sbjct: 64  HADPL---DTFPEYDQRRMTPAHQIVLEKTKEALLQANLIADENLNTLTEDIDKTKVGCV 120

Query: 115 XXXXXXXXQDMYDTIVDFERGKRVAPTFVPKILANMACGNISIKFQLRGVSHCVSTACAT 174
                    D+  TI       +V+P  +P++L NMA GN+ IK+ ++G S C STACAT
Sbjct: 121 IGTGMPSMPDLESTISTLFTKPKVSPFLIPRVLPNMAMGNVMIKYGIQGPSSCPSTACAT 180

Query: 175 GNNAIGDAYNFIRLGYNDVCLAGASEASVHPLSLAGFLRAKSITTSGVSRPFDKERDGFV 234
           GN++I + +N I+LG  DV + G+ E S+ P+S+AGF R+K+I+    +RPFD ERDGF+
Sbjct: 181 GNSSIIEGFNSIQLGLADVMICGSYEFSIDPISIAGFYRSKTISKKHQTRPFDVERDGFI 240

Query: 235 LGEGAGLVVLESLEHAQRRGARIYAEIEGYGLTSDAHHITAPSENGEGARRAMEMALK-- 292
           +GEG G++ LESLE A +RG+ I AEI G GL++D +HIT+P  +G G + AM+ ALK  
Sbjct: 241 MGEGCGILTLESLESALKRGSPILAEISGVGLSNDGYHITSPLPDGSGGKLAMQNALKRA 300

Query: 293 NHDPRKVDYINAHATSTVLGDRAESQAISSLFSTPNPSTLK-VSSNKXXXXXXXXXXXXV 351
           N  P++V YINAHATST LGD AES AI+ LF T +  T   VSSNK            V
Sbjct: 301 NIAPQQVGYINAHATSTQLGDVAESTAITELFGTKSTGTAPYVSSNKGHIGHLLGASGSV 360

Query: 352 ESIFTIKSLQEGIIPHTLNLSNIGGAKGDEADTFNSLDLVRDKPAV-HDIQLALNNSFGF 410
           ESIFT+ SL+ G  PHTLNL  +     DE    N L+L++++  + + I+ AL NSFGF
Sbjct: 361 ESIFTVLSLKYGRFPHTLNLKTV-----DETSIINELNLIKNESMIDNSIEYALTNSFGF 415

Query: 411 GGINSSLLF 419
           GG+N+S+LF
Sbjct: 416 GGVNTSILF 424

>Kwal_23.4862
          Length = 1731

 Score = 37.7 bits (86), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 61/152 (40%), Gaps = 30/152 (19%)

Query: 171  ACATGNNAIGDAYNFIRLGYNDVCLAGA-SEASVHPLSLAGFLRAKSITTSGVS------ 223
            ACAT   ++  A   I  G   +C+AG   +   H     G + A S     V       
Sbjct: 1321 ACATAVESLDYAVETILSGKAKICIAGGYDDFEEHVAYEFGNMGATSNHQKEVECGRDPR 1380

Query: 224  ---RPFDKERDGFVLGEGAGLVVLESLEHAQRRGARIYAEI----------------EGY 264
               RP    R+GF+  +GAG+ VL S + A R G  IY  +                 G 
Sbjct: 1381 EMCRPATTSRNGFMESQGAGIQVLMSAQLAIRMGVPIYGIVGMTSTASDKIGKSLPAPGK 1440

Query: 265  GLTSDAHHIT----APSENGEGARRAMEMALK 292
            G+ + A  I+    +PS N E  +R ++  LK
Sbjct: 1441 GIMTCARQISGRIESPSLNVEYRKRQLQNRLK 1472

>CAGL0E06138g complement(611598..617249) highly similar to sp|P19097
            Saccharomyces cerevisiae YPL231w FAS2, start by
            similarity
          Length = 1883

 Score = 33.1 bits (74), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 44/98 (44%), Gaps = 10/98 (10%)

Query: 171  ACATGNNAIGDAYNFIRLGYNDVCLAGASEASVHPLSLA-GFLRAKS---------ITTS 220
            ACAT   ++      I  G   +C+ G  +      S   G ++A S          T +
Sbjct: 1303 ACATSVESVDIGVETILSGKAKICIVGGYDDFQEEGSYEFGNMKATSNTLEEFEHGRTPA 1362

Query: 221  GVSRPFDKERDGFVLGEGAGLVVLESLEHAQRRGARIY 258
             +SRP    R+GF+  +GAG+ V+ + + A + G  IY
Sbjct: 1363 EMSRPATTSRNGFMEAQGAGIQVIMNADLALKMGVPIY 1400

>YPL231W (FAS2) [5218] chr16 (108652..114315) Fatty-acyl-CoA synthase,
            alpha chain, contains acyl carrier protein, beta-ketoacyl
            reductase, and beta-ketoacyl synthase in a single
            polypeptide chain [5664 bp, 1887 aa]
          Length = 1887

 Score = 32.3 bits (72), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 43/98 (43%), Gaps = 10/98 (10%)

Query: 171  ACATGNNAIGDAYNFIRLGYNDVCLAGASEASVHPLSLA-GFLRAKS---------ITTS 220
            ACAT   ++      I  G   +C+ G  +      S   G ++A S          T +
Sbjct: 1304 ACATSVESVDIGVETILSGKARICIVGGYDDFQEEGSFEFGNMKATSNTLEEFEHGRTPA 1363

Query: 221  GVSRPFDKERDGFVLGEGAGLVVLESLEHAQRRGARIY 258
             +SRP    R+GF+  +GAG+ ++   + A + G  IY
Sbjct: 1364 EMSRPATTTRNGFMEAQGAGIQIIMQADLALKMGVPIY 1401

>KLLA0C15983g 1389936..1395617 highly similar to sp|P19097
            Saccharomyces cerevisiae YPL231w FAS2 fatty-acyl-CoA
            synthase, alpha chain singleton, start by similarity
          Length = 1893

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 25/41 (60%)

Query: 218  TTSGVSRPFDKERDGFVLGEGAGLVVLESLEHAQRRGARIY 258
            T + +SRP    R+GF+  +GAG+ V+ + + A + G  IY
Sbjct: 1361 TPAEMSRPTTTTRNGFMEAQGAGIQVIMTADLALKMGVPIY 1401

>AFL138W [3057] [Homologous to ScYPL231W (FAS2) - SH]
            complement(171276..176951) [5676 bp, 1891 aa]
          Length = 1891

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 42/98 (42%), Gaps = 10/98 (10%)

Query: 171  ACATGNNAIGDAYNFIRLGYNDVCLAGASEASVHPLSLA-GFLRAKS---------ITTS 220
            ACAT   ++      I  G   +C+ G  +      S   G + A S          T +
Sbjct: 1307 ACATAVESMDIGVETILSGKAKICIVGGYDDFQEEGSFEFGSMNATSNSLEEFEHGRTPA 1366

Query: 221  GVSRPFDKERDGFVLGEGAGLVVLESLEHAQRRGARIY 258
             +SRP    R GF+  +GAG+ ++ + + A + G  IY
Sbjct: 1367 EMSRPTTTTRSGFMEAQGAGIQIIMNADLALKMGVPIY 1404

>Kwal_56.24248
          Length = 877

 Score = 28.9 bits (63), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 42/100 (42%), Gaps = 14/100 (14%)

Query: 171 ACATGNNAIGDAYNFIRLGYNDVCLAGA----SEASVHPL--------SLAGFLRAKSIT 218
           ACAT   ++      I  G   +C+ G      E   +          SL  F   +  T
Sbjct: 293 ACATAVESLDVGVETILSGKAKICIVGGYDDFQEEGSYEFGNMGATSNSLDEFDHGR--T 350

Query: 219 TSGVSRPFDKERDGFVLGEGAGLVVLESLEHAQRRGARIY 258
            + +SRP    R+GF+  +G+G+ V+ + + A   G  IY
Sbjct: 351 PAEMSRPATTSRNGFMEAQGSGMQVIMNADLALNMGVPIY 390

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,943,059
Number of extensions: 460298
Number of successful extensions: 991
Number of sequences better than 10.0: 15
Number of HSP's gapped: 972
Number of HSP's successfully gapped: 15
Length of query: 419
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 315
Effective length of database: 12,995,837
Effective search space: 4093688655
Effective search space used: 4093688655
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)