Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.582524324011791e-166
Sklu_1893.32812604714e-58
KLLA0C08261g2332314527e-56
ADL073W2772454435e-54
CAGL0L00693g2492334103e-49
YIL049W (DFG10)2532413991e-47
Scas_704.372512493781e-44
AAR016W52648710.50
Scas_464.1118870700.65
YPR045C47043661.8
Kwal_23.3160110040634.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.5825
         (240 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.5825                                                          458   e-166
Sklu_1893.3 YIL049W, Contig c1893 3492-4337                           186   4e-58
KLLA0C08261g complement(724399..725100) similar to sp|P40526 Sac...   178   7e-56
ADL073W [1668] [Homologous to ScYIL049W (DFG10) - SH] complement...   175   5e-54
CAGL0L00693g 85333..86082 similar to sp|P40526 Saccharomyces cer...   162   3e-49
YIL049W (DFG10) [2618] chr9 (260157..260918) Protein involved in...   158   1e-47
Scas_704.37                                                           150   1e-44
AAR016W [202] [Homologous to ScYOL027C - SH] complement(368883.....    32   0.50 
Scas_464.1                                                             32   0.65 
YPR045C (YPR045C) [5477] chr16 complement(655135..656547) Member...    30   1.8  
Kwal_23.3160                                                           29   4.1  

>Kwal_23.5825
          Length = 243

 Score =  458 bits (1179), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 226/240 (94%), Positives = 226/240 (94%)

Query: 1   MPTLLDAAFYASFLVGIASVHLAKWQLPALLKYGKTLEGSRTQKGLLGFFEQLTVPKQWF 60
           MPTLLDAAFYASFLVGIASVHLAKWQLPALLKYGKTLEGSRTQKGLLGFFEQLTVPKQWF
Sbjct: 1   MPTLLDAAFYASFLVGIASVHLAKWQLPALLKYGKTLEGSRTQKGLLGFFEQLTVPKQWF 60

Query: 61  THFYVYSTTLAILNVYCQRNLVSLLFLIHSGRRLYETQCVTKYGENSRMHLSHYLVGLWF 120
           THFYVYSTTLAILNVYCQRNLVSLLFLIHSGRRLYETQCVTKYGENSRMHLSHYLVGLWF
Sbjct: 61  THFYVYSTTLAILNVYCQRNLVSLLFLIHSGRRLYETQCVTKYGENSRMHLSHYLVGLWF 120

Query: 121 YSVANWAVFESKSRSQXXXXXXXXXXXXXXSSVDQYMNHLHLSKLVKYTMPTYGLFSITT 180
           YSVANWAVFESKSRSQ              SSVDQYMNHLHLSKLVKYTMPTYGLFSITT
Sbjct: 121 YSVANWAVFESKSRSQLPLVRFLAVLVFALSSVDQYMNHLHLSKLVKYTMPTYGLFSITT 180

Query: 181 SPHYFDEVLLYLSLTAYTGSLKLFACLVWVIVNLSTSALETRAWYLKKFPQTTPPYAIIP 240
           SPHYFDEVLLYLSLTAYTGSLKLFACLVWVIVNLSTSALETRAWYLKKFPQTTPPYAIIP
Sbjct: 181 SPHYFDEVLLYLSLTAYTGSLKLFACLVWVIVNLSTSALETRAWYLKKFPQTTPPYAIIP 240

>Sklu_1893.3 YIL049W, Contig c1893 3492-4337
          Length = 281

 Score =  186 bits (471), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 112/260 (43%), Positives = 157/260 (60%), Gaps = 31/260 (11%)

Query: 11  ASFLVGIASVHLAKWQLPALLKYGKTL--------EGSRTQK-------GLLGFFEQLTV 55
           ASF+V I+ V LAKW+L   LKYGKTL        +G+  +K        +L FFE + V
Sbjct: 20  ASFVVAISCVLLAKWKLTGFLKYGKTLLSVDDKKHDGNEKEKREMTNVLQILDFFESIVV 79

Query: 56  PKQWFTHFYVYSTTLAILN-VYCQRNLVSLLFLIHSGRRLYETQCVTKYGENSRMHLSHY 114
           P+ WF+HFY+ ST  +++N ++   +L++ L L HS RRLYE+ C++K+G  S+M++SHY
Sbjct: 80  PRAWFSHFYIISTFFSLVNGIWYPGHLIAWLPLFHSLRRLYESYCISKFGAESKMNISHY 139

Query: 115 LVGLWFYSVAN--WAVFESK-----SRSQXXXXXXXXXXXXXXSSVDQYMNHLHLSKLVK 167
           LVG+WFY+  N  +++  SK     S S               SS +QY NH++LS+LVK
Sbjct: 140 LVGIWFYTSLNLIFSIGLSKDNKITSLSSNSAFQLIALFVFLASSYNQYQNHVYLSQLVK 199

Query: 168 YTMPTYGLFSITTSPHYFDEVLLYLSLTAYT-----GSLK--LFACLVWVIVNLSTSALE 220
           YT P  GLF   +  HYFDE+L+Y SL  Y      G L   L  CL+WV +NLS SA+E
Sbjct: 200 YTNPKKGLFKWVSCAHYFDEILIYSSLFGYARVSRYGYLADGLKYCLLWVGINLSVSAIE 259

Query: 221 TRAWYLKKFPQTTPPYAIIP 240
           TR +Y  ++ Q   P+AIIP
Sbjct: 260 TRNYYSHRY-QDVAPHAIIP 278

>KLLA0C08261g complement(724399..725100) similar to sp|P40526
           Saccharomyces cerevisiae YIL049w DFG10 singleton, start
           by similarity
          Length = 233

 Score =  178 bits (452), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 103/231 (44%), Positives = 139/231 (60%), Gaps = 12/231 (5%)

Query: 10  YASFLVGIASVHLAKWQLPALLKYGKTLEGSRTQKGLLGFFEQLTVPKQWFTHFYVYSTT 69
           Y++F VGI SV +A++ +P LLKYGKT E S        F+  LT PK  F HFY+ S+ 
Sbjct: 9   YSTFYVGIISVFVAEFYIPQLLKYGKTWEASNN------FWYSLTCPKSNFGHFYLLSSI 62

Query: 70  LAILNVYCQRNLVSLLFLIHSGRRLYETQCVTKYGENSRMHLSHYLVGLWFYSVANWAVF 129
            +I N+   R+L++L   IHS RRLYE  CVTK+G+ S++HLSHYLVG+WFY+  N  + 
Sbjct: 63  FSIYNLLWIRSLLTLSVFIHSVRRLYECYCVTKWGQ-SKIHLSHYLVGIWFYTTLNLGIM 121

Query: 130 ESKSRSQXXXXXXXXXXXXXXSSVDQYMNHLHLSKLVKYTMPTYGLFSITTSPHYFDEVL 189
                +Q              SS+DQ  NH +LSKL KY+ P+YGLF    S HYFDE+L
Sbjct: 122 LYHGETQ---YSLISVILFIMSSLDQATNHDYLSKLKKYSQPSYGLFKYICSAHYFDELL 178

Query: 190 LYLS--LTAYTGSLKLFACLVWVIVNLSTSALETRAWYLKKFPQTTPPYAI 238
           +Y S  L      + L  C++W++VNL TS+ ET  WY +KF   +  Y I
Sbjct: 179 IYTSFMLMDKGSRMLLIHCILWILVNLGTSSFETGNWYQEKFGYRSRWYLI 229

>ADL073W [1668] [Homologous to ScYIL049W (DFG10) - SH]
           complement(553708..554541) [834 bp, 277 aa]
          Length = 277

 Score =  175 bits (443), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 102/245 (41%), Positives = 145/245 (59%), Gaps = 21/245 (8%)

Query: 12  SFLVGIASVHLAKWQLPALLKYGKTLEGSRTQKGLLGFFE----QLTVPKQWFTHFYVYS 67
           S+ +G+ S+ LAK++LP LL+YGKT      QK L+G  E     + VP+++F+HFYV S
Sbjct: 35  SYGIGLFSLWLAKYRLPKLLQYGKT-----RQKKLVGVIEPWYTSIAVPRRYFSHFYVLS 89

Query: 68  TTLAILNVY-CQRNLVSLLFLIHSGRRLYETQCVTKYGENSRMHLSHYLVGLWFYSVANW 126
             LA  N+Y    ++++     HS RRL E+  VTK+G  SRMH +HYLVGLWFYSV N 
Sbjct: 90  FVLATANLYWFPEDVITSCIFFHSLRRLVESARVTKWGSESRMHAAHYLVGLWFYSVLNL 149

Query: 127 AVF---ESKSRSQXXXXXXXXXXXXXX-----SSVDQYMNHLHLSKLVKYTMPTYGLFSI 178
           +V+    S+ R++                   +S DQ  NH+HL+ ++KYT+P  GLF I
Sbjct: 150 SVYLQLNSRQRTRSPSTVNKVFGAVGAVGFLLASWDQARNHIHLAHMIKYTLPRRGLFKI 209

Query: 179 TTSPHYFDEVLLYLSLTAYTGSLK--LFACLVWVIVNLSTSALETRAWYLKKFP-QTTPP 235
               HYFDE+++Y SL A   + +  L   ++WV  NL  SA+ET+ +Y  KF  Q   P
Sbjct: 210 VACAHYFDEIVIYASLAAMEATTRWSLTVAVIWVCANLGVSAVETKRYYDAKFKGQAVAP 269

Query: 236 YAIIP 240
           YA+IP
Sbjct: 270 YALIP 274

>CAGL0L00693g 85333..86082 similar to sp|P40526 Saccharomyces
           cerevisiae YIL049w DFG10, hypothetical start
          Length = 249

 Score =  162 bits (410), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 100/233 (42%), Positives = 138/233 (59%), Gaps = 8/233 (3%)

Query: 12  SFLVGIASVHLAKWQLPALLKYGKTLEGSRT-QKGLLGFFEQLTVPKQWFTHFYVYSTTL 70
           S +VG+ S+ +AK+ LP  L+YGKT   ++   + +    +  +VPK +F HFY+ S+ L
Sbjct: 18  SNIVGLMSLIIAKYYLPDFLRYGKTFTFAKNGNENIWDKIKNFSVPKSYFAHFYILSSVL 77

Query: 71  AILNV--YCQRNLVSLLFLIHSGRRLYETQCVTKYGENSRMHLSHYLVGLWFYSVANWAV 128
           A++ +  Y    LV  LFL HS RRLYET  ++KY E S+M+ SHY VGLWFYS  N  V
Sbjct: 78  ALVTLASYPTDILVWQLFL-HSSRRLYETLYISKYTEKSKMNWSHYAVGLWFYSQLNILV 136

Query: 129 FESKSRSQXXXXXXXXXXXXXXSSVDQYMNHLHLSKLVKYTMPTYGLFSITTSPHYFDEV 188
           +    R +              +S DQY NH+ LSKL KY++P   LF +   PHY DE+
Sbjct: 137 YLRVQR-ENTTARVLPILVMVLASWDQYKNHVVLSKLKKYSLPRSRLFELVCCPHYLDEM 195

Query: 189 LLYLSLTAYTGSLKLFACLVWVIVNLSTSALETRAWYLKKFPQT-TPPYAIIP 240
           ++Y SL +Y    +    L+WVI +LS SALE+R +YL KF  T  P YA IP
Sbjct: 196 IIYGSLVSYGH--EFVWPLIWVIASLSISALESRKFYLSKFKDTEVPRYAAIP 246

>YIL049W (DFG10) [2618] chr9 (260157..260918) Protein involved in
           filamentous growth, cell polarity, and cellular
           elongation [762 bp, 253 aa]
          Length = 253

 Score =  158 bits (399), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 99/241 (41%), Positives = 138/241 (57%), Gaps = 13/241 (5%)

Query: 8   AFYASFLVGIASVHLAKWQLPALLKYGKTLEGSRTQK--GLLGFFEQLTVPKQWFTHFYV 65
           A+  SF VGI S+ +AK  LP  L+YGKT       K   +L   ++ TVPK +F+HFY 
Sbjct: 15  AYRLSFFVGICSLFIAKSCLPEFLQYGKTYRPKENSKYSSILERIKKFTVPKAYFSHFYY 74

Query: 66  YSTTLAILNVYCQRNL-VSLLFLIHSGRRLYETQCVTKYGENSRMHLSHYLVGLWFYSVA 124
            +T L+++ +Y      +  +   HS RRLYET  V  Y  NSRM+ SHYLVG+WFYSV 
Sbjct: 75  LATFLSLVTLYFYPKFPIVWIIFGHSLRRLYETLYVLHYTSNSRMNWSHYLVGIWFYSVL 134

Query: 125 ----NWAVFESKSRSQXXXXXXXXXXXXXXSSVDQYMNHLHLSKLVKYTMPTYGLFSITT 180
               N +++++   S               +S DQY NH+ L+ LVKY++PT  LF +  
Sbjct: 135 LLILNISLYKN---SIPNTLNMNAFIIFCIASWDQYKNHVILANLVKYSLPTGRLFRLVC 191

Query: 181 SPHYFDEVLLYLSLTAYTGSLKLFACLVWVIVNLSTSALETRAWYLKKFPQT-TPPYAII 239
            PHY DE+++Y +L  Y    + +  LVWVI +L+ SALET+ +Y  KF      PYAII
Sbjct: 192 CPHYLDEIIIYSTLLPYEQ--EFYLTLVWVITSLTISALETKNYYRHKFKDNHVAPYAII 249

Query: 240 P 240
           P
Sbjct: 250 P 250

>Scas_704.37
          Length = 251

 Score =  150 bits (378), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 98/249 (39%), Positives = 146/249 (58%), Gaps = 19/249 (7%)

Query: 3   TLLDAAFYASFLVGIASVHLAKWQLPALLKYGKTLEGSRTQKGLLGFFEQL---TVPKQW 59
            LL   + +SF +G+ S+ +AK+ LP  L+YGKTL  +++   ++  ++++   TVPK +
Sbjct: 8   NLLVIGYRSSFFLGLLSLAIAKFYLPDFLQYGKTLNTAQS-GDVMTLWDKIIHFTVPKSY 66

Query: 60  FTHFYVYSTTLAI--LNVYCQRNLVSLLFLIHSGRRLYETQCVTKYGENSRMHLSHYLVG 117
           F+HFY  S  L++  L VY +  +V LL   HS RRLYET  V KY   SRM+ SHY+VG
Sbjct: 67  FSHFYYLSAILSVSTLYVYPKYPVVWLL-AFHSLRRLYETLFVCKYTSKSRMNWSHYVVG 125

Query: 118 LWFYSVANWAV-----FESKSRSQXXXXXXXXXXXXXXSSVDQYMNHLHLSKLVKYTMPT 172
           +WFY+V +  +     FE  S +               +S DQY NH  L+ L KY++PT
Sbjct: 126 IWFYTVLHLILNICLYFERISPT----INISALFILILASWDQYKNHRVLAHLRKYSLPT 181

Query: 173 YGLFSITTSPHYFDEVLLYLSLTAYTGSLKLFACLVWVIVNLSTSALETRAWYLKKF-PQ 231
             LF I   PHY DE+++Y +  +Y    +    L+WV+V+LS SA+ET+ +Y  KF  +
Sbjct: 182 QRLFKIVCCPHYLDEMIIYSTFLSYNA--EFIWPLIWVVVSLSISAIETKNFYKSKFVEE 239

Query: 232 TTPPYAIIP 240
             P Y+IIP
Sbjct: 240 NVPDYSIIP 248

>AAR016W [202] [Homologous to ScYOL027C - SH]
           complement(368883..370463) [1581 bp, 526 aa]
          Length = 526

 Score = 32.0 bits (71), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 29  ALLKYGKTLEGSRTQKGLLGFFEQLTVPKQWFTHFYVYSTTLAILNVY 76
           +L+ Y  ++EGS  +K  L FF+++  PK   T  + +   L+I  ++
Sbjct: 200 SLINYN-SVEGSEKRKKFLSFFQKVNSPKDGKTSVFTHEEILSISKMF 246

>Scas_464.1
          Length = 1188

 Score = 31.6 bits (70), Expect = 0.65,   Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 9/70 (12%)

Query: 59   WFTHFYVYSTTLAILNVYCQRNLVSLLFLIHSGRRLYETQCVTKYGENSRMHLSHYLVGL 118
            WF   + ++ TL +L      NL S LF      ++  T C+TK  +N++ HL+ +  G 
Sbjct: 978  WFLQGWNFTRTLILL--LTSINLQSFLF------KIVTTFCITKEFKNNKPHLA-WWTGN 1028

Query: 119  WFYSVANWAV 128
            W+ +  +W+V
Sbjct: 1029 WYKTGLSWSV 1038

>YPR045C (YPR045C) [5477] chr16 complement(655135..656547) Member of
           the SAC3 and GANP family, has low similarity to
           uncharacterized S. pombe Spbc2a9.11cp [1413 bp, 470 aa]
          Length = 470

 Score = 30.0 bits (66), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 24/43 (55%)

Query: 31  LKYGKTLEGSRTQKGLLGFFEQLTVPKQWFTHFYVYSTTLAIL 73
           L+ G   E ++ Q  ++  FE  T+PK+ ++ F  YS   ++L
Sbjct: 272 LENGDLGEFNQCQNRIMALFENPTIPKKSYSEFICYSVLYSML 314

>Kwal_23.3160
          Length = 1100

 Score = 28.9 bits (63), Expect = 4.1,   Method: Composition-based stats.
 Identities = 12/40 (30%), Positives = 19/40 (47%)

Query: 197 YTGSLKLFACLVWVIVNLSTSALETRAWYLKKFPQTTPPY 236
           Y G    FA + W  + L+   ++ R  + K  P+T  PY
Sbjct: 946 YHGRAATFASMTWCALILAWEVIDMRRSFFKMQPETDTPY 985

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.136    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,402,160
Number of extensions: 277063
Number of successful extensions: 702
Number of sequences better than 10.0: 12
Number of HSP's gapped: 678
Number of HSP's successfully gapped: 12
Length of query: 240
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 141
Effective length of database: 13,168,927
Effective search space: 1856818707
Effective search space used: 1856818707
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 60 (27.7 bits)