Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.581951650925860.0
Sklu_1893.251350920220.0
Kwal_34.1573051851118430.0
KLLA0C08283g51951017570.0
YER056C (FCY2)53351917030.0
Scas_715.4953250816470.0
Scas_704.3654548716340.0
CAGL0L00671g54352216300.0
CAGL0J02948g51550716090.0
YER060W (FCY21)52851116030.0
Scas_715.47d53352215930.0
YER060W-A (FCY22)53051515740.0
ADL074W52450915370.0
Scas_715.47d152351114310.0
CAGL0C00231g54050613670.0
Scas_715.54d2322266401e-80
Kwal_47.172165425385255e-60
KLLA0D05060g5235165237e-60
YGL186C (TPN1)5795654803e-53
CAGL0L06138g6314514552e-49
Scas_710.305844544067e-43
Scas_701.168611186e-08
Scas_690.1*636401166e-06
Kwal_47.18919640105770.26
Scas_640.16505130770.27
AGL027W877218750.48
Scas_676.25634104720.90
KLLA0C01958g16342691.0
Scas_712.56620104711.5
YGR138C (TPO2)614116674.5
YPR156C (TPO3)622116656.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.5819
         (509 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.5819                                                         1000   0.0  
Sklu_1893.2 YER056C, Contig c1893 1725-3266                           783   0.0  
Kwal_34.15730                                                         714   0.0  
KLLA0C08283g complement(725563..727122) similar to sp|P17064 Sac...   681   0.0  
YER056C (FCY2) [1485] chr5 complement(266511..268112) Cytosine/p...   660   0.0  
Scas_715.49                                                           639   0.0  
Scas_704.36                                                           634   0.0  
CAGL0L00671g 83129..84760 highly similar to sp|P17064 Saccharomy...   632   0.0  
CAGL0J02948g 282559..284106 highly similar to sp|P40039 Saccharo...   624   0.0  
YER060W (FCY21) [1490] chr5 (274565..276151) Protein with simila...   622   0.0  
Scas_715.47d                                                          618   0.0  
YER060W-A (FCY22) [1491] chr5 (276570..278162) Purine/cytosine p...   610   0.0  
ADL074W [1667] [Homologous to ScYER056C (FCY2) - SH] complement(...   596   0.0  
Scas_715.47d1                                                         555   0.0  
CAGL0C00231g 15916..17538 similar to sp|P40039 Saccharomyces cer...   531   0.0  
Scas_715.54d                                                          251   1e-80
Kwal_47.17216                                                         206   5e-60
KLLA0D05060g 436335..437906 similar to sp|P53099 Saccharomyces c...   206   7e-60
YGL186C (TPN1) [1806] chr7 complement(151041..152780) Member of ...   189   3e-53
CAGL0L06138g 695566..697461 similar to sp|P53099 Saccharomyces c...   179   2e-49
Scas_710.30                                                           160   7e-43
Scas_701.1                                                             50   6e-08
Scas_690.1*                                                            49   6e-06
Kwal_47.18919                                                          34   0.26 
Scas_640.16                                                            34   0.27 
AGL027W [4284] [Homologous to ScYPR194C (OPT2) - NSH] complement...    33   0.48 
Scas_676.25                                                            32   0.90 
KLLA0C01958g complement(157085..157576) no similarity, hypotheti...    31   1.0  
Scas_712.56                                                            32   1.5  
YGR138C (TPO2) [2094] chr7 complement(763765..765609) Polyamine ...    30   4.5  
YPR156C (TPO3) [5571] chr16 complement(837903..839771) Polyamine...    30   6.6  

>Kwal_23.5819
          Length = 516

 Score = 1000 bits (2586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/509 (96%), Positives = 493/509 (96%)

Query: 1   MSLQKEEYEIQDVEKRLNSRFEISDDDSQPVVESTEYTKLSIVDRIAASLRAETKGIEPV 60
           MSLQKEEYEIQDVEKRLNSRFEISDDDSQPVVESTEYTKLSIVDRIAASLRAETKGIEPV
Sbjct: 1   MSLQKEEYEIQDVEKRLNSRFEISDDDSQPVVESTEYTKLSIVDRIAASLRAETKGIEPV 60

Query: 61  TEEEKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLAVVLFSALGVIPVA 120
           TEEEKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLAVVLFSALGVIPVA
Sbjct: 61  TEEEKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLAVVLFSALGVIPVA 120

Query: 121 YYSVFGAELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIASAQLLHMINPGGA 180
           YYSVFGAELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIASAQLLHMINPGGA
Sbjct: 121 YYSVFGAELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIASAQLLHMINPGGA 180

Query: 181 RCPPWAGCLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVIIARLKIDGSFSSGEWI 240
           RCPPWAGCLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVIIARLKIDGSFSSGEWI
Sbjct: 181 RCPPWAGCLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVIIARLKIDGSFSSGEWI 240

Query: 241 SGTNGAAAVLSFGGVIFGFASGWTTYAADYTVYMPRTTNKPKVFFAVIFGLMFPLCFSII 300
           SGTNGAAAVLSFGGVIFGFASGWTTYAADYTVYMPRTTNKPKVFFAVIFGLMFPLCFSII
Sbjct: 241 SGTNGAAAVLSFGGVIFGFASGWTTYAADYTVYMPRTTNKPKVFFAVIFGLMFPLCFSII 300

Query: 301 LGAAAAMASKNNSEYARLHDSGGVGGLIYAILVNNSLHGFGQFCCVLLAMSTVANNIPNM 360
           LGAAAAMASKNNSEYARLHDSGGVGGLIYAILVNNSLHGFGQFCCVLLAMSTVANNIPNM
Sbjct: 301 LGAAAAMASKNNSEYARLHDSGGVGGLIYAILVNNSLHGFGQFCCVLLAMSTVANNIPNM 360

Query: 361 YSIALGTQALWEPLAKIPRVFWTMAGNLVTLAIAIPAYYKFNSFMTNFMDAIAYYLSIYI 420
           YSIALGTQALWEPLAKIPRVFWTMAGNLVTLAIAIPAYYKFNSFMTNFMDAIAYYLSIYI
Sbjct: 361 YSIALGTQALWEPLAKIPRVFWTMAGNLVTLAIAIPAYYKFNSFMTNFMDAIAYYLSIYI 420

Query: 421 GISLSEHLFFRKMNFRNYNVDDWNKWDKLPIGYXXXXXXXXXXXXXXXXMEQTYWTGQIA 480
           GISLSEHLFFRKMNFRNYNVDDWNKWDKLPIGY                MEQTYWTGQIA
Sbjct: 421 GISLSEHLFFRKMNFRNYNVDDWNKWDKLPIGYAGCCALFVGAVGVAVGMEQTYWTGQIA 480

Query: 481 RKIGDYGADIGFEIGFCFSVIVYNILRPL 509
           RKIGDYGADIGFEIGFCFSVIVYNILRPL
Sbjct: 481 RKIGDYGADIGFEIGFCFSVIVYNILRPL 509

>Sklu_1893.2 YER056C, Contig c1893 1725-3266
          Length = 513

 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/509 (74%), Positives = 433/509 (85%), Gaps = 3/509 (0%)

Query: 1   MSLQKEEYEIQDVEKRLNSRFEISDDDSQPVVESTEYTKLSIVDRIAASLRAETKGIEPV 60
           MS  KEEY IQD+EK+  +  E+++ DS PVVESTEYT +S +DR AA L+AETKGIEP+
Sbjct: 1   MSSSKEEYAIQDMEKQ--NPLELTETDSTPVVESTEYTTVSFIDRWAAKLKAETKGIEPI 58

Query: 61  TEEEKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLAVVLFSALGVIPVA 120
           T+EEKDDDSI NAASMWFSANMVIAA++LGVLG  V+GLNFW  VL ++ FS LG+IPVA
Sbjct: 59  TDEEKDDDSILNAASMWFSANMVIAAYALGVLGTGVFGLNFWESVLTIIFFSFLGLIPVA 118

Query: 121 YYSVFGAELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIASAQLLHMINPGGA 180
           ++SVFGAELG+RQMVLSRFL+GNVTARIFALIN+IACVGWGAVNTIASA LLHMINPGGA
Sbjct: 119 FFSVFGAELGMRQMVLSRFLMGNVTARIFALINVIACVGWGAVNTIASASLLHMINPGGA 178

Query: 181 RCPPWAGCLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVIIARLKIDGSFSSGEWI 240
           +CPPWA CLIIV STI+VTFFGYRVIHAYEKWSW+PNFAVFLVIIARLKI G+FS+GEW 
Sbjct: 179 QCPPWAACLIIVFSTIIVTFFGYRVIHAYEKWSWVPNFAVFLVIIARLKISGNFSTGEWT 238

Query: 241 SGTNGAAAVLSFGGVIFGFASGWTTYAADYTVYMPRTTNKPKVFFAVIFGLMFPLCFSII 300
           SG   A  VLSFGG IFGFASGWTTYAADYTVYMPR+TNK K+FFA++FGL FPLCFS+I
Sbjct: 239 SGATTAGGVLSFGGSIFGFASGWTTYAADYTVYMPRSTNKWKIFFALVFGLAFPLCFSLI 298

Query: 301 LGAAAAMASKNNSEYARLHDSGGVGGLIYAILVNNSLHGFGQFCCVLLAMSTVANNIPNM 360
           LGAA+    + N+ + + ++   VGGL+YAILV +SLHGFG+FCCVLLAMSTVANNIPNM
Sbjct: 299 LGAASIAGIEKNALWKQYYEDHSVGGLVYAILVKDSLHGFGEFCCVLLAMSTVANNIPNM 358

Query: 361 YSIALGTQALWEPLAKIPRVFWTMAGNLVTLAIAIPAYYKFNSFMTNFMDAIAYYLSIYI 420
           YSIALGTQ++WEPLAK+PRVFWT+AGNLVTLAIAIPAYYKF SFM++FM+AIAYYL+IYI
Sbjct: 359 YSIALGTQSMWEPLAKVPRVFWTIAGNLVTLAIAIPAYYKFESFMSSFMEAIAYYLAIYI 418

Query: 421 GISLSEHLFFRKMNFRNYNVDDWNKWDKLPIGYXXXXXXXXXXXXXXXXMEQTYWTGQIA 480
            ISLSEH F+RK  F+ YNVDDWN+WD+LPIGY                M QTYW GQIA
Sbjct: 419 AISLSEHFFYRK-GFKGYNVDDWNRWDRLPIGYAGCAALFIGAFGVAFGMSQTYWEGQIA 477

Query: 481 RKIGDYGADIGFEIGFCFSVIVYNILRPL 509
           R IG+YG DIGFE+G  FS I YNILRPL
Sbjct: 478 RHIGEYGGDIGFELGMGFSFITYNILRPL 506

>Kwal_34.15730
          Length = 518

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/511 (67%), Positives = 413/511 (80%), Gaps = 4/511 (0%)

Query: 3   LQKEEYEIQDVEKRLNSRFEISDDD----SQPVVESTEYTKLSIVDRIAASLRAETKGIE 58
           + K++YE+QD+E  + S+   S DD    S    E      +++++R+A  LRAETKGIE
Sbjct: 1   MAKDKYEVQDLELNVYSQENTSADDATRGSSQAPEKLNGGGMAVLNRLAKKLRAETKGIE 60

Query: 59  PVTEEEKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLAVVLFSALGVIP 118
           PVTE+EKDD SIWNAA +WFSANMVIAAFS+G+LGP+V+ LNFWGCV+++V+F+ +GV+P
Sbjct: 61  PVTEDEKDDSSIWNAAFVWFSANMVIAAFSVGMLGPLVFSLNFWGCVVSIVIFTFIGVLP 120

Query: 119 VAYYSVFGAELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIASAQLLHMINPG 178
           V  YSVFG +L LRQMVLSRFLLGNVTARIFALIN+IAC+GWG VNT+ SAQLLHMINP 
Sbjct: 121 VCLYSVFGVQLSLRQMVLSRFLLGNVTARIFALINVIACIGWGVVNTVTSAQLLHMINPT 180

Query: 179 GARCPPWAGCLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVIIARLKIDGSFSSGE 238
           G RCPPWAGCLIIV STI VTFFGYRVIH + K+SWIPNF VF+VIIARLKIDGSFS G+
Sbjct: 181 GGRCPPWAGCLIIVFSTIFVTFFGYRVIHTFGKYSWIPNFIVFIVIIARLKIDGSFSVGK 240

Query: 239 WISGTNGAAAVLSFGGVIFGFASGWTTYAADYTVYMPRTTNKPKVFFAVIFGLMFPLCFS 298
           W SG+  A ++LS GG++FGFA+GWTTYAAD+TVYMPRT N+ +VFFAV+ GL+FPLCF+
Sbjct: 241 WESGSTTAGSILSLGGIVFGFATGWTTYAADFTVYMPRTVNRAEVFFAVMLGLVFPLCFT 300

Query: 299 IILGAAAAMASKNNSEYARLHDSGGVGGLIYAILVNNSLHGFGQFCCVLLAMSTVANNIP 358
           IILGAAA  A+ NN  Y   ++S   GGL+YAILV  SLHGFGQFCCVLLAMSTVAN +P
Sbjct: 301 IILGAAAGCAALNNPVYHEFYESDHAGGLVYAILVPRSLHGFGQFCCVLLAMSTVANMVP 360

Query: 359 NMYSIALGTQALWEPLAKIPRVFWTMAGNLVTLAIAIPAYYKFNSFMTNFMDAIAYYLSI 418
           NMYSIALGTQALWEPLAK+PRVFWT+AGNL+TLAIAIPAYY+F +FMTNFMD+IAYYLSI
Sbjct: 361 NMYSIALGTQALWEPLAKVPRVFWTLAGNLITLAIAIPAYYRFEAFMTNFMDSIAYYLSI 420

Query: 419 YIGISLSEHLFFRKMNFRNYNVDDWNKWDKLPIGYXXXXXXXXXXXXXXXXMEQTYWTGQ 478
           YIG+SLSEH  FR+  F NY+  +WN W +LP+GY                M QTYWTG+
Sbjct: 421 YIGVSLSEHFIFRQNKFSNYDTSEWNDWHRLPLGYAGCAALFVGAIGVALGMHQTYWTGE 480

Query: 479 IARKIGDYGADIGFEIGFCFSVIVYNILRPL 509
           I R IG++G DIGFE+G  FS+IVY  LRPL
Sbjct: 481 IGRLIGEFGGDIGFELGLAFSMIVYTALRPL 511

>KLLA0C08283g complement(725563..727122) similar to sp|P17064
           Saccharomyces cerevisiae YER056c FCY2 purine-cytosine
           permease, start by similarity
          Length = 519

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/510 (66%), Positives = 401/510 (78%), Gaps = 3/510 (0%)

Query: 2   SLQKEEYEIQDVEKRLNSRFEISD--DDSQPVVESTEYTKLSIVDRIAASLRAETKGIEP 59
           S  KEEY + DVEK+  S+ +  +  ++   +VE+TE TKLS VD +A+ L AETKGIEP
Sbjct: 4   SSSKEEYVLHDVEKQELSKTQFDEVLEEEPVIVETTEVTKLSWVDHLASKLHAETKGIEP 63

Query: 60  VTEEEKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLAVVLFSALGVIPV 119
           +T++EKDDD I NAASMW SAN+VIAAFSLG +G  V+GLNF   VL +V FS LG++PV
Sbjct: 64  ITDDEKDDDDILNAASMWLSANLVIAAFSLGCIGTSVFGLNFGEAVLVIVFFSFLGLLPV 123

Query: 120 AYYSVFGAELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIASAQLLHMINPGG 179
           A++SVFGAELGLRQ+VLSRFLLGNVTARIF  INIIACVGWGAVNTIASA LLH++NP G
Sbjct: 124 AFFSVFGAELGLRQLVLSRFLLGNVTARIFCFINIIACVGWGAVNTIASASLLHIVNPSG 183

Query: 180 ARCPPWAGCLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVIIARLKIDGSFSSGEW 239
             CPPWAGCLII+  TI+VTFFGYRVIHAYEKWSW+PNFAVFLVIIARL   G+F++G W
Sbjct: 184 PDCPPWAGCLIIIFGTIIVTFFGYRVIHAYEKWSWVPNFAVFLVIIARLAKAGTFTAGSW 243

Query: 240 ISGTNGAAAVLSFGGVIFGFASGWTTYAADYTVYMPRTTNKPKVFFAVIFGLMFPLCFSI 299
            SG+  A  VLSFG  +FGFA+GWTTYA+DYTVYMPRTTNK KVF A++ GL FPLCFS+
Sbjct: 244 GSGSTTAGGVLSFGSSVFGFATGWTTYASDYTVYMPRTTNKKKVFAAIVLGLAFPLCFSM 303

Query: 300 ILGAAAAMASKNNSEYARLHDSGGVGGLIYAILVNNSLHGFGQFCCVLLAMSTVANNIPN 359
           ILGAAA   ++ N  +A L+D   VGGL YAIL+ +SL GFG FCCV+LA+ST++NNIPN
Sbjct: 304 ILGAAAVTGTRTNERWAELYDKYSVGGLCYAILIEDSLWGFGSFCCVVLALSTISNNIPN 363

Query: 360 MYSIALGTQALWEPLAKIPRVFWTMAGNLVTLAIAIPAYYKFNSFMTNFMDAIAYYLSIY 419
           MYSIALGTQAL+EPLAK+PRV WT+ GNLVTLAIAIPAYYKF +FMT FMD+I YYL+IY
Sbjct: 364 MYSIALGTQALFEPLAKVPRVAWTIIGNLVTLAIAIPAYYKFETFMTTFMDSIGYYLAIY 423

Query: 420 IGISLSEHLFFRKMNFRNYNVDDWNKWDKLPIGYXXXXXXXXXXXXXXXXMEQTYWTGQI 479
             I+LSEH  +R   F+ YNVDDW++WDKLPIGY                M Q YW GQI
Sbjct: 424 SAIALSEHFIYRG-GFKGYNVDDWDRWDKLPIGYAGTFALFIGAFGVAFGMNQIYWQGQI 482

Query: 480 ARKIGDYGADIGFEIGFCFSVIVYNILRPL 509
            R IG+ G DIGFE+G  F+ I YNI RPL
Sbjct: 483 GRLIGENGGDIGFELGAGFAFITYNIFRPL 512

>YER056C (FCY2) [1485] chr5 complement(266511..268112)
           Cytosine/purine permease, member of the purine/cytosine
           permease family of membrane transporters [1602 bp, 533
           aa]
          Length = 533

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/519 (63%), Positives = 396/519 (76%), Gaps = 18/519 (3%)

Query: 8   YEIQDVEKR---LNSRFE-------------ISDDDSQPVVESTEYTKLSIVDRIAASLR 51
           YEIQD+EKR   + S  E              S+DD Q +VES+E TKLS   +  ASL 
Sbjct: 9   YEIQDLEKRSPVIGSSLENEKKVAASETFTATSEDDQQYIVESSEATKLSWFHKFFASLN 68

Query: 52  AETKGIEPVTEEEKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLAVVLF 111
           AETKG+EPVTE+EK DDSI NAASMWFSANMVIA+++LG LGP+V+GLNF   VL ++ F
Sbjct: 69  AETKGVEPVTEDEKTDDSILNAASMWFSANMVIASYALGALGPMVFGLNFGQSVLVIIFF 128

Query: 112 SALGVIPVAYYSVFGAELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIASAQL 171
           + +G+I VA++SVFGAELGLRQM+LSR+L+GNVTARIF+LIN+IACVGWG VNT  SAQL
Sbjct: 129 NIMGLIFVAFFSVFGAELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIVNTSVSAQL 188

Query: 172 LHMINPG-GARCPPWAGCLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVIIARLKI 230
           L+M+N G G  CP WAGCLII+  T+LVTFFGY VIHAYEKWSW+PNFAVFLVIIA+L  
Sbjct: 189 LNMVNEGSGHVCPIWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFLVIIAQLSR 248

Query: 231 DGSFSSGEWISGTNGAAAVLSFGGVIFGFASGWTTYAADYTVYMPRTTNKPKVFFAVIFG 290
            G F  GEW+ G   A +VLSFG  IFGFA+GWTTYAADYTVYMP++TNK K+FF+++ G
Sbjct: 249 SGKFKGGEWVGGATTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYKIFFSLVAG 308

Query: 291 LMFPLCFSIILGAAAAMASKNNSEYARLHDSGGVGGLIYAILVNNSLHGFGQFCCVLLAM 350
           L FPL F++ILGAA+AMA+ N+  +   +D   +GG+IYAILV NSL+GFGQFCCVLLA+
Sbjct: 309 LAFPLFFTMILGAASAMAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQFCCVLLAL 368

Query: 351 STVANNIPNMYSIALGTQALWEPLAKIPRVFWTMAGNLVTLAIAIPAYYKFNSFMTNFMD 410
           ST+ANNIPNMY++AL  QALW PLAKIPRV WTMAGN  TL I+IPA Y F+ FM NFMD
Sbjct: 369 STIANNIPNMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFMENFMD 428

Query: 411 AIAYYLSIYIGISLSEHLFFRKMNFRNYNVDDWNKWDKLPIGYXXXXXXXXXXXXXXXXM 470
           +I YYL+IYI IS SEH F+R+ +F  YN+DDW+ W+ LPIG                 M
Sbjct: 429 SIGYYLAIYIAISCSEHFFYRR-SFSAYNIDDWDNWEHLPIGIAGTAALIVGAFGVALGM 487

Query: 471 EQTYWTGQIARKIGDYGADIGFEIGFCFSVIVYNILRPL 509
            QTYW G+I R IG YG DIGFE+G  ++ I+YNILRPL
Sbjct: 488 CQTYWVGEIGRLIGKYGGDIGFELGASWAFIIYNILRPL 526

>Scas_715.49
          Length = 532

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/508 (61%), Positives = 395/508 (77%), Gaps = 3/508 (0%)

Query: 2   SLQKEEYEIQDVEKRLNSRFEISDDDSQPVVESTEYTKLSIVDRIAASLRAETKGIEPVT 61
            L++   +++   K L+S + + D DS    E  E TKL++ +RIAA L AETKGIEP+T
Sbjct: 21  DLERNSKDLKSPSKNLSSDYYV-DIDSHASEEVLE-TKLNLFNRIAAGLSAETKGIEPIT 78

Query: 62  EEEKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLAVVLFSALGVIPVAY 121
           +EEK+D S+ NAASMWFSANMVIAA+++G LGP+V+GLNF    L ++ F+ LG++PVA+
Sbjct: 79  DEEKNDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGTSTLVIIFFNILGLLPVAF 138

Query: 122 YSVFGAELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIASAQLLHMINPGGAR 181
           +S+FGA+LGLRQMVLSRFL+GN TARIF++IN +ACVGWG VNT+AS+QLL+M+N G  +
Sbjct: 139 FSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIVNTVASSQLLNMVNQGPHK 198

Query: 182 CPPWAGCLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVIIARLKIDGSFSSGEWIS 241
           CP WAGC++I+ +TIL+TFFGYRVIH++EKW W+PNFA FLVIIARL   G+FS+GEW S
Sbjct: 199 CPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLVIIARLAKSGNFSNGEWTS 258

Query: 242 GTNGAAAVLSFGGVIFGFASGWTTYAADYTVYMPRTTNKPKVFFAVIFGLMFPLCFSIIL 301
           G   A  VLSFG  +FGFA+GWTTYAADYTVYMPR TNK K+FF+++ GL FPL F +IL
Sbjct: 259 GPTTAGNVLSFGSAVFGFATGWTTYAADYTVYMPRNTNKFKIFFSLVAGLSFPLFFVMIL 318

Query: 302 GAAAAMASKNNSEYARLHDSGGVGGLIYAILVNNSLHGFGQFCCVLLAMSTVANNIPNMY 361
           GAA+AM + NN ++A  +   G+GGL YAILV NSLHGFG+FCCV+L++S VANN+PNMY
Sbjct: 319 GAASAMGAVNNPDWANYYSENGMGGLTYAILVPNSLHGFGEFCCVVLSISIVANNVPNMY 378

Query: 362 SIALGTQALWEPLAKIPRVFWTMAGNLVTLAIAIPAYYKFNSFMTNFMDAIAYYLSIYIG 421
           +IAL  QA+W PLAKIPRVFWTMAGN  TL IAIPA Y F++FM  FMD+IAYYL+IYI 
Sbjct: 379 TIALSVQAIWAPLAKIPRVFWTMAGNFATLGIAIPACYFFDTFMEYFMDSIAYYLAIYIS 438

Query: 422 ISLSEHLFFRKMNFRNYNVDDWNKWDKLPIGYXXXXXXXXXXXXXXXXMEQTYWTGQIAR 481
           I+LSEH  +R+ +F  YNV+DW+   KLPIG                 M QTYWTGQI R
Sbjct: 439 IALSEHFIYRR-SFEAYNVEDWDDNSKLPIGIAGCCAFGVGVIGVALGMCQTYWTGQIGR 497

Query: 482 KIGDYGADIGFEIGFCFSVIVYNILRPL 509
            IG+YG D+GFE+G  +S IVYN++RPL
Sbjct: 498 LIGEYGGDLGFELGAGWSFIVYNLVRPL 525

>Scas_704.36
          Length = 545

 Score =  634 bits (1634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/487 (63%), Positives = 378/487 (77%), Gaps = 5/487 (1%)

Query: 26  DDSQPVVESTEY---TKLSIVDRIAASLRAETKGIEPVTEEEKDDDSIWNAASMWFSANM 82
           D+ + + E   Y   TKLS  +R  ASL AETKG+EPVT+EEK DDSI NAASMWFSAN+
Sbjct: 54  DEYESIQEPETYMEETKLSFFNRFVASLNAETKGVEPVTDEEKTDDSIINAASMWFSANL 113

Query: 83  VIAAFSLGVLGPVVWGLNFWGCVLAVVLFSALGVIPVAYYSVFGAELGLRQMVLSRFLLG 142
           VIA+++LG LGP+V+ LNF   VL ++ F+ LG++ +A++SVFGAE GLRQM+LSR+LLG
Sbjct: 114 VIASYALGGLGPIVFNLNFGTSVLVIIFFNILGLLSIAFFSVFGAEFGLRQMILSRYLLG 173

Query: 143 NVTARIFALINIIACVGWGAVNTIASAQLLHMINPGGARCPPWAGCLIIVLSTILVTFFG 202
           N+TARIFA+INIIACVGWG VNT+AS+QLL+M+N     CP WAGCLIIV  T+LVTFFG
Sbjct: 174 NITARIFAIINIIACVGWGVVNTVASSQLLNMVNTPN-NCPLWAGCLIIVGCTVLVTFFG 232

Query: 203 YRVIHAYEKWSWIPNFAVFLVIIARLKIDGSFSSGEWISGTNGAAAVLSFGGVIFGFASG 262
           Y VIHAYEKWSW+PNFAVFLVIIARLK+ G+F+ GEW SG   A  VLSFGG +FGFA+G
Sbjct: 233 YNVIHAYEKWSWVPNFAVFLVIIARLKMSGAFTGGEWTSGPTTAGNVLSFGGAVFGFAAG 292

Query: 263 WTTYAADYTVYMPRTTNKPKVFFAVIFGLMFPLCFSIILGAAAAMASKNNSEYARLHDSG 322
           WTTYAADYTVYMPR+TNK  +FF++  GL  PL F++ILGAA+AM + NN ++   + S 
Sbjct: 293 WTTYAADYTVYMPRSTNKYTIFFSLTAGLSLPLFFTMILGAASAMGAVNNPDWMNYYKSN 352

Query: 323 GVGGLIYAILVNNSLHGFGQFCCVLLAMSTVANNIPNMYSIALGTQALWEPLAKIPRVFW 382
           G+GG+ YAILV +SLHGFGQFCCVLLAMSTVANNIPNMY+IAL  QAL++P +K+PRV W
Sbjct: 353 GMGGVTYAILVPDSLHGFGQFCCVLLAMSTVANNIPNMYTIALSVQALYQPFSKVPRVAW 412

Query: 383 TMAGNLVTLAIAIPAYYKFNSFMTNFMDAIAYYLSIYIGISLSEHLFFRKMNFRNYNVDD 442
           TMAGN  TL I+I A Y F  FM NFM++I YYL+IYI ISLSEH  +RK  F+ YNV+D
Sbjct: 413 TMAGNAFTLGISIAACYYFQGFMENFMNSIGYYLAIYIAISLSEHFIYRK-GFQGYNVED 471

Query: 443 WNKWDKLPIGYXXXXXXXXXXXXXXXXMEQTYWTGQIARKIGDYGADIGFEIGFCFSVIV 502
           WN W KLPIG                 M Q+YW G+I + IGD+G DIGFE+G  ++ IV
Sbjct: 472 WNTWSKLPIGIAGTSALIVGAFGVALGMSQSYWVGEIGKLIGDHGGDIGFELGASWAFIV 531

Query: 503 YNILRPL 509
           YN+LRPL
Sbjct: 532 YNVLRPL 538

>CAGL0L00671g 83129..84760 highly similar to sp|P17064 Saccharomyces
           cerevisiae YER056c FCY2 purine-cytosine permease or
           sp|P40039 Saccharomyces cerevisiae YER060w FCY21,
           hypothetical start
          Length = 543

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/522 (57%), Positives = 386/522 (73%), Gaps = 18/522 (3%)

Query: 4   QKEEYEIQDVEKR---------LNS---RFEISDD----DSQPVVESTEYTKLSIVDRIA 47
              +YE+ +VEK+         +N+    ++  DD         VE T+  KL  + R+A
Sbjct: 17  HSNDYELNEVEKQPVEDVKTTNVNTNDFEYDYGDDFTNSSEAATVEETK-LKLGFISRLA 75

Query: 48  ASLRAETKGIEPVTEEEKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLA 107
             + AETKG+EPVT+EEK DDS+ NAASMWFSAN+V+A+++LG LGP+V+ LNF   VL 
Sbjct: 76  LKMNAETKGVEPVTDEEKTDDSVLNAASMWFSANLVLASYALGALGPIVFRLNFGTSVLT 135

Query: 108 VVLFSALGVIPVAYYSVFGAELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIA 167
           +V F+ +G++ VA++SVFGAE GLRQM+LSRFL+GNVTAR+FA IN++ACVGWG VNT+ 
Sbjct: 136 IVFFNMIGLVSVAFFSVFGAEFGLRQMILSRFLVGNVTARVFAAINVVACVGWGVVNTVV 195

Query: 168 SAQLLHMINPGGARCPPWAGCLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVIIAR 227
           +AQLLH++N G  + P W GCL+IV  T++VTFFGY +IHAYE+WSW+PNFAVFLVIIAR
Sbjct: 196 AAQLLHIVNQGSHQLPLWGGCLVIVGGTVMVTFFGYSIIHAYERWSWVPNFAVFLVIIAR 255

Query: 228 LKIDGSFSSGEWISGTNGAAAVLSFGGVIFGFASGWTTYAADYTVYMPRTTNKPKVFFAV 287
           L   G FS+G W SG   A  VLSFG  I+GFA+GWTTYAADYTVYMPRT NK K+FF +
Sbjct: 256 LHKSGQFSNGPWTSGATTAGGVLSFGSAIYGFAAGWTTYAADYTVYMPRTMNKFKIFFFL 315

Query: 288 IFGLMFPLCFSIILGAAAAMASKNNSEYARLHDSGGVGGLIYAILVNNSLHGFGQFCCVL 347
             GL FPL F++ILGAA+AM + NN E+  L+D   +GGL YAILV NSLHGFG+FCCVL
Sbjct: 316 CAGLAFPLLFTMILGAASAMGAVNNPEWMALYDKDNMGGLTYAILVPNSLHGFGEFCCVL 375

Query: 348 LAMSTVANNIPNMYSIALGTQALWEPLAKIPRVFWTMAGNLVTLAIAIPAYYKFNSFMTN 407
           LAMST+ANNIPNMY+IAL  QAL+EP +++PRV WT+AGN   + I+IPA Y F  F+ N
Sbjct: 376 LAMSTIANNIPNMYTIALSVQALYEPFSRVPRVVWTLAGNAAVVGISIPASYYFEGFLEN 435

Query: 408 FMDAIAYYLSIYIGISLSEHLFFRKMNFRNYNVDDWNKWDKLPIGYXXXXXXXXXXXXXX 467
           FMD+I YYL+IYI ISLSEH  +R+  F+ YN++DWN WD+LPIG               
Sbjct: 436 FMDSIGYYLAIYIAISLSEHFIYRR-GFKGYNIEDWNNWDRLPIGIAGCSALFVGAFGVA 494

Query: 468 XXMEQTYWTGQIARKIGDYGADIGFEIGFCFSVIVYNILRPL 509
             M QTYWTG+I+R IG +G DIGFE+G  ++ IV+NI+RPL
Sbjct: 495 LGMSQTYWTGEISRHIGKHGGDIGFELGMSWAFIVFNIVRPL 536

>CAGL0J02948g 282559..284106 highly similar to sp|P40039
           Saccharomyces cerevisiae YER060w or sp|P17064
           Saccharomyces cerevisiae YER056c FCY2, hypothetical
           start
          Length = 515

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/507 (59%), Positives = 386/507 (76%), Gaps = 5/507 (0%)

Query: 4   QKEEYEIQ-DVEKRLNSRFEISDDDSQPVVESTEYTKLSIVDRIAASLRAETKGIEPVTE 62
           +K+ Y+++  VE   NS  E    +   V+E    TKLS+++R+AA + AETKGIEP+T+
Sbjct: 6   KKDLYDMEMQVESSANSHVETDGYNDATVLE----TKLSLLNRLAAMISAETKGIEPITD 61

Query: 63  EEKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLAVVLFSALGVIPVAYY 122
           +EK+DDS+ NAASMWFSANMV+ A ++G LGP+V+GLNF   VL +V F+ LG+  VA++
Sbjct: 62  DEKNDDSLINAASMWFSANMVLPALAIGGLGPLVFGLNFGVSVLTIVFFNILGLFAVAFF 121

Query: 123 SVFGAELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIASAQLLHMINPGGARC 182
           SVFGA+ GLRQMVLSR+L+GN+TARIFALIN +ACVGWG VNT+A++QLL+ INPG  + 
Sbjct: 122 SVFGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGIVNTVAASQLLNEINPGSHQL 181

Query: 183 PPWAGCLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVIIARLKIDGSFSSGEWISG 242
           P W GCL+I+ +TILV+FFGY+VIH YEK+SW+PNFAVFLV+IARLKI G F +G W SG
Sbjct: 182 PLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFLVLIARLKISGKFHNGAWGSG 241

Query: 243 TNGAAAVLSFGGVIFGFASGWTTYAADYTVYMPRTTNKPKVFFAVIFGLMFPLCFSIILG 302
              A +VLSFG  +FGFASGWTTYAADYTVYMPR TN  K+FFA++ GL FPL F++ILG
Sbjct: 242 PTTAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYKIFFALVAGLAFPLFFTMILG 301

Query: 303 AAAAMASKNNSEYARLHDSGGVGGLIYAILVNNSLHGFGQFCCVLLAMSTVANNIPNMYS 362
           +A A A+ + + +   ++  G+GGL +AILV +SLHGFGQFCCV+LAMST+ANN+PNMY+
Sbjct: 302 SACAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFGQFCCVVLAMSTIANNVPNMYT 361

Query: 363 IALGTQALWEPLAKIPRVFWTMAGNLVTLAIAIPAYYKFNSFMTNFMDAIAYYLSIYIGI 422
           IAL  Q++W+P AKIPRV WTM GNL  L I+IPA Y F++FM  FMD+IAYYLSIYI I
Sbjct: 362 IALSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYYFSTFMQYFMDSIAYYLSIYISI 421

Query: 423 SLSEHLFFRKMNFRNYNVDDWNKWDKLPIGYXXXXXXXXXXXXXXXXMEQTYWTGQIARK 482
           +L EHL +R  +F NYNV+DWN + KLPIG                 M Q+YW G+IAR 
Sbjct: 422 ALCEHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVALGMSQSYWVGEIARH 481

Query: 483 IGDYGADIGFEIGFCFSVIVYNILRPL 509
           IG+YG DI  E+G  ++ I YNI RPL
Sbjct: 482 IGEYGGDIAIELGAGWAFIAYNICRPL 508

>YER060W (FCY21) [1490] chr5 (274565..276151) Protein with
           similarity to Fcy2p, member of the purine/cytosine
           family of secondary active transporters [1587 bp, 528
           aa]
          Length = 528

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/511 (58%), Positives = 380/511 (74%), Gaps = 7/511 (1%)

Query: 4   QKEEYEIQDVEKRLN-----SRFEISDDDSQPVVESTEYTKLSIVDRIAASLRAETKGIE 58
           Q  +YE++D+E R +     S  E  DD      E     KLS ++RIAA L AETKGIE
Sbjct: 13  QYLKYELKDLESRAHDAKTPSTNEFYDDVESHGTEELVEAKLSFLNRIAAGLSAETKGIE 72

Query: 59  PVTEEEKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLAVVLFSALGVIP 118
           P+TE+EK DDSI NAASMWFSANMV+ A+++G LGP+V+ LNF   V  ++ F+ LG++ 
Sbjct: 73  PITEDEKTDDSILNAASMWFSANMVLPAYAIGALGPMVFDLNFGQSVFVIIFFNLLGLVS 132

Query: 119 VAYYSVFGAELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIASAQLLHMINPG 178
           VA++SVFGAELGLRQM+LSR+L+GN+ ARIF+ IN IAC+GWG VNT+AS+Q+L+M+NPG
Sbjct: 133 VAFFSVFGAELGLRQMILSRYLVGNIAARIFSFINFIACIGWGIVNTVASSQVLNMVNPG 192

Query: 179 GARCPPWAGCLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVIIARLKIDGSFSSGE 238
             +CP WAGC++I+ +T++VTFFGY VIHAYEKW+W+PNFAVFLVIIARL     F  GE
Sbjct: 193 -HQCPLWAGCIVIIGATVIVTFFGYGVIHAYEKWAWVPNFAVFLVIIARLARSKKFVLGE 251

Query: 239 WISGTNGAAAVLSFGGVIFGFASGWTTYAADYTVYMPRTTNKPKVFFAVIFGLMFPLCFS 298
           W SG   A  VLSFG  ++GFA+GWTTYAADYTVYMPR TNK K+FF+++ GL  PL F+
Sbjct: 252 WTSGPTTAGNVLSFGSTVYGFAAGWTTYAADYTVYMPRKTNKYKIFFSLVVGLATPLYFT 311

Query: 299 IILGAAAAMASKNNSEYARLHDSGGVGGLIYAILVNNSLHGFGQFCCVLLAMSTVANNIP 358
           +ILGAA AMA+  +  +   +D   +GGL +A+LV NS+HGFGQFCCVLL++ST+ANN+P
Sbjct: 312 MILGAAVAMAAIGDPAWKTYYDENSIGGLTFAVLVPNSVHGFGQFCCVLLSLSTIANNVP 371

Query: 359 NMYSIALGTQALWEPLAKIPRVFWTMAGNLVTLAIAIPAYYKFNSFMTNFMDAIAYYLSI 418
           NMY+IAL  QA WEPLAK+PRV WT+ GN   L IAIPA Y F++FM  FMD+I YYL+I
Sbjct: 372 NMYTIALSVQATWEPLAKVPRVIWTLLGNAAALGIAIPACYYFSTFMNYFMDSIGYYLAI 431

Query: 419 YIGISLSEHLFFRKMNFRNYNVDDWNKWDKLPIGYXXXXXXXXXXXXXXXXMEQTYWTGQ 478
           YI I+ SEH  +R+ +F  YNVDDW+ W++LPIG                 M QTYW G+
Sbjct: 432 YIAIACSEHFIYRR-SFSAYNVDDWDSWERLPIGIAGTAALIVGAFGVALGMCQTYWVGE 490

Query: 479 IARKIGDYGADIGFEIGFCFSVIVYNILRPL 509
           I+R IGDYG DIGFE+G  ++ IVYNI RP 
Sbjct: 491 ISRLIGDYGGDIGFELGLSWAFIVYNIARPF 521

>Scas_715.47d
          Length = 533

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/522 (58%), Positives = 384/522 (73%), Gaps = 17/522 (3%)

Query: 4   QKEEYEIQDVEKRLNSRFEISD--------------DDSQPVVESTEYT--KLSIVDRIA 47
            K  YEIQD+E  L    E S+              ++    +E TE T  K S  +R+A
Sbjct: 6   DKNVYEIQDLEMDLERNSEFSNLPNDKKIDLGPTFSNEPASFIEITEETGSKFSFFNRLA 65

Query: 48  ASLRAETKGIEPVTEEEKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLA 107
           + L AETKGIE +T+EEK D SI +A SMWFSANMVI+A++LG +GP+V+GLNF  CVL 
Sbjct: 66  SQLNAETKGIERITDEEKTDGSILDATSMWFSANMVISAYTLGGIGPLVYGLNFGTCVLT 125

Query: 108 VVLFSALGVIPVAYYSVFGAELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIA 167
           ++ FS LG++PVA++S+FGA+ GLRQMVLSRFL+GN TARI A+IN+I+ VGWG VN++A
Sbjct: 126 IIFFSILGLLPVAFFSIFGAKFGLRQMVLSRFLIGNSTARIIAVINVISSVGWGVVNSVA 185

Query: 168 SAQLLHMINPGGARCPPWAGCLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVIIAR 227
           S+QLL+M+N G   CP WAGC+II+ +TILVTFFGY  IHAYE+WSW+PNFAVFLVIIAR
Sbjct: 186 SSQLLNMVNQGHHSCPLWAGCVIIIGATILVTFFGYSYIHAYERWSWVPNFAVFLVIIAR 245

Query: 228 LKIDGSFSSGEWISGTNGAAAVLSFGGVIFGFASGWTTYAADYTVYMPRTTNKPKVFFAV 287
           L + G+FS GEW SG   A  VLSFG  IFGFA+GWT YAADYTVYMPR TNK K+FF++
Sbjct: 246 LHMSGNFSGGEWTSGPTTAGNVLSFGCAIFGFATGWTVYAADYTVYMPRDTNKFKIFFSL 305

Query: 288 IFGLMFPLCFSIILGAAAAMASKNNSEYARLHDSGGVGGLIYAILVNNSLHGFGQFCCVL 347
           + GL FPL F +ILGAA+AM + NN  +   + + G+GG+ YAILV +SLHGFG+FCCVL
Sbjct: 306 VGGLSFPLFFCLILGAASAMGAVNNPTWNDYYQNNGMGGVTYAILVPDSLHGFGEFCCVL 365

Query: 348 LAMSTVANNIPNMYSIALGTQALWEPLAKIPRVFWTMAGNLVTLAIAIPAYYKFNSFMTN 407
           LA+ST+ANNIPNMYSI L  QA+WEPLAK+PR  WT+AGN  TLAI+IPA Y F+ FM +
Sbjct: 366 LALSTIANNIPNMYSIGLAVQAIWEPLAKVPRAIWTLAGNAATLAISIPACYYFDGFMED 425

Query: 408 FMDAIAYYLSIYIGISLSEHLFFRKMNFRNYNVDDWNKWDKLPIGYXXXXXXXXXXXXXX 467
           FM++I YYL+IY   +L+EH  FR+  F+ YNV+DW+   KLP+G               
Sbjct: 426 FMNSIGYYLAIYSATALAEHFIFRR-GFKGYNVEDWDDNSKLPMGIAGCAALFVGAFGVA 484

Query: 468 XXMEQTYWTGQIARKIGDYGADIGFEIGFCFSVIVYNILRPL 509
             M QTYW G+IAR IG+YG DIGFE+G  ++ +VY ILRPL
Sbjct: 485 LGMSQTYWVGEIARHIGEYGGDIGFELGAGWAFVVYVILRPL 526

>YER060W-A (FCY22) [1491] chr5 (276570..278162) Purine/cytosine
           permease with similarity to Fcy2p, member of the
           purine/cytosine subfamily of the nucleobase:cation
           symporter-1 (NCS1) family [1593 bp, 530 aa]
          Length = 530

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/515 (58%), Positives = 382/515 (74%), Gaps = 7/515 (1%)

Query: 1   MSLQKEEYEIQDVEK-RLNSRFEISDD--DSQPVVESTEY--TKLSIVDRIAASLRAETK 55
           + ++    E++D+E   L+++   +D   +   +  + E+   K S  +RIAA+L AETK
Sbjct: 10  VDIKDAGSELRDLESGALDTKSSAADVYYEGVELHRTNEFIDNKPSFFNRIAAALNAETK 69

Query: 56  GIEPVTEEEKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLAVVLFSALG 115
           GIEPVTE+EK+DDSI NAA++WFSANMVI A+S+G LGP+V+GLNF   VL ++ F+ LG
Sbjct: 70  GIEPVTEDEKNDDSILNAATIWFSANMVIVAYSVGALGPLVFGLNFGQSVLVIIFFNILG 129

Query: 116 VIPVAYYSVFGAELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIASAQLLHMI 175
           +IPVA +S+FG ELGLRQM+LSR+L GN+TAR F+L+N+IACVGW  +N   SAQLL+M+
Sbjct: 130 LIPVALFSLFGVELGLRQMILSRYLAGNITARFFSLVNVIACVGWCVLNISVSAQLLNMV 189

Query: 176 NPG-GARCPPWAGCLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVIIARLKIDGSF 234
           N G G  CP WAGCLII   T+LVTFFGY V+HAYEKWSW+PNFA FLVIIA+L   G F
Sbjct: 190 NEGSGHNCPIWAGCLIIAGGTVLVTFFGYSVVHAYEKWSWVPNFAAFLVIIAQLSRSGKF 249

Query: 235 SSGEWISGTNGAAAVLSFGGVIFGFASGWTTYAADYTVYMPRTTNKPKVFFAVIFGLMFP 294
             GEW+ G   A  VLSFG  +FG A+GW TYAADYTVYMP+TT+K K+FF+V+ GL FP
Sbjct: 250 KGGEWVGGATTAGGVLSFGSSVFGSAAGWATYAADYTVYMPKTTSKYKIFFSVVAGLAFP 309

Query: 295 LCFSIILGAAAAMASKNNSEYARLHDSGGVGGLIYAILVNNSLHGFGQFCCVLLAMSTVA 354
           L F++ILGAA  MA+ N+  +   +D   +GG+IYAILV NSL+GFGQFCCVLLA+STVA
Sbjct: 310 LFFTMILGAACGMAALNDPTWKSYYDKNAMGGVIYAILVPNSLNGFGQFCCVLLALSTVA 369

Query: 355 NNIPNMYSIALGTQALWEPLAKIPRVFWTMAGNLVTLAIAIPAYYKFNSFMTNFMDAIAY 414
           NN+P MY++AL  QALW PLAKIPRV WTMAGN  TL I+IPA Y F+ FM NFMD+I Y
Sbjct: 370 NNVPGMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFMENFMDSIGY 429

Query: 415 YLSIYIGISLSEHLFFRKMNFRNYNVDDWNKWDKLPIGYXXXXXXXXXXXXXXXXMEQTY 474
           YL+IYI I+ SEH  +R+ +F  YN+DDW+ W+ LPIG                 M QTY
Sbjct: 430 YLAIYIAIACSEHFIYRR-SFSAYNIDDWDNWEHLPIGIAGTAALIAGAFGVALGMCQTY 488

Query: 475 WTGQIARKIGDYGADIGFEIGFCFSVIVYNILRPL 509
           W G+I+R IG+YG DIGFE+G  ++ I+YNI+RPL
Sbjct: 489 WVGEISRLIGEYGGDIGFELGGSWAFIIYNIVRPL 523

>ADL074W [1667] [Homologous to ScYER056C (FCY2) - SH]
           complement(551981..553555) [1575 bp, 524 aa]
          Length = 524

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/509 (59%), Positives = 365/509 (71%), Gaps = 5/509 (0%)

Query: 1   MSLQKEEYEIQDVEKRLNSRFEISDDDSQPVVESTEYTKLSIVDRIAASLRAETKGIEPV 60
           MSL K++    D+EK+       +++   P V+ TEYT LS V+R AA L AETKG+ PV
Sbjct: 14  MSLTKDDGSYGDLEKK-KGFLSDAEEPVTPQVDETEYTTLSWVNRWAARLNAETKGVSPV 72

Query: 61  TEEEKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLAVVLFSALGVIPVA 120
           TE+E  D S+ NAASMWFSAN+VIAAF++GVL   V+ LN    VLA V+FS +GV+ VA
Sbjct: 73  TEDECHDSSLLNAASMWFSANLVIAAFAVGVLSTAVFRLNMLEAVLATVVFSFMGVLAVA 132

Query: 121 YYSVFGAELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIASAQLLHMINPGGA 180
           ++SVFGAE GLRQM+LSR+L+GN TARIF LIN+IACVGW +VNTIAS  LLHMINP GA
Sbjct: 133 FFSVFGAEFGLRQMILSRYLMGNTTARIFCLINVIACVGWSSVNTIASTTLLHMINPTGA 192

Query: 181 RCPPWAGCLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVIIARLKIDGSFSSGEWI 240
           RCPPWA  LIIVLST+ +TFFGYRVIHAYEKWSW+PN  VFL+IIARL I G+F++G  +
Sbjct: 193 RCPPWAASLIIVLSTVFITFFGYRVIHAYEKWSWVPNLVVFLIIIARLAIAGNFTAGSSL 252

Query: 241 SGTNGAAAVLSFGGVIFGFASGWTTYAADYTVYMPRTTNKPKVFFAVIFGLMFPLCFSII 300
            G   A + LS+G V+FGFASGWTTYAADYTVYMP+ +NK ++FF +I GL  PL F++I
Sbjct: 253 GGKATAGSFLSYGSVVFGFASGWTTYAADYTVYMPKNSNKYRIFFFMIAGLATPLLFTLI 312

Query: 301 LGAAAAMASKNNSEYARLHDSGGVGGLIYAILVNNSLHGFGQFCCVLLAMSTVANNIPNM 360
           LGAAA      N  +   +    VGGL +AIL  N+L GFGQFCCV+LAMSTVANNIPNM
Sbjct: 313 LGAAAGRCVHTNPTWGEYYKKHSVGGLCFAILAENALGGFGQFCCVVLAMSTVANNIPNM 372

Query: 361 YSIALGTQALWEPLAKIPRVFWTMAGNLVTLAIAIPAYYKFNSFMTNFMDAIAYYLSIYI 420
           YSIAL TQALW   A++PRVFWT+ GN  +L IAI AYYKF +FMT+FMD+I YYLSIYI
Sbjct: 373 YSIALSTQALWSRFARVPRVFWTLVGNACSLVIAIVAYYKFETFMTSFMDSIGYYLSIYI 432

Query: 421 GISLSEHLFFRKMNFRNYNVDDWNKWDKLPIGYXXXXXXXXXXXXXXXXMEQTYWTGQIA 480
            I ++EH  FRK  FR Y+V  W++ D LP GY                M   Y+TG IA
Sbjct: 433 VICVTEHFVFRK-GFRGYDVSHWDRPDLLPAGYAGCAALCVGAVGVAMGMSHEYYTGPIA 491

Query: 481 RKIGDYGADIGFEIGFCFSVIVYNILRPL 509
           +     G DIGF +   FS IVY   RPL
Sbjct: 492 KLA---GGDIGFLLAAGFSFIVYICCRPL 517

>Scas_715.47d1
          Length = 523

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/511 (52%), Positives = 351/511 (68%), Gaps = 4/511 (0%)

Query: 2   SLQKEEYEIQD---VEKRLNSRFEISDDDSQPVVESTEYTKLSIVDRIAASLRAETKGIE 58
           S +  + E QD   V     S     +DD    V S+E + ++ + +IA  L AET+GIE
Sbjct: 7   SFKTTDLEKQDPAFVANEAISNDTTGEDDFSKTV-SSEASNIAFLQKIATRLNAETRGIE 65

Query: 59  PVTEEEKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLAVVLFSALGVIP 118
           PV ++EK D +IWN   +WFSAN VI+A+++G LGP+V+GLNF    L +V F+ +GV+P
Sbjct: 66  PVRDDEKTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFNIIGVVP 125

Query: 119 VAYYSVFGAELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIASAQLLHMINPG 178
           VAY+S+FG ELGLRQMVLSR+L+GN+  R F+ IN IACVGW  +N+I SAQLL+M+N  
Sbjct: 126 VAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLLNMVNLH 185

Query: 179 GARCPPWAGCLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVIIARLKIDGSFSSGE 238
           G RCP WAG +++VL TILVTFFG +VI A+E+WSW+PN AVFLVIIARL   G FS G+
Sbjct: 186 GHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVIIARLHKSGQFSGGK 245

Query: 239 WISGTNGAAAVLSFGGVIFGFASGWTTYAADYTVYMPRTTNKPKVFFAVIFGLMFPLCFS 298
           W SG   A  VLS G V +G+A  W TY+ADYTVYMPR TNK K+FF +   L  PLCF+
Sbjct: 246 WTSGPTTAGNVLSLGCVAYGYAGAWATYSADYTVYMPRNTNKVKLFFGLCVALTVPLCFT 305

Query: 299 IILGAAAAMASKNNSEYARLHDSGGVGGLIYAILVNNSLHGFGQFCCVLLAMSTVANNIP 358
           +ILGAA  M   NN+ +A+ + S G+GGL Y +LV NS+HGFG+FCCVLLA+ST+ANN P
Sbjct: 306 MILGAAVGMGGVNNATWAKYYSSNGIGGLTYEVLVPNSVHGFGEFCCVLLALSTIANNTP 365

Query: 359 NMYSIALGTQALWEPLAKIPRVFWTMAGNLVTLAIAIPAYYKFNSFMTNFMDAIAYYLSI 418
           NMY++    QA+WEPLA++PR F T+ GN     +   A Y F+SFM  FMD +AYY +I
Sbjct: 366 NMYTLGFSFQAIWEPLARVPRAFCTLFGNAAVFVVGCCACYYFDSFMEKFMDTLAYYGAI 425

Query: 419 YIGISLSEHLFFRKMNFRNYNVDDWNKWDKLPIGYXXXXXXXXXXXXXXXXMEQTYWTGQ 478
           YI + ++EHL FRK +F+ Y+V DW  + KLPIG                 M Q+YW G+
Sbjct: 426 YISLGMAEHLIFRKCSFKAYDVKDWKTFSKLPIGIAGGVGFFVAAFGVALGMCQSYWVGE 485

Query: 479 IARKIGDYGADIGFEIGFCFSVIVYNILRPL 509
           I R+IG  G D+GFE+G  +  I Y ++RPL
Sbjct: 486 IGRRIGKDGGDVGFEMGAAWGFIAYVLVRPL 516

>CAGL0C00231g 15916..17538 similar to sp|P40039 Saccharomyces
           cerevisiae YER060w or sp|P17064 Saccharomyces cerevisiae
           YER056c, hypothetical start
          Length = 540

 Score =  531 bits (1367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/506 (51%), Positives = 355/506 (70%), Gaps = 3/506 (0%)

Query: 4   QKEEYEIQDVEKRLNSRFEISDDDSQPVVESTEYTKLSIVDRIAASLRAETKGIEPVTEE 63
             E+ E++D+  +   +F   D+ S    +     K   +  +  +L AETKG+EP+ E 
Sbjct: 31  HYEDLELKDITFK--EKFNELDNKSTETDKDETCFKSPFIIWLKRTLNAETKGVEPINEN 88

Query: 64  EKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLAVVLFSALGVIPVAYYS 123
           EK+D +I+ ++ +WFSAN+V+AA+ +G LGP V+ LNF   VL +V F+ LG++ V+++S
Sbjct: 89  EKNDTNIFGSSFVWFSANLVLAAYGVGSLGPTVYHLNFAISVLTIVFFNILGLVSVSFFS 148

Query: 124 VFGAELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIASAQLLHMINPGGARCP 183
           VFGAELGLRQM++SR+L+GNVTARIFA +N I CVGW  +N   +A+L  +I  GG   P
Sbjct: 149 VFGAELGLRQMIISRYLVGNVTARIFAALNCIGCVGWDVLNIYLAAKLFAIIKTGGNHLP 208

Query: 184 PWAGCLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVIIARLKIDGSFSSGEWISGT 243
            W GC++IV ST+ +   GY+ IH YEKWSWIPN AVFL+II+R+KI   FS+G W SG+
Sbjct: 209 LWGGCIVIVGSTVFIAALGYKFIHIYEKWSWIPNLAVFLIIISRIKISREFSNGPWTSGS 268

Query: 244 NGAAAVLSFGGVIFGFASGWTTYAADYTVYMPRTTNKPKVFFAVIFGLMFPLCFSIILGA 303
             A  VLSFG  IFG A+GW TY+ADYTVYMPR TNK ++FF    GL F L F++I+GA
Sbjct: 269 TTAGNVLSFGSAIFGSAAGWVTYSADYTVYMPRRTNKFRIFFFNSIGLAFSLIFTMIVGA 328

Query: 304 AAAMASKNNSEYARLHDSGGVGGLIYAILVNNSLHGFGQFCCVLLAMSTVANNIPNMYSI 363
           AA + + NNS++  L++   +GG+ YA+LV NSLHGFG+FCCV+LAMSTVANN+P+MY+I
Sbjct: 329 AAGICAVNNSKWMELYNEFQIGGVTYALLVPNSLHGFGKFCCVILAMSTVANNVPSMYTI 388

Query: 364 ALGTQALWEPLAKIPRVFWTMAGNLVTLAIAIPAYYKFNSFMTNFMDAIAYYLSIYIGIS 423
           AL  QALWEPL  +PR  WT+  N+V L I+IPA Y F SFM NFM +I Y+ ++YIGIS
Sbjct: 389 ALSVQALWEPLTSVPRAIWTIFANIVVLGISIPACYFFQSFMQNFMGSIGYFYALYIGIS 448

Query: 424 LSEHLFFRKMNFRNYNVDDWNKWDKLPIGYXXXXXXXXXXXXXXXXMEQTYWTGQIARKI 483
           L+EH  FR+  F NYNV+D + W+KLPIG+                M QTYW G+IARKI
Sbjct: 449 LAEHCVFRR-KFGNYNVNDHSNWEKLPIGFAGCIALIVGSFGVALGMAQTYWVGEIARKI 507

Query: 484 GDYGADIGFEIGFCFSVIVYNILRPL 509
           G YG DIGFE+G  ++ + Y I+RP+
Sbjct: 508 GTYGGDIGFELGMSWAFLTYIIIRPI 533

>Scas_715.54d
          Length = 232

 Score =  251 bits (640), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 123/226 (54%), Positives = 164/226 (72%), Gaps = 4/226 (1%)

Query: 2   SLQKEEYEIQD---VEKRLNSRFEISDDDSQPVVESTEYTKLSIVDRIAASLRAETKGIE 58
           S +  + E QD   V     S    S+DD    V S+E + ++ + +IA  L AET+GIE
Sbjct: 8   SFKTTDLEKQDPAFVANEAISNDTTSEDDFSKTV-SSEASNIAFLQKIATRLNAETRGIE 66

Query: 59  PVTEEEKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLAVVLFSALGVIP 118
           PV ++EK D +IWN   +WFSAN VI+A+++G LGP+V+GLNF    L +V F+ +GV+P
Sbjct: 67  PVRDDEKTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTIVFFNIIGVVP 126

Query: 119 VAYYSVFGAELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIASAQLLHMINPG 178
           VAY+S+FG ELGLRQMVLSR+L+GN+  R F+ IN IACVGW  +N+I SAQLL+M+N  
Sbjct: 127 VAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICSAQLLNMVNLH 186

Query: 179 GARCPPWAGCLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVI 224
           G RCP WAG +++VL TILVTFFG +VI A+E+WSW+PN AVFLVI
Sbjct: 187 GHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVI 232

>Kwal_47.17216
          Length = 542

 Score =  206 bits (525), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 149/538 (27%), Positives = 240/538 (44%), Gaps = 45/538 (8%)

Query: 9   EIQDVEKRLNSRFEISDDDSQPVVESTEYTKLSIVDRIAASLRAETKGIEPVTEEEK-DD 67
           E + V+  + S  E S  +    V      KLS+  +   +L  E +GI+ +   E+   
Sbjct: 2   EPEKVDDVVFSETEKSRGEGNQTVFGKVLNKLSVASKRLDALGVEIRGIQRIPAYERGTS 61

Query: 68  DSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLAVVLFSALGVIPVAYYSVFGA 127
               + A +W SA   +++ S   LGP+++ L F   +++ ++  A+G    AY S  G 
Sbjct: 62  KQFLSVAGLWLSAAGGLSSMSSYFLGPLLFELTFRQSLVSGLVSMAIGCAVAAYLSTMGP 121

Query: 128 ELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIASAQLLHMINPGGARCPPWAG 187
           + G RQMV +R+L G    +  +L +II  +GW  VN +   Q+L  I+   ++ P W G
Sbjct: 122 QSGCRQMVTARYLFGWYFVKFVSLASIIGVMGWSIVNCVVGGQMLAAIS--NSKIPLWVG 179

Query: 188 CLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVII----ARLKIDGSFSSGEWISGT 243
            +I+   + +V  FG + +   E +  +P    FL++      +  +  +F + + I   
Sbjct: 180 IIIVTAVSFIVAIFGIKQVLRVETFLSVPVLTCFLLLYIAASDKYYLLDTFKNDD-IDPL 238

Query: 244 NGAAAVLSFGGVIFGFASGWTTYAADYTVYMPRTTNKPKVFFAVIFGLMFPLCFSIILGA 303
                 LSF  + +   S W +  ADY +  P  T   KVF    FG + P  F  +LG 
Sbjct: 239 TIKGNWLSFFSLCYSITSTWGSITADYYILFPEDTAHYKVFLLTFFGTLIPTTFVGVLGL 298

Query: 304 AAAMASKNNSEYARLHDSGGVGGLIYAILVNNSLHGFGQFCCVLLAMSTVANNIPNMYSI 363
             A  + +   +   +   G+GGL+++       +GFG+FC V+L  S ++NNI N YS 
Sbjct: 299 ILASCAASYEPWKAAYHKYGMGGLLFSGF--ERWNGFGKFCVVVLIFSLISNNIINTYSA 356

Query: 364 ALGTQALWEPLAKIPRVFWTMAGNLVTLAIAIPAYYKFNSFMTNFMDAIAYYLSIYIGIS 423
           A   Q     +A++PR  W +A  +  L  A+     F+  + NF+  I Y++S+Y  I 
Sbjct: 357 AFNIQLSSVHMARVPRWLWAIACTIFYLVCALVGRNHFSEILGNFLPMIGYWISMYFIIL 416

Query: 424 LSEHLFFRKMNFRN----------------------------------YNVDDWNKWDKL 449
           L E+L FR  +FR+                                  YN + WN  + L
Sbjct: 417 LEENLIFRS-HFRHLYTEEFPPHPVEEGESPRALRDIKNKKVSSRKHAYNWEMWNNAEVL 475

Query: 450 PIGYXXXXXXXXXXXXXXXXMEQTYWTGQIARKIGDYGADIGFEIGFCFSVIVYNILR 507
             GY                M Q YW G IAR  GD+G D+G  +   FS  VY  LR
Sbjct: 476 THGYAATFAFLVGVGGVALSMAQAYWIGPIARHFGDFGGDLGMWVSMGFSGTVYPALR 533

>KLLA0D05060g 436335..437906 similar to sp|P53099 Saccharomyces
           cerevisiae YGL186c, hypothetical start
          Length = 523

 Score =  206 bits (523), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 149/516 (28%), Positives = 241/516 (46%), Gaps = 46/516 (8%)

Query: 33  ESTEYTKLSIVDRIAASLR----------AETKGIEPVTEEEKDD-DSIWNAASMWFSAN 81
              E T+ SI  R A+S+R           E +GI+ +   E+      W+ A +W SA 
Sbjct: 4   SEVEVTERSIFVRSASSIRQFSDKLDALGVEARGIQRIQPYERGTAKQFWHVAGLWLSAA 63

Query: 82  MVIAAFSLGVLGPVVWGLNFWGCVLAVVLFSALGVIPVAYYSVFGAELGLRQMVLSRFLL 141
             +++ S   LGP+V+ L F  C+++ ++   +G    AY SV G + G RQ+V +R+L 
Sbjct: 64  GGLSSMSSYFLGPMVFQLTFNQCLVSGLISMWIGCGVAAYCSVMGPQSGCRQIVTARYLF 123

Query: 142 GNVTARIFALINIIACVGWGAVNTIASAQLLHMINPGGARCPPWAGCLIIVLSTILVTFF 201
           G    +  AL  I+  +GW  VN +   Q+L  ++ G  + P W G +I+ + ++LV+ F
Sbjct: 124 GWWFVKFIALAAIVGVMGWSIVNCVVGGQMLASVSDG--KVPLWVGIIIVTVVSLLVSIF 181

Query: 202 GYRVIHAYEKWSWIPNFAVFLVIIA----RLKIDGSFSSGEWISGTNGAAAVLSFGGVIF 257
           G + +   E    +P    FL++      + K    FS+ + I         LSF  + +
Sbjct: 182 GIKQVLKVETLFAVPVLTSFLLLYISASDKFKYLYEFSNSD-IDSLTVKGCWLSFFSLCY 240

Query: 258 GFASGWTTYAADYTVYMPRTTNKPKVFFAVIFGLMFPLCFSIILGAAAAMASKNNSEYAR 317
              S W +  ADY +  P  T + +VF    FG   P  F  +LG   A  S +   +  
Sbjct: 241 SITSTWGSITADYYILFPEDTPQIQVFLLTFFGTAVPTTFVGVLGLLLASCSLSYEPWQA 300

Query: 318 LHDSGGVGGLIYAILVNNSLHGFGQFCCVLLAMSTVANNIPNMYSIALGTQALWEPLAKI 377
            +D  G+GGL+ A    +  +GFG+F  V+L +S ++NNI N YS A   Q     LAK+
Sbjct: 301 AYDEYGMGGLMNAGF--SRWNGFGKFLVVVLILSLISNNIVNTYSAAFSIQLSSVMLAKV 358

Query: 378 PRVFWTMAGNLVTLAIAIPAYYKFNSFMTNFMDAIAYYLSIYIGISLSEHLFFR------ 431
           PR  W +   +  L  A+     F++ + NF+  I Y++S+Y  + + E++ FR      
Sbjct: 359 PRWIWAIGCTIFYLVCALVGRNSFSTILGNFLPMIGYWISMYFILLVEENVIFRNWFHHL 418

Query: 432 -KMNFRN-------------------YNVDDWNKWDKLPIGYXXXXXXXXXXXXXXXXME 471
            K+ F N                   YN D+W+  + +  G                 M 
Sbjct: 419 YKLEFPNDIEVKPHHKLRKLPRHIHRYNWDEWDNSEVITRGLAASAAFCIGVAGVVLGMC 478

Query: 472 QTYWTGQIARKIGDYGADIGFEIGFCFSVIVYNILR 507
           QTY+ G +A KIG+YG D+G  +G  F+ + Y  LR
Sbjct: 479 QTYYVGPLAAKIGEYGGDLGMWLGMGFAGVSYPPLR 514

>YGL186C (TPN1) [1806] chr7 complement(151041..152780) Member of the
           purine/cytosine permease family of membrane transporters
           [1740 bp, 579 aa]
          Length = 579

 Score =  189 bits (480), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 151/565 (26%), Positives = 248/565 (43%), Gaps = 77/565 (13%)

Query: 6   EEYEIQDVEKRLNSRFEISDDDSQPVVESTEYTKLSIVDRIAASLRAETKGIEPVTEEEK 65
           E YE       LN   E    +S P +      + + + +   ++  E+ GI+ ++  E+
Sbjct: 24  EFYEEGTAASSLNIATE--KANSSPSILRRIINRAAWLSKKVDAMGVESTGIQRISPYER 81

Query: 66  --DDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLAVVLFSALGVIPVAYYS 123
                   + A +W SA   +++ S  +LGP+++GL+F   V + ++   +G +  AY S
Sbjct: 82  GTSKKQFLHVAGLWLSATGGLSSMSSFLLGPLLFGLSFRESVASSLISVTIGCLIAAYCS 141

Query: 124 VFGAELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIASAQLLHMINPGGARCP 183
           + G + G RQMV +R+L G    ++ AL +II  +GW  VN++   ++L  I+    + P
Sbjct: 142 IMGPQSGCRQMVTARYLFGWWFVKLVALASIIGVMGWSVVNSVVGGEMLAAIS--NDKVP 199

Query: 184 PWAGCLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVI--------------IARLK 229
            W G +I+ + + LV  FG + +   E +  +P    FL++              +++  
Sbjct: 200 LWVGIVIVTVCSFLVAIFGIKQVIKVETYLSVPVLTAFLLLYISSSDKYSFVNAYVSKGN 259

Query: 230 IDGSFSSGEWISGTNGAAAVLSFGGVIFGFASGWTTYAADYTVYMPRTTNKPKVFFAVIF 289
           +D S   G W          +SF  + +   + W +  ADY +  P  T   ++F    F
Sbjct: 260 LDSSTRKGNW----------MSFFSLCYSITATWGSITADYYILFPEDTPYIQIFCLTFF 309

Query: 290 GLMFPLCFSIILGAAAAMASKNNSEYARLHDSGGVGGLIYAILVNNSLHGFGQFCCVLLA 349
           G   P CF  ILG   A  + +   ++  +DS G+GGL++A       +GFG+FC V+L 
Sbjct: 310 GTFLPTCFVGILGLLLASVAMSYKPWSVEYDSHGMGGLLWAGF--QRWNGFGKFCVVVLV 367

Query: 350 MSTVANNIPNMYSIALGTQALWEPLAKIPRVFWTMAGNLVTLAIAIPAYYKFNSFMTNFM 409
            S V+NNI N YS A   Q      AKIPR FW++   ++ L  A+     F++ + NF+
Sbjct: 368 FSLVSNNIINTYSAAFSIQLSSVFCAKIPRWFWSIVCTIICLVCALIGRNHFSTILGNFL 427

Query: 410 DAIAYYLSIYIGISLSEHLFFR-------------------------------------- 431
             I Y++S+Y  +   E+L FR                                      
Sbjct: 428 PMIGYWISMYFILLFEENLVFRRFFLHLYTKEFPTVTGEINGPELVGSSKEVEKDAVTNI 487

Query: 432 -------KMNFRNYNVDDWNKWDKLPIGYXXXXXXXXXXXXXXXXMEQTYWTGQIARKIG 484
                  K+    YN D W  ++ L  GY                M Q YW G IA K G
Sbjct: 488 HLLKRKHKVTKHRYNWDKWEDYEVLTHGYAATFAFIVGVAGVVVGMAQAYWIGPIAAKFG 547

Query: 485 DYGADIGFEIGFCFSVIVYNILRPL 509
           +YG D+   +   FS +VY   R L
Sbjct: 548 EYGGDVAMWLSMAFSGVVYPPCRYL 572

>CAGL0L06138g 695566..697461 similar to sp|P53099 Saccharomyces
           cerevisiae YGL186c, start by similarity
          Length = 631

 Score =  179 bits (455), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 127/451 (28%), Positives = 212/451 (47%), Gaps = 36/451 (7%)

Query: 2   SLQKEEYEIQDVEKRLNSR----FEISDDDSQPVVESTEYTKLSIVDRIAASLRAETKGI 57
            L+K      D + R N R    F++   D    +       L  +     S   ET GI
Sbjct: 35  DLEKRSTHKTDPDSRTNRRNKKLFDLDRHDPNLNIFMKGLAYLLWLSDKLDSFGVETSGI 94

Query: 58  EPVTEEEK-DDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLAVVLFSALGV 116
           E V   E+       + A +W SA   +++ S  +LGP+++ L+F   + + ++   +G 
Sbjct: 95  ERVPPYERGTKKQFLHVAGLWLSATGGLSSMSSFLLGPLLFELSFQQALTSSMISVTVGC 154

Query: 117 IPVAYYSVFGAELGLRQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIASAQLLHMIN 176
           +  AY S+ G + G RQMV +R+L G    +  AL  II  +GW   N++   ++L  I+
Sbjct: 155 LVAAYCSIMGPQSGCRQMVTARYLFGWWFVKFVALAAIIGVMGWSVTNSVVGGEMLAAIS 214

Query: 177 PGGARCPPWAGCLIIVLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVI---------IAR 227
               R P W G +I+ + + +V  FG + +   E +  +P    FL++         + R
Sbjct: 215 --NDRVPLWVGIVIVTVCSFVVAIFGIKQVLRIETYISVPVLTSFLLLYISSGNRDYLVR 272

Query: 228 ----LKIDGSFSSGEWISGTNGAAAVLSFGGVIFGFASGWTTYAADYTVYMPRTTNKPKV 283
               + +      G WIS          F  + +   S W +  ADY +  P  T   +V
Sbjct: 273 EYKPIDVPSKTIKGNWIS----------FFSLCYSITSTWGSITADYYILFPEDTPHYQV 322

Query: 284 FFAVIFGLMFPLCFSIILGAAAAMASKNNSEYARLHDSGGVGGLIYAILVNNSLHGFGQF 343
           F   + G + P  F  ILG   A  +K+   Y   +D+ G+GGL++A    +  +GFG+F
Sbjct: 323 FLLTLAGTLIPTTFVGILGLTLASIAKSYQPYGEEYDTHGMGGLLWAGF--SRWNGFGKF 380

Query: 344 CCVLLAMSTVANNIPNMYSIALGTQ--ALWEPLAKIPRVFWTMAGNLVTLAIAIPAYYKF 401
             V+L +S ++NNI N YS A G Q  A+W   A++PR FW +   +V L  A+     F
Sbjct: 381 LVVVLILSLISNNIINTYSAAFGIQLSAVWA--ARVPRWFWCIVCTIVYLVCALVGRNHF 438

Query: 402 NSFMTNFMDAIAYYLSIYIGISLSEHLFFRK 432
            + + NF+  I Y++S+Y  +   E++ FR+
Sbjct: 439 ATILGNFLPMIGYWISMYFILLFEENVIFRR 469

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 37/84 (44%), Gaps = 3/84 (3%)

Query: 427 HLFFRKM--NFRNYNVDDWNKWDKLPIGYXXXXXXXXXXXXXXXXMEQTYWTGQIARKI- 483
           H   RK       YN D+W+  D L  GY                M QTYW G IARK+ 
Sbjct: 539 HTLKRKHIHTKHRYNWDEWDNPDVLTHGYAATFAFLCGVAGVVVGMAQTYWVGPIARKLG 598

Query: 484 GDYGADIGFEIGFCFSVIVYNILR 507
           G YG DI   +   FS IVY  LR
Sbjct: 599 GPYGGDIAMWLSMGFSGIVYPWLR 622

>Scas_710.30
          Length = 584

 Score =  160 bits (406), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 124/454 (27%), Positives = 222/454 (48%), Gaps = 35/454 (7%)

Query: 19  SRFEISDDDSQPVVESTEYTKL-----SIVDRIAASLRAETKGIEPVTEEEK--DDDSIW 71
            + E+++ +   V +S  Y +      +++ +   SL  E  GIE ++  E+        
Sbjct: 7   EKIEVAETEFTTVKKSPSYLRRLLHTANLLSKKLDSLGVEATGIERISPYERGSKRKQFI 66

Query: 72  NAASMWFSANMVIAAFSLGVLGPVVWGLNFWGCVLAVVLFSALGVIPVAYYSVFGAELGL 131
           + A  W +A   +++ S  +LGP+++GL F   +++ ++  A+G +  AY S+ G + G 
Sbjct: 67  HVAGYWLAATGSLSSMSSFLLGPLLFGLTFNESMVSGIVSMAIGCLVAAYCSIMGPQSGC 126

Query: 132 RQMVLSRFLLGNVTARIFALINIIACVGWGAVNTIASAQLLHMINPGGARCPPWAGCLII 191
           RQMV +R+L G    +  AL  II  +GW  VN++   ++L  I+    + P W G LI+
Sbjct: 127 RQMVTARYLFGWWFVKFVALAAIIGVMGWSVVNSVVGGEMLASIS--NDKVPLWVGVLIV 184

Query: 192 VLSTILVTFFGYRVIHAYEKWSWIPNFAVFLVII----ARLKIDGSFSS---------GE 238
            L + LV  FG + +   E +  IP + +F+++      +      F S         G 
Sbjct: 185 TLFSFLVAVFGIKQVLKVETYLSIPVWLMFILLYISSSDKYHYIDDFKSPIPDRLTLKGN 244

Query: 239 WISGTNGAAAVLSFGGVIFGFASGWTTYAADYTVYMPRTTNKPKVFFAVIFGLMFPLCFS 298
           W          LSF  + +   + W +  ADY +  P  T+K +VF     G + P  F 
Sbjct: 245 W----------LSFFSLCYSITATWGSITADYYILFPEDTSKFQVFMLTFLGTVVPTLFV 294

Query: 299 IILGAAAAMASKNNSEYARLHDSGGVGGLIYAILVNNSLHGFGQFCCVLLAMSTVANNIP 358
            +LG   +  +     +   ++  G+GGL++A       +GFG+FC V+L +S ++NNI 
Sbjct: 295 GVLGLCLSTVAATYEPWNDDYNKYGMGGLLHAGF--KRWNGFGKFCVVVLLLSLISNNII 352

Query: 359 NMYSIALGTQALWEPLAKIPRVFWTMAGNLVTLAIAIPAYYKFNSFMTNFMDAIAYYLSI 418
           N YS A   Q      AK+PR FW++   ++ L  A+     F++ + NF+  I Y++S+
Sbjct: 353 NTYSAAFSVQLASVKAAKVPRWFWSIVCMIICLVCALVGRNHFSTILGNFLPMIGYWISM 412

Query: 419 YIGISLSEHLFFRKMNFRNYNVDDWNKWDKLPIG 452
           Y  + L E++ FR+  F +    ++ ++DK   G
Sbjct: 413 YFILLLEENVIFREY-FHHLYYKEFPEFDKSKSG 445

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 37/84 (44%), Gaps = 4/84 (4%)

Query: 427 HLFFRKMNFRNYNVDDWNKWDK---LPIGYXXXXXXXXXXXXXXXXMEQTYWTGQIARKI 483
           HL  R+ +    +  +WNKWD    L  GY                M Q YW G +ARK 
Sbjct: 493 HLLKRR-HLATSHKYNWNKWDDPEVLTHGYAATFAFLCGVAGVVVGMAQAYWIGPLARKF 551

Query: 484 GDYGADIGFEIGFCFSVIVYNILR 507
           G+ G DI   +   FS +VY  LR
Sbjct: 552 GETGGDIAMWLSMAFSGLVYPPLR 575

>Scas_701.1
          Length = 68

 Score = 50.1 bits (118), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 32/61 (52%)

Query: 449 LPIGYXXXXXXXXXXXXXXXXMEQTYWTGQIARKIGDYGADIGFEIGFCFSVIVYNILRP 508
           LPIG                 M Q+YW G+I R+IG  G D+GFE+G  +  I Y ++RP
Sbjct: 1   LPIGIAGGVGFFVAAFGVALGMCQSYWVGEIGRRIGKDGGDVGFEMGAAWGFIAYVLVRP 60

Query: 509 L 509
           L
Sbjct: 61  L 61

>Scas_690.1*
          Length = 636

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 28/40 (70%)

Query: 470 MEQTYWTGQIARKIGDYGADIGFEIGFCFSVIVYNILRPL 509
           M Q+YW G+I R+IG  G D+GFE+G  +  I Y ++RPL
Sbjct: 590 MCQSYWVGEIGRRIGKDGGDVGFEMGAAWGFIAYVLVRPL 629

>Kwal_47.18919
          Length = 640

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 50/105 (47%), Gaps = 5/105 (4%)

Query: 42  IVDRIAASLRAETKGIEPVTEEEKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNF 101
           I+ R AA LR ET   + +TE+E    S+    +       V+    L V  PV+  + F
Sbjct: 381 ILKRRAAKLRRETGNPKIMTEQEAQGLSVGEMVNA-----CVLRPLYLAVTEPVLDLMCF 435

Query: 102 WGCVLAVVLFSALGVIPVAYYSVFGAELGLRQMVLSRFLLGNVTA 146
           + C++  +L++     PV +  ++G +  L  ++L   L+G   A
Sbjct: 436 YVCLIYSLLYAFFFAYPVIFGELYGYKDNLIGLMLIPILIGASVA 480

>Scas_640.16
          Length = 505

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 52/130 (40%), Gaps = 14/130 (10%)

Query: 32  VESTEYTKLSIVDRIAASLRAETKGIEPVTEEEKDDDSIWNAASMWFSANMVIAAFSLGV 91
           V+S   T LS+ D  + S        EP++ E KD D +     MW  A+M     SLGV
Sbjct: 158 VDSYYSTLLSVYDEQSHSNVTSPLKDEPLSLEGKDIDQL--DCEMWEKADMKEKIVSLGV 215

Query: 92  LGPVVWG------LNFWGCVLAVVLFSALGVIPVAYYSVFGAELGLRQMVLSRFLLGNVT 145
           LG    G      L     V A+ + + L   P     +F      R++  ++    +  
Sbjct: 216 LGEGAGGSVEKCKLKHGKKVFALKIVNTLNTDPEFQKQIF------RELQFNKSFKSDYI 269

Query: 146 ARIFALINII 155
            R + + N +
Sbjct: 270 VRYYGMFNDV 279

>AGL027W [4284] [Homologous to ScYPR194C (OPT2) - NSH]
           complement(657964..660597) [2634 bp, 877 aa]
          Length = 877

 Score = 33.5 bits (75), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 59/218 (27%), Positives = 85/218 (38%), Gaps = 44/218 (20%)

Query: 102 WGCVLAVVLFSALGVIPVAYYSVFGAELGLR---QMVLSRFLLGNVTARIFALINIIACV 158
           WG  LAV L  A  +      S  GA LGL    QM+    L GN  A     + II   
Sbjct: 580 WGIFLAVGLNVAFLLPLTTLQSTTGASLGLNLLVQMITGYLLPGNPYA-----LMIIKAF 634

Query: 159 GWG----AVNTIASAQLLHMINPGGARCPP---WAGCLIIVLSTILVTFFGYR-VIHAYE 210
           G+     A N +++ ++ H       + PP   + G L +VL  ++V+       IH   
Sbjct: 635 GYNIDGQADNYLSNLKMAHY-----CKIPPVPLFRGQLSMVLLQVIVSLAVINWQIHNVP 689

Query: 211 KWSWIPNFAVFLVIIARLKIDGSFSSGEWISGTNGAAAVLSF--------------GGVI 256
            +    N + F+    R   + S      + G  G   V S+               GV+
Sbjct: 690 DFCNPKNRSGFICQGPRTYYNASI-----VWGIIGPKKVFSYLYPMMKWCWLIGALLGVL 744

Query: 257 FGFASGWTTYAADYTVYMPRTTNKPKVFFAVIFGLMFP 294
           FG   GW   +  Y +Y PR+ N P VF   +  LM P
Sbjct: 745 FG---GWCRLSRKYKLYYPRSFN-PVVFVTGMISLMPP 778

>Scas_676.25
          Length = 634

 Score = 32.3 bits (72), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 49/104 (47%), Gaps = 11/104 (10%)

Query: 42  IVDRIAASLRAETKGIEPVTEEEKDDDSIWNAASMWFSANM---VIAAFSLGVLGPVVWG 98
           I+ R AA LR ET   + +TE+E        A  + F+  M   VI      +  PV++ 
Sbjct: 374 ILKRRAAKLRKETGNPKIMTEQE--------AQGITFNEMMSACVIRPLKFSITEPVLFM 425

Query: 99  LNFWGCVLAVVLFSALGVIPVAYYSVFGAELGLRQMVLSRFLLG 142
             F+ C++  +L++     PV +  ++G +  +  ++    L+G
Sbjct: 426 TCFYVCLIYSLLYAFFFAYPVIFGELYGYKDNMIGLMFIPILIG 469

>KLLA0C01958g complement(157085..157576) no similarity, hypothetical
           start
          Length = 163

 Score = 31.2 bits (69), Expect = 1.0,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 21/42 (50%)

Query: 259 FASGWTTYAADYTVYMPRTTNKPKVFFAVIFGLMFPLCFSII 300
           F  G   + AD +V     +   K FF V+F   FPL FS+I
Sbjct: 29  FLGGARKFTADESVGDDGESFSEKTFFIVVFASAFPLLFSVI 70

>Scas_712.56
          Length = 620

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 48/104 (46%), Gaps = 11/104 (10%)

Query: 42  IVDRIAASLRAETKGIEPVTEEEKDDDSIWNAASMWFSANM---VIAAFSLGVLGPVVWG 98
           I+ R AA LR ET   + +TE+E        A  + F+  M   V+      V  PV+  
Sbjct: 360 ILKRRAAKLRKETGNPKIMTEQE--------AQGITFNEMMTACVVRPLKFSVTEPVLCM 411

Query: 99  LNFWGCVLAVVLFSALGVIPVAYYSVFGAELGLRQMVLSRFLLG 142
             F+ C++  +L++     PV +  ++G +  +  ++    L+G
Sbjct: 412 TCFYVCLIYSLLYAFFFAYPVIFSELYGYKDNIIGLMFIPILIG 455

>YGR138C (TPO2) [2094] chr7 complement(763765..765609) Polyamine
           transport protein, member of the multidrug-resistance
           12-spanner (DHA12) family of the major facilitator
           superfamily (MFS-MDR) [1845 bp, 614 aa]
          Length = 614

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 51/116 (43%), Gaps = 9/116 (7%)

Query: 42  IVDRIAASLRAETKGIEPVTEEEKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNF 101
           I+ R AA LR ET   + +TE+E    S+    S    A ++   +   V  PV+    F
Sbjct: 354 ILKRKAARLRKETGNPKIMTEQEAQGVSM----SEMMRACLLRPLY-FAVTEPVLVATCF 408

Query: 102 WGCVLAVVLFSALGVIPVAYYSVFGAELGLRQMVLSRFLLGNVTARIFALINIIAC 157
           + C++  +L++     PV    +FG   G +  ++    +  V   ++AL     C
Sbjct: 409 YVCLIYSLLYAFFFAFPV----IFGELYGYKDNLVGLMFIPIVIGALWALATTFYC 460

>YPR156C (TPO3) [5571] chr16 complement(837903..839771) Polyamine
           transport protein, member of the multidrug-resistance
           12-spanner (DHA12) family of the major facilitator
           superfamily (MFS-MDR) [1869 bp, 622 aa]
          Length = 622

 Score = 29.6 bits (65), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 51/116 (43%), Gaps = 9/116 (7%)

Query: 42  IVDRIAASLRAETKGIEPVTEEEKDDDSIWNAASMWFSANMVIAAFSLGVLGPVVWGLNF 101
           I+ R AA LR ET   + +TE+E    S+     M  +  +    FS  V  PV+    F
Sbjct: 363 ILKRKAARLRKETGNPKIMTEQEAQGVSM---GEMMRACLLRPLYFS--VTEPVLVATCF 417

Query: 102 WGCVLAVVLFSALGVIPVAYYSVFGAELGLRQMVLSRFLLGNVTARIFALINIIAC 157
           + C++  +L++     PV    +FG   G +  ++    +  V   ++AL     C
Sbjct: 418 YVCLIYSLLYAFFFAFPV----IFGELYGYKDNLVGLMFIPIVIGALWALATTFYC 469

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.140    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,454,089
Number of extensions: 614334
Number of successful extensions: 2346
Number of sequences better than 10.0: 50
Number of HSP's gapped: 2346
Number of HSP's successfully gapped: 54
Length of query: 509
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 403
Effective length of database: 12,926,601
Effective search space: 5209420203
Effective search space used: 5209420203
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)