Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.580746545920730.0
Scas_704.354482047161e-89
ADL075W2071936913e-89
CAGL0M12342g4572196873e-85
KLLA0C08305g4092166694e-83
YIL050W (PCL7)2851996072e-75
Scas_715.513412185503e-66
YER059W (PCL6)4202744849e-56
KLLA0D01287g3451261911e-15
Sklu_2373.43071631713e-13
ACR001C3461511706e-13
CAGL0E02541g3421101681e-12
Kwal_56.224432801241632e-12
Scas_392.13031101591e-11
YOL001W (PHO80)2931261572e-11
YGL134W (PCL10)4331331441e-09
YPL219W (PCL8)4921471405e-09
CAGL0E05918g4811351396e-09
Scas_720.474731311389e-09
Kwal_56.241514801241362e-08
CAGL0H08998g5471101291e-07
KLLA0B02024g5271221272e-07
Scas_706.34511191262e-07
AFL115W3861091155e-06
YNL289W (PCL1)2791161002e-04
Kwal_34.1599623161910.002
CAGL0E02233g266115880.006
Scas_686.2210132860.009
YHR071W (PCL5)22995760.17
Sklu_2426.923361740.35
Scas_646.2323865710.71
AER335W428103701.2
KLLA0B05885g658105682.5
Kwal_55.2169138754682.5
CAGL0G01584g582100656.7
Sklu_2174.463247647.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.5807
         (459 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.5807                                                          803   0.0  
Scas_704.35                                                           280   1e-89
ADL075W [1666] [Homologous to ScYIL050W (PCL7) - SH; ScYER059W (...   270   3e-89
CAGL0M12342g complement(1232642..1234015) weakly similar to sp|P...   269   3e-85
KLLA0C08305g complement(728996..730225) some similarities with s...   262   4e-83
YIL050W (PCL7) [2617] chr9 (258912..259769) Cyclin, associates w...   238   2e-75
Scas_715.51                                                           216   3e-66
YER059W (PCL6) [1489] chr5 (272622..273884) Cyclin that associat...   191   9e-56
KLLA0D01287g 112866..113903 some similarities with sp|P20052 Sac...    78   1e-15
Sklu_2373.4 YOL001W, Contig c2373 11960-12883                          70   3e-13
ACR001C [1049] [Homologous to ScYOL001W (PHO80) - SH] (357962..3...    70   6e-13
CAGL0E02541g 244577..245605 similar to sp|P20052 Saccharomyces c...    69   1e-12
Kwal_56.22443                                                          67   2e-12
Scas_392.1                                                             66   1e-11
YOL001W (PHO80) [4815] chr15 (325249..326130) Cyclin that intera...    65   2e-11
YGL134W (PCL10) [1853] chr7 (255666..256967) Cyclin that associa...    60   1e-09
YPL219W (PCL8) [5230] chr16 (136749..138227) Cyclin that associa...    59   5e-09
CAGL0E05918g complement(585723..587168) some similarities with t...    58   6e-09
Scas_720.47                                                            58   9e-09
Kwal_56.24151                                                          57   2e-08
CAGL0H08998g 877952..879595 weakly similar to tr|Q08966 Saccharo...    54   1e-07
KLLA0B02024g 176585..178168 some similarities with sp|P53124 Sac...    54   2e-07
Scas_706.3                                                             53   2e-07
AFL115W [3080] [Homologous to ScYPL219W (PCL8) - SH; ScYGL134W (...    49   5e-06
YNL289W (PCL1) [4322] chr14 (87895..88734) G1/S-specific cyclin ...    43   2e-04
Kwal_34.15996                                                          40   0.002
CAGL0E02233g 215697..216497 similar to sp|P24867 Saccharomyces c...    39   0.006
Scas_686.2                                                             38   0.009
YHR071W (PCL5) [2359] chr8 (237005..237694) Cyclin that associat...    34   0.17 
Sklu_2426.9 YHR071W, Contig c2426 11461-12162                          33   0.35 
Scas_646.23                                                            32   0.71 
AER335W [2836] [Homologous to ScYMR208W (ERG12) - SH] complement...    32   1.2  
KLLA0B05885g complement(530762..532738) no similarity, hypotheti...    31   2.5  
Kwal_55.21691                                                          31   2.5  
CAGL0G01584g complement(146813..148561) similar to sp|P46678 Sac...    30   6.7  
Sklu_2174.4 YER049W, Contig c2174 3142-5040 reverse complement         29   7.8  

>Kwal_23.5807
          Length = 465

 Score =  803 bits (2073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/459 (87%), Positives = 400/459 (87%)

Query: 1   MPHRPSFLEQVSENGSKSRCQPMVIPRRVSAVLGEGPTXXXXXXXXXXXXXXXXXXXDXX 60
           MPHRPSFLEQVSENGSKSRCQPMVIPRRVSAVLGEGPT                   D  
Sbjct: 1   MPHRPSFLEQVSENGSKSRCQPMVIPRRVSAVLGEGPTSVTEEAISSSHSSESFLQSDGA 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXFQGRSNSVASRMRPSLQRMGSSYSRGSFVGKNGSFVX 120
                                  FQGRSNSVASRMRPSLQRMGSSYSRGSFVGKNGSFV 
Sbjct: 61  GAEAAGAEPAGLAASSAAGGAGLFQGRSNSVASRMRPSLQRMGSSYSRGSFVGKNGSFVS 120

Query: 121 XXXXXXXXXXXXXXHPPATPELIEPPSQVRAVVPSSDSESDAVPGIERADENSDDKETTI 180
                         HPPATPELIEPPSQVRAVVPSSDSESDAVPGIERADENSDDKETTI
Sbjct: 121 TSLSDDCGSSSYSSHPPATPELIEPPSQVRAVVPSSDSESDAVPGIERADENSDDKETTI 180

Query: 181 SSSVPRSSEPINISVPMAKSHSSKYFQESVHEDDYLQQFTPFHNTPTSVSNSYSTHNDRP 240
           SSSVPRSSEPINISVPMAKSHSSKYFQESVHEDDYLQQFTPFHNTPTSVSNSYSTHNDRP
Sbjct: 181 SSSVPRSSEPINISVPMAKSHSSKYFQESVHEDDYLQQFTPFHNTPTSVSNSYSTHNDRP 240

Query: 241 LKQRAPVPNSEPKLSEVPELIQIATFPTDRLLSMLTALLDKIVKSNDQLNRDRPFDEDQF 300
           LKQRAPVPNSEPKLSEVPELIQIATFPTDRLLSMLTALLDKIVKSNDQLNRDRPFDEDQF
Sbjct: 241 LKQRAPVPNSEPKLSEVPELIQIATFPTDRLLSMLTALLDKIVKSNDQLNRDRPFDEDQF 300

Query: 301 LASARTEDADNDTRPNIASEILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFD 360
           LASARTEDADNDTRPNIASEILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFD
Sbjct: 301 LASARTEDADNDTRPNIASEILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFD 360

Query: 361 RIAKTCNHGKEQLFVMDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHL 420
           RIAKTCNHGKEQLFVMDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHL
Sbjct: 361 RIAKTCNHGKEQLFVMDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHL 420

Query: 421 ELQFLVLCDFELIISVEELQKYSDLLRDFWNREVGDATE 459
           ELQFLVLCDFELIISVEELQKYSDLLRDFWNREVGDATE
Sbjct: 421 ELQFLVLCDFELIISVEELQKYSDLLRDFWNREVGDATE 459

>Scas_704.35
          Length = 448

 Score =  280 bits (716), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 156/204 (76%), Gaps = 18/204 (8%)

Query: 259 ELIQIATFPTDRLLSMLTALLDKIVKSNDQLNRDRPFDE--DQFLASARTEDADNDTRPN 316
           E I IA FPT++LL MLTALLDKIVKSND+LN      E  D  L   R+ED  N+    
Sbjct: 222 ESINIAEFPTNKLLEMLTALLDKIVKSNDKLNVSSSNSESIDDIL---RSEDNSNNA--- 275

Query: 317 IASEILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNH-------- 368
               IL+FRGKHVP I+L QYFQRIQKYCPTTNDVFLSLLVYFDRI+K CN+        
Sbjct: 276 YVGSILAFRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDS 335

Query: 369 --GKEQLFVMDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLV 426
              K QLFVMDSYNIHRLII+ VTV TKFFSDFFYSNSRYARVGG+SL+ELNHLELQFLV
Sbjct: 336 PTNKSQLFVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLV 395

Query: 427 LCDFELIISVEELQKYSDLLRDFW 450
           LCDFEL+I  EELQ+Y+DLL  FW
Sbjct: 396 LCDFELMIPTEELQRYADLLSRFW 419

>ADL075W [1666] [Homologous to ScYIL050W (PCL7) - SH; ScYER059W
           (PCL6) - SH] complement(550944..551567) [624 bp, 207 aa]
          Length = 207

 Score =  270 bits (691), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 153/193 (79%), Gaps = 14/193 (7%)

Query: 261 IQIATFPTDRLLSMLTALLDKIVKSNDQLNRDRPFDEDQFLASARTEDADNDTRPNIASE 320
           + IA FPTD+LL MLT LL KI+KSND+L   +PFD+++           +D      + 
Sbjct: 16  MDIAQFPTDKLLEMLTGLLYKIIKSNDRL---KPFDQEK-----------HDINNKYVAH 61

Query: 321 ILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKEQLFVMDSYN 380
           +LSFRGKH+P ITL  YF RIQKYCP TNDVFLSLLVYFDRIAK CN    QLFVMDSYN
Sbjct: 62  VLSFRGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYN 121

Query: 381 IHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELIISVEELQ 440
           IHRLII+AVTVSTKFFSDFFYSNSRYARVGGISL+ELN LELQF +LCDFELI+S++ELQ
Sbjct: 122 IHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFSILCDFELIVSIQELQ 181

Query: 441 KYSDLLRDFWNRE 453
           +Y+DLL  FW+RE
Sbjct: 182 RYADLLYKFWHRE 194

>CAGL0M12342g complement(1232642..1234015) weakly similar to
           sp|P40038 Saccharomyces cerevisiae YER059w PCL6 cyclin
           like protein interacting with PHO85P, hypothetical start
          Length = 457

 Score =  269 bits (687), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 157/219 (71%), Gaps = 31/219 (14%)

Query: 261 IQIATFPTDRLLSMLTALLDKIVKSNDQLNRDRPFDE--------------DQFLASART 306
           + IA FPTD+LL MLTALL+KI+KSNDQ+    P+ +              D  L S + 
Sbjct: 236 LNIAEFPTDKLLEMLTALLNKIIKSNDQM---EPYKDKDKDEDHDDDESLTDSKLMSVKG 292

Query: 307 EDADNDTRPNIASEILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTC 366
            D     +      ILSF+GKHVP ITL QYFQRIQKYCPTTNDVFLSLLVYFDRI+K C
Sbjct: 293 TD-----KEKYLKSILSFKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKC 347

Query: 367 NHG---------KEQLFVMDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKEL 417
           N            +QLFVMDSYNIHRL+I+ VTV TKFFSDFFYSNSRYARVGGISL EL
Sbjct: 348 NSSDSESADTSPADQLFVMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSEL 407

Query: 418 NHLELQFLVLCDFELIISVEELQKYSDLLRDFWNREVGD 456
           NHLELQFLVLCDFEL+ISV++LQ+Y++LL  FWN +  D
Sbjct: 408 NHLELQFLVLCDFELLISVDKLQRYANLLLRFWNNQGVD 446

>KLLA0C08305g complement(728996..730225) some similarities with
           sp|P40038 Saccharomyces cerevisiae YER059w PCL6 cyclin
           like protein interacting with PHO85P, hypothetical start
          Length = 409

 Score =  262 bits (669), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 150/216 (69%), Gaps = 35/216 (16%)

Query: 261 IQIATFPTDRLLSMLTALLDKIVKSNDQLNRDRPFDEDQFLASARTEDADNDTRPNIASE 320
           + IATFPT +LL MLT LL KI+KSND L     F+  Q               P +  E
Sbjct: 189 MDIATFPTYKLLDMLTGLLTKIIKSNDSLGSTPNFETSQ-----------GKNIP-LMRE 236

Query: 321 ILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCN------------- 367
           ILSFRGK VP ITL+QYFQRIQKYCPTTNDV LSLLV+FDRIAK CN             
Sbjct: 237 ILSFRGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVST 296

Query: 368 ----------HGKEQLFVMDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKEL 417
                         QLFVMDS+NIHRLII+A+TVSTKF SDFFYSNSRYARVGGISL+EL
Sbjct: 297 PDKTTASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQEL 356

Query: 418 NHLELQFLVLCDFELIISVEELQKYSDLLRDFWNRE 453
           NHLELQFL+LCDF LIISVEELQ+Y+DLL  FW++E
Sbjct: 357 NHLELQFLILCDFRLIISVEELQRYADLLYKFWDKE 392

>YIL050W (PCL7) [2617] chr9 (258912..259769) Cyclin, associates with
           the Pho85p cyclin-dependent kinase, involved in
           utilization of alternate carbon sources [858 bp, 285 aa]
          Length = 285

 Score =  238 bits (607), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 148/199 (74%), Gaps = 19/199 (9%)

Query: 259 ELIQIATFPTDRLLSMLTALLDKIVKSNDQLNRDRPFDEDQFLASARTEDADNDTRPNIA 318
           +++ IA FPTD L+ M++ALL++I+ +ND+              +  ++   ++T   + 
Sbjct: 98  KILNIADFPTDELILMISALLNRIITANDE-------------TTDVSQQVSDETEDELL 144

Query: 319 SEILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKE------Q 372
           + IL+F GK+VP I + QY +RIQKYCPTTND+FLSLLVYFDRI+K   H  E      Q
Sbjct: 145 TPILAFYGKNVPEIAVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQ 204

Query: 373 LFVMDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFEL 432
           LFVMDS NIHRL+I+ VT+ TKF SDFFYSNSRYA+VGGISL+ELNHLELQFL+LCDF+L
Sbjct: 205 LFVMDSGNIHRLLITGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKL 264

Query: 433 IISVEELQKYSDLLRDFWN 451
           ++SVEE+QKY++LL  FWN
Sbjct: 265 LVSVEEMQKYANLLYKFWN 283

>Scas_715.51
          Length = 341

 Score =  216 bits (550), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 111/218 (50%), Positives = 148/218 (67%), Gaps = 28/218 (12%)

Query: 255 SEVPELIQIATFPTDRLLSMLTALLDKIVKSNDQLNRDRPFDEDQFLASARTEDADNDTR 314
           + V + I I    T +L+ M++ +L+K++KSND+L R+R    ++   + RT+D DN   
Sbjct: 121 ASVNDFIDITKLSTKKLIKMISTILEKLIKSNDEL-RER----NETSLNDRTDD-DNSDE 174

Query: 315 PNIASEILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKEQ-- 372
             +   I SFRGKH+P I L+QYF RIQKYCPT N V L++L+YFDRI+K  N  KE   
Sbjct: 175 SKLVRSIKSFRGKHIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENES 234

Query: 373 --------------------LFVMDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGI 412
                                F++DSYNIHRLIISA+TVSTKF+SDFFYSNSRYA+VGGI
Sbjct: 235 DPNISTHHHLLRNYDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGI 294

Query: 413 SLKELNHLELQFLVLCDFELIISVEELQKYSDLLRDFW 450
           SL E+N+LELQFL++ +F+LIIS EE+Q+YS LL  F+
Sbjct: 295 SLDEMNYLELQFLLISNFDLIISSEEIQRYSGLLSKFY 332

>YER059W (PCL6) [1489] chr5 (272622..273884) Cyclin that associates
           with the Pho85p cyclin-dependent kinase, involved in
           utilization of alternative carbon and nitrogen sources
           [1263 bp, 420 aa]
          Length = 420

 Score =  191 bits (484), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 122/274 (44%), Positives = 146/274 (53%), Gaps = 59/274 (21%)

Query: 235 THNDRPLKQRAPVPNSEPKLSEVPELIQIATFPTDRLLSMLTALLDKIVKSNDQLNRDRP 294
           TH  +   Q   + + +   S+V   + IA FPTD+LL MLTALL KI+KSND+     P
Sbjct: 136 THTVQSSTQEDKILDGDTSNSQVTPSLNIAEFPTDKLLKMLTALLTKIIKSNDRTAATNP 195

Query: 295 FDEDQFLASARTEDADNDTRPNIASEILSFRGKHVPAITLQQY----------------- 337
               Q + + R   A +D      S +L FRGKHVP I L QY                 
Sbjct: 196 -SLTQEIENGRCL-ALSDNEKKYLSPVLGFRGKHVPQIGLDQYFQRIQKYCPTTNDVFLS 253

Query: 338 ----FQRIQKYC------PTTNDVFL------SLLVYFDRIA---KTC------------ 366
               F RI K C      P TN          S L   +R A     C            
Sbjct: 254 LLVYFDRISKRCNSVTTTPKTNTAKHESPSNESSLDKANRGADKMSACNSNENNENDDSD 313

Query: 367 ---------NHGKEQLFVMDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKEL 417
                    +    Q+FVMDS+NIHRLII+ +TVSTKF SDFFYSNSRY+RVGGISL+EL
Sbjct: 314 DENTGVQRDSRAHPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQEL 373

Query: 418 NHLELQFLVLCDFELIISVEELQKYSDLLRDFWN 451
           NHLELQFLVLCDFEL+ISV ELQ+Y+DLL  FWN
Sbjct: 374 NHLELQFLVLCDFELLISVNELQRYADLLYRFWN 407

>KLLA0D01287g 112866..113903 some similarities with sp|P20052
           Saccharomyces cerevisiae YOL001w PHO80 cyclin,
           hypothetical start
          Length = 345

 Score = 78.2 bits (191), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 68/126 (53%), Gaps = 7/126 (5%)

Query: 308 DADNDTRPNIASEILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCN 367
           DA+N    N   E+  F  K  P+IT+ QY  R+ KY    + V LS + Y D ++    
Sbjct: 49  DANNAG--NQTMELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYP 106

Query: 368 HGKEQLFVMDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVL 427
                 F ++S  +HR +++A T+++K   D F +N+ Y++VGG+   ELN LE +FL  
Sbjct: 107 E-----FTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLER 161

Query: 428 CDFELI 433
             + +I
Sbjct: 162 VRYRII 167

>Sklu_2373.4 YOL001W, Contig c2373 11960-12883
          Length = 307

 Score = 70.5 bits (171), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 77/163 (47%), Gaps = 29/163 (17%)

Query: 271 LLSMLTALLDKIVKSNDQLNRDRPFDEDQFLASARTEDADNDTRPNIASEILSFRGKHVP 330
           L+ +++ +L  +++ ND + +D+                          ++  F  +  P
Sbjct: 61  LVVLISRMLSSLIQMNDSMCKDKNL------------------------KLTRFHSRVPP 96

Query: 331 AITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKEQLFVMDSYNIHRLIISAVT 390
            I++  Y  R+ KY      V ++ + Y D ++          F ++S  +HR +++A T
Sbjct: 97  GISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPS-----FTLNSLTVHRFLLTATT 151

Query: 391 VSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI 433
           V++K  SD F +N  YA+VGG+   ELN LE +FL   ++ +I
Sbjct: 152 VASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRII 194

>ACR001C [1049] [Homologous to ScYOL001W (PHO80) - SH]
           (357962..359002) [1041 bp, 346 aa]
          Length = 346

 Score = 70.1 bits (170), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 73/151 (48%), Gaps = 23/151 (15%)

Query: 299 QFLASART----------------EDADNDTRPNIASEILSFRGKHVPAITLQQYFQRIQ 342
           QFL+ +RT                 DA  D    I  ++  F  +  PAI++  Y  R+ 
Sbjct: 21  QFLSCSRTYLVVLISRMLTSLIGMNDAQGDKSKPI--KLTRFHSRVPPAISVYNYLIRLT 78

Query: 343 KYCPTTNDVFLSLLVYFDRIAKTCNHGKEQLFVMDSYNIHRLIISAVTVSTKFFSDFFYS 402
           KY    + V L+ + Y D +           F +DS  +HR +++A TV++K   D F +
Sbjct: 79  KYSSLEHCVLLASVYYIDLLTNV-----YPEFRLDSLTVHRFLLTATTVASKGLCDSFCT 133

Query: 403 NSRYARVGGISLKELNHLELQFLVLCDFELI 433
           N+ YA+VGG+   ELN LE +FL   ++ ++
Sbjct: 134 NTHYAKVGGVQCSELNVLENEFLERVNYRIL 164

>CAGL0E02541g 244577..245605 similar to sp|P20052 Saccharomyces
           cerevisiae YOL001w PHO80 cyclin, start by similarity
          Length = 342

 Score = 69.3 bits (168), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 60/110 (54%), Gaps = 5/110 (4%)

Query: 324 FRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKEQLFVMDSYNIHR 383
           F  K  P I++  YF R+ KY    + V LS + Y D ++          F ++S   HR
Sbjct: 62  FHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNV-----YPAFNLNSLTAHR 116

Query: 384 LIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI 433
            +++A T+++K   D F +N+ Y++VGG+   ELN LE +FL   ++ +I
Sbjct: 117 FLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRII 166

>Kwal_56.22443
          Length = 280

 Score = 67.4 bits (163), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 67/124 (54%), Gaps = 6/124 (4%)

Query: 311 NDTRP-NIASEILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHG 369
           ND+ P + A E+  F  +  P I++  Y  R+ +Y      V ++ + Y D ++      
Sbjct: 61  NDSVPKDDAKELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLS-----A 115

Query: 370 KEQLFVMDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCD 429
               F ++S  +HR +++A TV++K   D F +NS YA+VGG+   EL+ LE +FL   +
Sbjct: 116 MYPSFSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVN 175

Query: 430 FELI 433
           + ++
Sbjct: 176 YRIL 179

>Scas_392.1
          Length = 303

 Score = 65.9 bits (159), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 59/110 (53%), Gaps = 5/110 (4%)

Query: 324 FRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKEQLFVMDSYNIHR 383
           F  +  P I++  Y  R+ KYC   + V LS++ Y D             F  +S   HR
Sbjct: 100 FHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFT-----AAYPTFTFNSLTAHR 154

Query: 384 LIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI 433
            +++A+TV+ K   D F + ++YA++GG+  +ELN LE  FL + ++ +I
Sbjct: 155 FLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRII 204

>YOL001W (PHO80) [4815] chr15 (325249..326130) Cyclin that interacts
           with Pho85p cyclin-dependent kinase, regulates the
           phosphate pathway through phosphorylation of Pho4p [882
           bp, 293 aa]
          Length = 293

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 64/126 (50%), Gaps = 13/126 (10%)

Query: 324 FRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKEQLFVMDSYNIHR 383
           +  K  P I++  YF R+ K+    + V ++ L Y D +           F ++S   HR
Sbjct: 67  YHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPD-----FTLNSLTAHR 121

Query: 384 LIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI--------IS 435
            +++A TV+TK   D F +N+ YA+VGG+   ELN LE  FL   ++ +I         S
Sbjct: 122 FLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCS 181

Query: 436 VEELQK 441
           +E+ QK
Sbjct: 182 IEQKQK 187

>YGL134W (PCL10) [1853] chr7 (255666..256967) Cyclin that associates
           with the Pho85p cyclin-dependent kinase, involved in
           glycogen accumulation [1302 bp, 433 aa]
          Length = 433

 Score = 60.1 bits (144), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 68/133 (51%), Gaps = 3/133 (2%)

Query: 320 EILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRI--AKTCNHGKEQLFVMD 377
           E  +F  K  P ++   + +RIQ  C     V+L      D +   +  N+  +    + 
Sbjct: 296 EYSNFYMKSKPTLSSADFLKRIQDKCEYQPTVYLVATFLIDTLFLTRDGNNILQLKLNLQ 355

Query: 378 SYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLV-LCDFELIISV 436
              +HR+II+AV +STK   DF +S+  +++V GIS + L  LE+  L+ +C+ +L++S 
Sbjct: 356 EKEVHRMIIAAVRLSTKLLEDFVHSHEYFSKVCGISKRLLTKLEVSLLICVCNTKLMVSN 415

Query: 437 EELQKYSDLLRDF 449
            +L     LL + 
Sbjct: 416 RKLAASKLLLNEL 428

>YPL219W (PCL8) [5230] chr16 (136749..138227) Cyclin that associates
           with the Pho85p cyclin-dependent kinase, involved in
           control of glycogen accumulation [1479 bp, 492 aa]
          Length = 492

 Score = 58.5 bits (140), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 76/147 (51%), Gaps = 8/147 (5%)

Query: 310 DNDTRPNIASE----ILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFL--SLLVYFDRIA 363
           DN     I+SE     ++F  K+ P+++ + +  RIQ  C     V+L  + L+    + 
Sbjct: 338 DNANTLAISSEDPQKFVNFVMKNPPSLSFRDFIDRIQNKCMFGAVVYLGATYLLQLVFLT 397

Query: 364 KTCNHGKEQLFV-MDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLEL 422
           +    G  +L   +     HR+IIS + ++TK   DF +S +   +V GIS + L  LE+
Sbjct: 398 RDEMDGPIKLKAKLQEDQAHRIIISTIRIATKLLEDFVHSQNYICKVFGISKRLLTKLEI 457

Query: 423 QFLVLCDFE-LIISVEELQKYSDLLRD 448
            F+   +F+ L+I+ E+L+K   +L D
Sbjct: 458 SFMASVNFDGLMITCEKLEKTLHILDD 484

>CAGL0E05918g complement(585723..587168) some similarities with
           tr|Q08966 Saccharomyces cerevisiae YPL219w PCL8,
           hypothetical start
          Length = 481

 Score = 58.2 bits (139), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 69/135 (51%), Gaps = 6/135 (4%)

Query: 324 FRGKHVPAITLQQYFQRIQKYCPTTNDVFL--SLLVYFDRIAKTCNHGKEQL-FVMDSYN 380
           F  K  P+I+   + QRIQ  C   + ++L  + L+    + +  N G  +L   +    
Sbjct: 346 FSMKSAPSISHHDFIQRIQNKCMFGSIIYLGATYLLQILFLTREYNDGPLRLKHKLQQNE 405

Query: 381 IHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLC--DFELIISVEE 438
           +HR+I+  + ++TK   DF +S+    +V GIS K +  LEL  L+ C  D  L+I+ E+
Sbjct: 406 VHRVIVGTIRIATKLLEDFVHSHQYICKVCGISKKLMTKLELA-LIFCLKDNNLLINSEK 464

Query: 439 LQKYSDLLRDFWNRE 453
           L   + +L +   +E
Sbjct: 465 LSATACILEELKAQE 479

>Scas_720.47
          Length = 473

 Score = 57.8 bits (138), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 68/131 (51%), Gaps = 4/131 (3%)

Query: 323 SFRGKHVPAITLQQYFQRIQKYCPTTNDVFL---SLLVYFDRIAKTCNHGKEQLFVMDSY 379
           +F+ K  P+++   + QRIQ  C     V+L    LL     I +  +   +  F  +  
Sbjct: 339 NFKMKSPPSLSYADFIQRIQNKCEYDPHVYLIATYLLQTLLLIREEHSRKLKLRFKFEKS 398

Query: 380 NIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFE-LIISVEE 438
           ++HRLII+ V ++TK   D  +S+  + +V GIS K L+ LE+  L+    E L+++  +
Sbjct: 399 DVHRLIIATVRIATKLLEDHVHSHEYFCKVSGISKKLLSKLEVSLLLCLKNECLLMTKGK 458

Query: 439 LQKYSDLLRDF 449
           +    D+LR+ 
Sbjct: 459 MAASIDILREL 469

>Kwal_56.24151
          Length = 480

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 63/124 (50%), Gaps = 23/124 (18%)

Query: 320 EILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKEQLFV---- 375
           ++ +F     P +  ++Y QR+  +C  +     + +VY      T  H  + LF+    
Sbjct: 344 QLATFNMDSTPTLAYEEYLQRL--HCKFS----FAPIVYL-----TAAHLLQSLFLTRKD 392

Query: 376 --------MDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVL 427
                   +D+  +HRLII+++ ++TK   D  +S++ ++R+ GIS K L  LE+ FL  
Sbjct: 393 NKLCCKYHLDNCQVHRLIIASIRLATKLLEDCVHSHTCFSRICGISKKLLTKLEIAFLNC 452

Query: 428 CDFE 431
            +FE
Sbjct: 453 INFE 456

>CAGL0H08998g 877952..879595 weakly similar to tr|Q08966
           Saccharomyces cerevisiae YPL219w PCL8, hypothetical
           start
          Length = 547

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 58/110 (52%), Gaps = 4/110 (3%)

Query: 322 LSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKEQLFV---MDS 378
           L+F  K  P+++ + +  RIQ  C     ++L+       +  T ++    + V   +  
Sbjct: 412 LNFTMKSKPSVSAEIFLGRIQNKCEFGPIIYLAAAYLLQILFLTRDNPDSNIRVRLKLRE 471

Query: 379 YNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLC 428
             IHRLIIS V VS K   DF +S+  +++V G+S K L+ LE+  L++C
Sbjct: 472 NEIHRLIISTVRVSAKLVEDFVHSHEYFSKVCGVSKKLLSKLEVS-LIMC 520

>KLLA0B02024g 176585..178168 some similarities with sp|P53124
           Saccharomyces cerevisiae YGL134w PCL10 cyclin like
           protein interacting with PHO85P, hypothetical start
          Length = 527

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 65/122 (53%), Gaps = 7/122 (5%)

Query: 324 FRGKHVPAITLQQYFQRIQKYCPTTNDVFLS---LLVYFDRIAKTCNHGKEQLF--VMDS 378
           F+ K  P +++ QY  RI+  C     ++L+   LLV +  I      GK  L   + +S
Sbjct: 392 FQMKSAPTLSISQYLDRIESKCSFPPIIYLTASFLLVTYCDIKFDTGSGKFHLENPITES 451

Query: 379 YNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQF-LVLCDFELIISVE 437
              HRL+I+ + ++ K   D  +S+S +++V GIS K L+ LEL   L+L D +  + + 
Sbjct: 452 MT-HRLLIAFIRLAAKLLEDHVHSHSYFSKVCGISKKLLSKLELNLVLILQDTQDGLLIT 510

Query: 438 EL 439
           EL
Sbjct: 511 EL 512

>Scas_706.3
          Length = 451

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 62/119 (52%), Gaps = 10/119 (8%)

Query: 328 HVPAITLQQYFQRIQKYCPTTNDVFLSL-----LVYFDRIAKTCNHGKEQL-FVMDSYNI 381
           +VP+++   +  RIQ  C     V++S      ++  DR  +    G  +L   +    +
Sbjct: 322 NVPSLSYTDFINRIQSKCMFGAIVYMSATYLFQILLLDRDER---DGPIKLKHKLQENEV 378

Query: 382 HRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFE-LIISVEEL 439
           HR+II+ + V TK   DF +S+  + +V G+S K L+ LE+  L+    + +II+ EEL
Sbjct: 379 HRMIIATIRVGTKLVEDFVHSHQYFCKVCGVSRKLLSKLEVTLLLCLKHDKIIITTEEL 437

>AFL115W [3080] [Homologous to ScYPL219W (PCL8) - SH; ScYGL134W
           (PCL10) - SH] complement(221235..222395) [1161 bp, 386
           aa]
          Length = 386

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 52/109 (47%), Gaps = 6/109 (5%)

Query: 324 FRGKHVPAITLQQYFQRIQKYC---PTTNDVFLSLLVYFDRIAKTCNHGKEQLF--VMDS 378
           F  K   ++T  QY  RI   C   P        LL+           G  Q+   + +S
Sbjct: 244 FEMKAPASVTYTQYLDRINAKCMFAPIVYQTAGCLLLRLTLKWPPSETGPVQIRWPIAES 303

Query: 379 YNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVL 427
           Y +HRLI++ + VSTK   D  +S+  +++V GIS K L  LEL  +++
Sbjct: 304 Y-VHRLIVALIRVSTKIVEDTVHSHEYFSKVCGISKKLLMRLELALILV 351

>YNL289W (PCL1) [4322] chr14 (87895..88734) G1/S-specific cyclin
           that interacts with the Cdc28p-like kinase Pho85p [840
           bp, 279 aa]
          Length = 279

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 57/116 (49%), Gaps = 7/116 (6%)

Query: 327 KHVPAI-TLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKEQLFVMDSYNIHRLI 385
           KH+  + +L  +  R+ +Y        L+   Y +++ +        L       IHR+ 
Sbjct: 47  KHLTRLPSLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPRDATGL----PSTIHRIF 102

Query: 386 ISAVTVSTKFFSDFFYSNSRYARV--GGISLKELNHLELQFLVLCDFELIISVEEL 439
           ++ + +S KF +D    N  +AR   G  +L+++N +E Q L L +++L ++ E+L
Sbjct: 103 LACLILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNWDLRVNTEDL 158

>Kwal_34.15996
          Length = 231

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 37/61 (60%)

Query: 383 RLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELIISVEELQKY 442
           R+ +  + ++ KF +D  +S + + R+ G+S K+L+ +E   L   D+EL+I+ E L  +
Sbjct: 127 RVYLCCLILAHKFLNDQTFSMNSWQRISGLSSKDLSTMERWCLSKLDYELLINDENLNSW 186

Query: 443 S 443
           S
Sbjct: 187 S 187

>CAGL0E02233g 215697..216497 similar to sp|P24867 Saccharomyces
           cerevisiae YNL289w PCL1 cyclin, start by similarity
          Length = 266

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 58/115 (50%), Gaps = 8/115 (6%)

Query: 327 KHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKEQLFVMDSYNIHRLII 386
           +H+P+  L  +  R+ +Y        L+ + Y +++ +        L       IHRL +
Sbjct: 50  EHLPS--LMTFITRLVRYTNVYTPTLLATVCYLNKLKRILPKDATGL----PSTIHRLFL 103

Query: 387 SAVTVSTKFFSDFFYSNSRYARV--GGISLKELNHLELQFLVLCDFELIISVEEL 439
           + + +S+K  +D    N  +AR   G  SL+++N +E Q L L ++++ +S ++L
Sbjct: 104 ACLILSSKCHNDSSPKNVHWARYTDGLFSLEDINLMERQLLQLLNWDINVSEDDL 158

>Scas_686.2
          Length = 210

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/132 (21%), Positives = 62/132 (46%), Gaps = 9/132 (6%)

Query: 317 IASEILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKEQLFVM 376
           +AS I  +  + +    +Q Y + + K   +T  V     +Y D+I     +   +  + 
Sbjct: 61  LASIIKKYSLETIGVADIQVYLKEVCKRSRSTKTVVFLAAIYLDKI-----YSNWEPMLG 115

Query: 377 D----SYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFEL 432
           D    +  + R+ +S + ++ KF +D  +S   ++ + G+  KEL  +E + L+  ++EL
Sbjct: 116 DIPKFARCVKRVFLSCLIIAHKFANDKTFSMRSWSSISGLGRKELTIMEKKCLLEINYEL 175

Query: 433 IISVEELQKYSD 444
            +   EL  + +
Sbjct: 176 TVDKAELLSWQN 187

>YHR071W (PCL5) [2359] chr8 (237005..237694) Cyclin that associates
           with the Pho85p cyclin-dependent kinase and regulates
           Gcn4p stability [690 bp, 229 aa]
          Length = 229

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 2/95 (2%)

Query: 345 CPTTNDVFLSLLVYFDRIAKTCNHGKEQLFVMDSYNIHRLIISAVTVSTKFFSDFFYSNS 404
           C   N V  +   YF +I ++     E      S+   R+ +  + +S KF +D  YS  
Sbjct: 93  CSKENAVLATF--YFQKIHQSRGVRDESSLPEFSHCSRRIFLCCLILSHKFLNDNTYSMK 150

Query: 405 RYARVGGISLKELNHLELQFLVLCDFELIISVEEL 439
            +  + G+  K+L+ +E   L   ++EL I  +E 
Sbjct: 151 NWQIISGLHAKDLSLMERWCLGKLNYELAIPYDEF 185

>Sklu_2426.9 YHR071W, Contig c2426 11461-12162
          Length = 233

 Score = 33.1 bits (74), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 32/61 (52%)

Query: 383 RLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELIISVEELQKY 442
           R+ +  + +S KF  D  +S   + R+ G+  K++  +E   L   D+EL +    LQ++
Sbjct: 125 RIYLVCLILSHKFLKDQTFSMKSWQRISGLPTKDIATMERWCLGKLDYELFLEESALQEW 184

Query: 443 S 443
           +
Sbjct: 185 A 185

>Scas_646.23
          Length = 238

 Score = 32.0 bits (71), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 15/65 (23%), Positives = 37/65 (56%)

Query: 378 SYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELIISVE 437
           +++I R  ++ + ++ KF +D  +S   ++ + G+  K ++ +E   L   +F+L +S E
Sbjct: 137 AHSIKRTFLNCLILAHKFSNDITFSMKTWSLITGLQPKNISTMERWCLKKLNFQLFVSNE 196

Query: 438 ELQKY 442
           +L  +
Sbjct: 197 QLLSW 201

>AER335W [2836] [Homologous to ScYMR208W (ERG12) - SH]
           complement(1253625..1254911) [1287 bp, 428 aa]
          Length = 428

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 48/103 (46%), Gaps = 16/103 (15%)

Query: 179 TISSSVP-----RSSEPINISVPMAKSHSSKYFQ-----ESVHEDDYLQQFT-----PFH 223
           T+ S++P      SS  I + + +A      + Q      +  + D++ ++        H
Sbjct: 140 TVKSTLPIGAGLGSSASIAVCLALAMGRLGGHVQCESGALTKEQQDFVNRWALVGEQCIH 199

Query: 224 NTPTSVSNSYSTHNDRPLKQRAPVPNSE-PKLSEVPELIQIAT 265
            TP+ + N+ +T+ D  L QR P  +++   LS+ P++  I T
Sbjct: 200 GTPSGIDNAVATYGDAVLFQRQPDGSTKFDHLSDFPQMPMILT 242

>KLLA0B05885g complement(530762..532738) no similarity, hypothetical
           start
          Length = 658

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/105 (20%), Positives = 50/105 (47%), Gaps = 20/105 (19%)

Query: 339 QRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKEQLFVMDSYNIHRLIISAV--------- 389
           +++Q +C    ++   +   F++ A  CN     + + D YN+ +L I+           
Sbjct: 363 EKVQSWCI---ELITKMETQFNKDADKCNDEDALMNIKDKYNLAKLFINEFNDMLFSTRG 419

Query: 390 ----TVSTKFFSDFF--YSNSRYARVGGISLKELNHLE--LQFLV 426
               T++T+ ++D    ++NS   R+ G+  ++L  L+  + FL+
Sbjct: 420 VNMNTLATREYTDILTRFANSLETRMSGLFQRDLYSLQRSISFLL 464

>Kwal_55.21691
          Length = 387

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 7/54 (12%)

Query: 290 NRDRPFDEDQFLASARTEDADNDTRP----NIASEILSFRGKH---VPAITLQQ 336
           NR R  D D F   AR     +DT P    N+  ++  ++ KH   VP++T Q+
Sbjct: 100 NRKRYLDADAFFRKARQLGYKDDTLPIWEANLTKKVEKWKQKHKDEVPSLTAQE 153

>CAGL0G01584g complement(146813..148561) similar to sp|P46678
           Saccharomyces cerevisiae YNL039w TFC5, start by
           similarity
          Length = 582

 Score = 29.6 bits (65), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 42/100 (42%), Gaps = 24/100 (24%)

Query: 87  RSNSVASRMRPSLQRMGSSY--SRGSFVGKNGSFVXXXXXXXXXXXXXXXHPPATPELIE 144
           R NS+ +   P+LQ +      SRGS   K GS                 H  +    IE
Sbjct: 171 RMNSITAENDPTLQAIKKRRLSSRGSIAKKGGS----------------THRISIVTKIE 214

Query: 145 PPSQVRAVVPSSDSESDAVPGIERA--DENSDDKETTISS 182
           PP +  A    S S+ D     E+A  DEN +DK+ TI S
Sbjct: 215 PPKEKSA----SPSDHDIYKKQEKAENDENDEDKKFTIKS 250

>Sklu_2174.4 YER049W, Contig c2174 3142-5040 reverse complement
          Length = 632

 Score = 29.3 bits (64), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 5/47 (10%)

Query: 260 LIQIATFPTDRLLSMLTALLDKIVKSNDQLNRDRPFDEDQFLASART 306
            +QI +F  D      + LL +++K ND+LN+D P++ D+  A  +T
Sbjct: 361 FLQIGSFLNDSK----SKLLKRLIK-NDELNKDCPYESDKVDAPWKT 402

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.131    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,563,903
Number of extensions: 579674
Number of successful extensions: 3012
Number of sequences better than 10.0: 126
Number of HSP's gapped: 3003
Number of HSP's successfully gapped: 145
Length of query: 459
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 354
Effective length of database: 12,961,219
Effective search space: 4588271526
Effective search space used: 4588271526
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)