Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.58051021025315e-72
CAGL0J02926g127953497e-44
Sklu_2193.4102983468e-44
YER058W (PET117)1071113373e-42
Scas_715.52107973322e-41
ADL076W113952966e-36
KLLA0C08327g103972948e-36
ADL348W54634611.3
CAGL0M05137g135181601.8
ADL186C136158601.8
ADR241C99338592.4
Kwal_55.2151556790592.4
YCR042C (TAF2)140754574.7
Sklu_2442.1429834564.9
CAGL0D03344g178740559.2
YDL148C (NOP14)81020559.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.5805
         (102 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.5805                                                          209   5e-72
CAGL0J02926g 281301..281684 similar to sp|Q02771 Saccharomyces c...   139   7e-44
Sklu_2193.4 YER058W, Contig c2193 6568-6876                           137   8e-44
YER058W (PET117) [1488] chr5 (271766..272089) Protein involved i...   134   3e-42
Scas_715.52                                                           132   2e-41
ADL076W [1665] [Homologous to ScYER058W (PET117) - SH] complemen...   118   6e-36
KLLA0C08327g complement(730884..731195) similar to sp|Q02771 Sac...   117   8e-36
ADL348W [1392] [Homologous to ScYML130C (ERO1) - SH] complement(...    28   1.3  
CAGL0M05137g 552160..556215 weakly similar to sp|P21827 Saccharo...    28   1.8  
ADL186C [1555] [Homologous to ScYOL138C - SH] (369322..373407) [...    28   1.8  
ADR241C [1982] [Homologous to ScYLR039C (RIC1) - SH] (1123202..1...    27   2.4  
Kwal_55.21515                                                          27   2.4  
YCR042C (TAF2) [575] chr3 complement(201169..205392) Component o...    27   4.7  
Sklu_2442.14 YCL009C, Contig c2442 24299-25195 reverse complement      26   4.9  
CAGL0D03344g complement(343595..348958) similar to tr|Q07963 Sac...    26   9.2  
YDL148C (NOP14) [720] chr4 complement(188155..190587) Nuclear an...    26   9.3  

>Kwal_23.5805
          Length = 102

 Score =  209 bits (531), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 102/102 (100%), Positives = 102/102 (100%)

Query: 1   MSTASKITLALSCVLTTATVIGVHYVQELERDTLHQGPIKDAKRIADRKAEMENERKKRF 60
           MSTASKITLALSCVLTTATVIGVHYVQELERDTLHQGPIKDAKRIADRKAEMENERKKRF
Sbjct: 1   MSTASKITLALSCVLTTATVIGVHYVQELERDTLHQGPIKDAKRIADRKAEMENERKKRF 60

Query: 61  NESEHELQQELRRKYEALQPLSGEVLTKDGERAGDHIKDSKK 102
           NESEHELQQELRRKYEALQPLSGEVLTKDGERAGDHIKDSKK
Sbjct: 61  NESEHELQQELRRKYEALQPLSGEVLTKDGERAGDHIKDSKK 102

>CAGL0J02926g 281301..281684 similar to sp|Q02771 Saccharomyces
           cerevisiae YER058w PET117, start by similarity
          Length = 127

 Score =  139 bits (349), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 79/95 (83%), Gaps = 2/95 (2%)

Query: 1   MSTASKITLALSCVLTTATVIGVHYVQELERDTLHQGPIKDAKRIADRKAEME--NERKK 58
           MS ASKIT  +SC +T AT+IGVHYVQELER+TLHQGPIKDAKR+A++K  M    + KK
Sbjct: 32  MSRASKITFGVSCAVTLATIIGVHYVQELERETLHQGPIKDAKRVAEKKKLMPAGTDEKK 91

Query: 59  RFNESEHELQQELRRKYEALQPLSGEVLTKDGERA 93
             N SEHELQQELR+KYE++QPLSGEV+T+DGER 
Sbjct: 92  LLNRSEHELQQELRKKYESMQPLSGEVVTQDGERV 126

>Sklu_2193.4 YER058W, Contig c2193 6568-6876
          Length = 102

 Score =  137 bits (346), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 79/98 (80%), Gaps = 7/98 (7%)

Query: 1  MSTASKITLALSCVLTTATVIGVHYVQELERDTLHQGPIKDAKRIADRKAEME------- 53
          MS ASKITLALSC+LTT TVIGVH VQ++ER TLHQGPIKDAKR+A++K   E       
Sbjct: 1  MSRASKITLALSCLLTTTTVIGVHIVQDMERQTLHQGPIKDAKRVAEKKLAKEEQNQDPS 60

Query: 54 NERKKRFNESEHELQQELRRKYEALQPLSGEVLTKDGE 91
           +R K  N+ EHELQQELR+KYEA+QPLSGEVLTKDGE
Sbjct: 61 KQRMKLVNKGEHELQQELRKKYEAMQPLSGEVLTKDGE 98

>YER058W (PET117) [1488] chr5 (271766..272089) Protein involved in
           assembly of cytochrome oxidase [324 bp, 107 aa]
          Length = 107

 Score =  134 bits (337), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 84/111 (75%), Gaps = 13/111 (11%)

Query: 1   MSTASKITLALSCVLTTATVIGVHYVQELERDTLHQGPIKDAKRIADRKAEMEN------ 54
           MS ASKIT A SC++T ATV+GVHYVQE+ER+TLHQGPIKDAKR+ +++    N      
Sbjct: 1   MSRASKITFAASCLITAATVVGVHYVQEMERETLHQGPIKDAKRVEEKRLRKTNGVASLD 60

Query: 55  ---ERKKRFNESEHELQQELRRKYEALQPLSGEVLTKDGERAGDHIKDSKK 102
              ERK+ FN SEHE Q+ELR+KYE +QPLSGEV+TKDGE     +K+SKK
Sbjct: 61  PTKERKRYFNMSEHEEQKELRKKYETMQPLSGEVVTKDGEV----VKESKK 107

>Scas_715.52
          Length = 107

 Score =  132 bits (332), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 63/97 (64%), Positives = 78/97 (80%), Gaps = 6/97 (6%)

Query: 1  MSTASKITLALSCVLTTATVIGVHYVQELERDTLHQGPIKDAKRIADRKAEMEN------ 54
          MS ASKIT AL+CV T  T +GVHYVQ +ERDTLHQGPIKDAKR+A++K   E+      
Sbjct: 1  MSRASKITFALTCVFTITTTVGVHYVQGMERDTLHQGPIKDAKRVAEKKRLKESGLDPAK 60

Query: 55 ERKKRFNESEHELQQELRRKYEALQPLSGEVLTKDGE 91
          E+K+ FN+SEHELQ+EL+++YE  QPLSGEV+TKDGE
Sbjct: 61 EKKRMFNQSEHELQKELKKQYEQQQPLSGEVVTKDGE 97

>ADL076W [1665] [Homologous to ScYER058W (PET117) - SH]
           complement(550058..550399) [342 bp, 113 aa]
          Length = 113

 Score =  118 bits (296), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 71/95 (74%), Gaps = 4/95 (4%)

Query: 1   MSTASKITLALSCVLTTATVIGVHYVQELERDTLHQGPIKDAKRIADRKAEM----ENER 56
           MS ASKITLAL    + ATV+ VH VQE+ERD L QGPIKDA R A+++AE     E  R
Sbjct: 14  MSRASKITLALCTAASAATVVTVHLVQEMERDALKQGPIKDALRTAEKRAERDADPEAAR 73

Query: 57  KKRFNESEHELQQELRRKYEALQPLSGEVLTKDGE 91
           KK  N SEHELQ ELRRKY A+QPLSGEV+T+DG+
Sbjct: 74  KKMLNASEHELQLELRRKYAAMQPLSGEVVTQDGD 108

>KLLA0C08327g complement(730884..731195) similar to sp|Q02771
          Saccharomyces cerevisiae YER058w PET117 cytochrome c
          oxidase assembly factor singleton, start by similarity
          Length = 103

 Score =  117 bits (294), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 58/97 (59%), Positives = 73/97 (75%), Gaps = 6/97 (6%)

Query: 1  MSTASKITLALSCVLTTATVIGVHYVQELERDTLHQGPIKDAKRIADRKAEMEN------ 54
          MS ASKITL L+ + T   V+GVH+VQELER TLHQGPIKDA+R+A++K   +N      
Sbjct: 1  MSRASKITLGLTTLFTATIVVGVHHVQELERQTLHQGPIKDAQRVAEKKLARQNGVDPEK 60

Query: 55 ERKKRFNESEHELQQELRRKYEALQPLSGEVLTKDGE 91
          ER++  N++EHE Q ELR+KYE +QPLSGEV TKD E
Sbjct: 61 ERQRMVNKNEHEYQLELRKKYEQMQPLSGEVRTKDNE 97

>ADL348W [1392] [Homologous to ScYML130C (ERO1) - SH]
           complement(93227..94867) [1641 bp, 546 aa]
          Length = 546

 Score = 28.1 bits (61), Expect = 1.3,   Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 18/34 (52%)

Query: 46  ADRKAEMENERKKRFNESEHELQQELRRKYEALQ 79
           AD K      +K+   ES   LQQEL+  Y ALQ
Sbjct: 469 ADLKIPARRSKKQTKEESTSALQQELQGVYHALQ 502

>CAGL0M05137g 552160..556215 weakly similar to sp|P21827 Saccharomyces
            cerevisiae YGL097w SRM1, hypothetical start
          Length = 1351

 Score = 27.7 bits (60), Expect = 1.8,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 12/81 (14%)

Query: 30   ERDTLHQGPIKDAKRIADRKAEME-NERKKRFNESEHELQQELRRK-----------YEA 77
            E  T    P   A  ++D K ++E  E +K F E    +Q EL R+           Y++
Sbjct: 1253 ESVTTDTTPSWTASTVSDFKQKVEAQEFEKWFQEESKRVQLELERRGSSHHDELKVLYDS 1312

Query: 78   LQPLSGEVLTKDGERAGDHIK 98
             Q + G V+  + ++AG  IK
Sbjct: 1313 SQNIPGFVIDSNVKKAGRKIK 1333

>ADL186C [1555] [Homologous to ScYOL138C - SH] (369322..373407)
           [4086 bp, 1361 aa]
          Length = 1361

 Score = 27.7 bits (60), Expect = 1.8,   Method: Composition-based stats.
 Identities = 14/58 (24%), Positives = 27/58 (46%)

Query: 42  AKRIADRKAEMENERKKRFNESEHELQQELRRKYEALQPLSGEVLTKDGERAGDHIKD 99
           A R +D   E+E ER+   ++  H L+++ R  ++  Q    E   +  +  G+   D
Sbjct: 573 ADRESDHDKELEKERETEVDQHYHYLREQEREHHQEYQEWEHEPFGRHDDHQGNPQTD 630

>ADR241C [1982] [Homologous to ScYLR039C (RIC1) - SH]
           (1123202..1126183) [2982 bp, 993 aa]
          Length = 993

 Score = 27.3 bits (59), Expect = 2.4,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 55  ERKKRFNESE-HELQQELRRKYEALQPLSGEVLTKDGE 91
           E  KRF++S+ H+L +E+      L P  G++L  DG+
Sbjct: 635 ETIKRFHQSKRHKLPEEVSSNVRWLLPWKGQLLVLDGD 672

>Kwal_55.21515
          Length = 567

 Score = 27.3 bits (59), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 42/90 (46%), Gaps = 27/90 (30%)

Query: 15  LTTATVIGVHYVQELERDTLHQGPIKDAKRIADR-----KAEMENERKKRFNESEHELQQ 69
           L T T   +H +QE   +  HQ    +A+R  DR     KAE++NE  +R      ELQQ
Sbjct: 66  LLTKTKESLHALQE---EVSHQRS--EARREHDRQVDTLKAEVDNESSRR-----RELQQ 115

Query: 70  ELRRKYEALQPLSGEVLTKDGERAGDHIKD 99
           ++R             L KD  +A  H+KD
Sbjct: 116 QVR------------SLEKDLSKANSHVKD 133

>YCR042C (TAF2) [575] chr3 complement(201169..205392) Component of
          TAF(II) complex (TBP-associated protein complex),
          required for activated transcription by RNA polymerase
          II [4224 bp, 1407 aa]
          Length = 1407

 Score = 26.6 bits (57), Expect = 4.7,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 6/54 (11%)

Query: 7  ITLALSCVLTTATVIGVHYVQELERDTLHQGPIKDAKRIADRKAEMENERKKRF 60
          I LA  C+  +AT+I +  +Q LE  T       D K +  +   +EN R  +F
Sbjct: 39 IDLATHCITGSATIIIIPLIQNLEYVTF------DCKEMTIKDVLVENRRCDQF 86

>Sklu_2442.14 YCL009C, Contig c2442 24299-25195 reverse complement
          Length = 298

 Score = 26.2 bits (56), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 51  EMENE-RKKRFNESEHELQQELRRKYEALQPLSG 83
           EM +E R KRF+     L + LR KYE L  ++G
Sbjct: 185 EMVDEIRNKRFHPKNLPLSEVLRLKYEHLNDITG 218

>CAGL0D03344g complement(343595..348958) similar to tr|Q07963
            Saccharomyces cerevisiae YLR024c UBR2, hypothetical start
          Length = 1787

 Score = 25.8 bits (55), Expect = 9.2,   Method: Composition-based stats.
 Identities = 12/40 (30%), Positives = 23/40 (57%)

Query: 61   NESEHELQQELRRKYEALQPLSGEVLTKDGERAGDHIKDS 100
            N   +E++Q+LR+   A++ +  E+     +R  D IK+S
Sbjct: 988  NGKRYEIEQQLRKHISAIKDIPYELSFVPAKRVIDDIKES 1027

>YDL148C (NOP14) [720] chr4 complement(188155..190587) Nuclear and
           nucleolar protein involved in 40S ribosomal subunit
           biogenesis and 18S rRNA maturation, component of U3
           snoRNP (also called small subunit processome) [2433 bp,
           810 aa]
          Length = 810

 Score = 25.8 bits (55), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 15/20 (75%)

Query: 58  KRFNESEHELQQELRRKYEA 77
           KRFNE + ELQQ  R+K +A
Sbjct: 189 KRFNEDDAELQQPQRKKTKA 208

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.127    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 3,167,618
Number of extensions: 121309
Number of successful extensions: 889
Number of sequences better than 10.0: 91
Number of HSP's gapped: 876
Number of HSP's successfully gapped: 99
Length of query: 102
Length of database: 16,596,109
Length adjustment: 73
Effective length of query: 29
Effective length of database: 14,068,995
Effective search space: 408000855
Effective search space used: 408000855
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 54 (25.4 bits)