Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.58041411407371e-102
Sklu_2193.31281275975e-81
KLLA0C08349g1401405872e-79
ADL077C1421295458e-73
Scas_704.341481445381e-71
YIL051C (MMF1)1451445181e-68
Scas_715.531281264986e-66
CAGL0M12386g1421284572e-59
YER057C (HMF1)1291274353e-56
Kwal_47.16590126991461e-12
Kwal_23.28071291071354e-11
Kwal_55.21247134991233e-09
KLLA0B14817g131991233e-09
Scas_506.36891201171e-07
KLLA0E03894g1371031077e-07
YLR143W6851321055e-06
CAGL0M04521g6881051012e-05
AGL164W68679932e-04
KLLA0D16984g696122850.002
Kwal_27.1131068879790.013
CAGL0L02959g69473613.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.5804
         (140 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.5804                                                          288   e-102
Sklu_2193.3 YIL051C, Contig c2193 5846-6232 reverse complement        234   5e-81
KLLA0C08349g 731629..732051 highly similar to sp|P40185 Saccharo...   230   2e-79
ADL077C [1664] [Homologous to ScYIL051C (MMF1) - SH; ScYER057C (...   214   8e-73
Scas_704.34                                                           211   1e-71
YIL051C (MMF1) [2616] chr9 complement(257842..258279) Protein im...   204   1e-68
Scas_715.53                                                           196   6e-66
CAGL0M12386g 1234993..1235421 similar to sp|P40037 Saccharomyces...   180   2e-59
YER057C (HMF1) [1487] chr5 complement(270735..271124) Protein th...   172   3e-56
Kwal_47.16590                                                          61   1e-12
Kwal_23.2807                                                           57   4e-11
Kwal_55.21247                                                          52   3e-09
KLLA0B14817g 1301705..1302100 similar to sp|Q8XCD0 Escherichia c...    52   3e-09
Scas_506.3                                                             50   1e-07
KLLA0E03894g complement(364475..364888) some similarities with s...    46   7e-07
YLR143W (YLR143W) [3552] chr12 (427330..429387) Protein containi...    45   5e-06
CAGL0M04521g 496157..498223 similar to tr|Q12429 Saccharomyces c...    44   2e-05
AGL164W [4148] [Homologous to ScYLR143W - SH] complement(388842....    40   2e-04
KLLA0D16984g 1439669..1441759 similar to sgd|S0004133 Saccharomy...    37   0.002
Kwal_27.11310                                                          35   0.013
CAGL0L02959g 344703..346787 some similarities with sp|P47029 Sac...    28   3.0  

>Kwal_23.5804
          Length = 141

 Score =  288 bits (737), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 140/140 (100%), Positives = 140/140 (100%)

Query: 1   MFLRNAARNTFRSMSTLTPVRTQLSPPPAASYSQAMRVNKMVFVSGQIPYTAENKRVEGT 60
           MFLRNAARNTFRSMSTLTPVRTQLSPPPAASYSQAMRVNKMVFVSGQIPYTAENKRVEGT
Sbjct: 1   MFLRNAARNTFRSMSTLTPVRTQLSPPPAASYSQAMRVNKMVFVSGQIPYTAENKRVEGT 60

Query: 61  IADKAEQVIQNVRNILEEANSGLDKIVKVNIFLADIKDFAEFNGVYGKYFNEHKPARSCV 120
           IADKAEQVIQNVRNILEEANSGLDKIVKVNIFLADIKDFAEFNGVYGKYFNEHKPARSCV
Sbjct: 61  IADKAEQVIQNVRNILEEANSGLDKIVKVNIFLADIKDFAEFNGVYGKYFNEHKPARSCV 120

Query: 121 AVKALPLDVDLEMEVVAVEK 140
           AVKALPLDVDLEMEVVAVEK
Sbjct: 121 AVKALPLDVDLEMEVVAVEK 140

>Sklu_2193.3 YIL051C, Contig c2193 5846-6232 reverse complement
          Length = 128

 Score =  234 bits (597), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 121/127 (95%)

Query: 14  MSTLTPVRTQLSPPPAASYSQAMRVNKMVFVSGQIPYTAENKRVEGTIADKAEQVIQNVR 73
           MSTLTPVRTQL+PPPAASYSQA++VN MVFVSGQIPYT ENK VEG+IADKAEQVIQNV+
Sbjct: 1   MSTLTPVRTQLAPPPAASYSQAIKVNNMVFVSGQIPYTHENKPVEGSIADKAEQVIQNVK 60

Query: 74  NILEEANSGLDKIVKVNIFLADIKDFAEFNGVYGKYFNEHKPARSCVAVKALPLDVDLEM 133
           NILEEANS L+KIVKVN+FLADI DFAEFNGVY KYFNEHKPARSCVAVK+LPL+VDLEM
Sbjct: 61  NILEEANSSLNKIVKVNVFLADINDFAEFNGVYAKYFNEHKPARSCVAVKSLPLNVDLEM 120

Query: 134 EVVAVEK 140
           EV+AVEK
Sbjct: 121 EVIAVEK 127

>KLLA0C08349g 731629..732051 highly similar to sp|P40185
           Saccharomyces cerevisiae YIL051c MMD1 required for
           maintenance of mitochondrial DNA, start by similarity
          Length = 140

 Score =  230 bits (587), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 125/140 (89%), Gaps = 1/140 (0%)

Query: 1   MFLRNAARNTFRSMSTLTPVRTQLSPPPAASYSQAMRVNKMVFVSGQIPYTAENKRVEGT 60
           MF R A ++T R M+TLTPV+TQL+PPPAASYSQA++VN ++FVSGQIPYTAENK VEG+
Sbjct: 1   MF-RQALKSTVRRMNTLTPVKTQLAPPPAASYSQAIKVNNLIFVSGQIPYTAENKPVEGS 59

Query: 61  IADKAEQVIQNVRNILEEANSGLDKIVKVNIFLADIKDFAEFNGVYGKYFNEHKPARSCV 120
           IADKAEQVIQNV+NIL EANS LDKIVKVNIFLADI  FAEFN VY KYFN HKPARSCV
Sbjct: 60  IADKAEQVIQNVKNILVEANSDLDKIVKVNIFLADINSFAEFNSVYAKYFNVHKPARSCV 119

Query: 121 AVKALPLDVDLEMEVVAVEK 140
           A KALPL+VDLEMEV+AVEK
Sbjct: 120 AAKALPLNVDLEMEVIAVEK 139

>ADL077C [1664] [Homologous to ScYIL051C (MMF1) - SH; ScYER057C
           (HMF1) - SH] (549526..549954) [429 bp, 142 aa]
          Length = 142

 Score =  214 bits (545), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 98/129 (75%), Positives = 114/129 (88%)

Query: 12  RSMSTLTPVRTQLSPPPAASYSQAMRVNKMVFVSGQIPYTAENKRVEGTIADKAEQVIQN 71
           RSMS+LTPVRT  +PPPAASYSQAMR N MVFVSGQIPYT +NK VEG++ADK EQVI N
Sbjct: 13  RSMSSLTPVRTTAAPPPAASYSQAMRANGMVFVSGQIPYTPDNKPVEGSVADKTEQVIAN 72

Query: 72  VRNILEEANSGLDKIVKVNIFLADIKDFAEFNGVYGKYFNEHKPARSCVAVKALPLDVDL 131
           VRN+LE +NSGLD++ KVN+FLAD+  FAEFN VY KYF EHKPARSCVAV+ALPL+VDL
Sbjct: 73  VRNVLEASNSGLDRVAKVNVFLADMAYFAEFNSVYAKYFGEHKPARSCVAVRALPLNVDL 132

Query: 132 EMEVVAVEK 140
           EMEV+A+E+
Sbjct: 133 EMEVIALER 141

>Scas_704.34
          Length = 148

 Score =  211 bits (538), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 102/144 (70%), Positives = 121/144 (84%), Gaps = 4/144 (2%)

Query: 1   MFLRN----AARNTFRSMSTLTPVRTQLSPPPAASYSQAMRVNKMVFVSGQIPYTAENKR 56
           MFLRN    + +   RS++TLTPV T+L+PP AASYSQAM+ N  V+VSGQIPYT ENK 
Sbjct: 1   MFLRNTILRSRQPIVRSLTTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPENKP 60

Query: 57  VEGTIADKAEQVIQNVRNILEEANSGLDKIVKVNIFLADIKDFAEFNGVYGKYFNEHKPA 116
           VEGTI+DKAEQV QN++NIL+E+ S +DKIVKVN+FLADI +F EFNGVY KYFN HKPA
Sbjct: 61  VEGTISDKAEQVFQNIKNILKESGSSMDKIVKVNVFLADINNFKEFNGVYAKYFNVHKPA 120

Query: 117 RSCVAVKALPLDVDLEMEVVAVEK 140
           RSCVAVK LPL+VDLE+EV+AVEK
Sbjct: 121 RSCVAVKDLPLNVDLEVEVIAVEK 144

>YIL051C (MMF1) [2616] chr9 complement(257842..258279) Protein
           important for maintenance of mitochondrial DNA, may be
           involved in isoleucine-dependent transaminase activity,
           member of the p14.5 family [438 bp, 145 aa]
          Length = 145

 Score =  204 bits (518), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 119/144 (82%), Gaps = 4/144 (2%)

Query: 1   MFLRNAARNTF----RSMSTLTPVRTQLSPPPAASYSQAMRVNKMVFVSGQIPYTAENKR 56
           MFLRN+   T     R ++TLTPV T+L+PP AASYSQAM+ N  V+VSGQIPYT +NK 
Sbjct: 1   MFLRNSVLRTAPVLRRGITTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPDNKP 60

Query: 57  VEGTIADKAEQVIQNVRNILEEANSGLDKIVKVNIFLADIKDFAEFNGVYGKYFNEHKPA 116
           V+G+I++KAEQV QNV+NIL E+NS LD IVKVN+FLAD+K+FAEFN VY K+F+ HKPA
Sbjct: 61  VQGSISEKAEQVFQNVKNILAESNSSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHKPA 120

Query: 117 RSCVAVKALPLDVDLEMEVVAVEK 140
           RSCV V +LPL+VDLEMEV+AVEK
Sbjct: 121 RSCVGVASLPLNVDLEMEVIAVEK 144

>Scas_715.53
          Length = 128

 Score =  196 bits (498), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 107/126 (84%)

Query: 14  MSTLTPVRTQLSPPPAASYSQAMRVNKMVFVSGQIPYTAENKRVEGTIADKAEQVIQNVR 73
           M+TLTPV  + +P  AASYS AM+ N ++F+SGQIP TAENK VEG+IADKAEQVIQN++
Sbjct: 1   MTTLTPVTCKNAPSAAASYSHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIK 60

Query: 74  NILEEANSGLDKIVKVNIFLADIKDFAEFNGVYGKYFNEHKPARSCVAVKALPLDVDLEM 133
           N+LE +NS L+KIVKVNIFLADI  FAEFN VY KYFN HKPARSCVAV ALPL+ DLEM
Sbjct: 61  NVLEASNSSLEKIVKVNIFLADINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEM 120

Query: 134 EVVAVE 139
           EV+AVE
Sbjct: 121 EVIAVE 126

>CAGL0M12386g 1234993..1235421 similar to sp|P40037 Saccharomyces
           cerevisiae YER057c HIG1 Heat-shock induceable Inhibiter
           of cell Growth, hypothetical start
          Length = 142

 Score =  180 bits (457), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 110/128 (85%)

Query: 12  RSMSTLTPVRTQLSPPPAASYSQAMRVNKMVFVSGQIPYTAENKRVEGTIADKAEQVIQN 71
           R +S LTPV +  +PP AASYS AM+VN +++VSGQIPYT +NK VEG+I+DKAEQVIQN
Sbjct: 13  RQLSKLTPVISANAPPAAASYSHAMKVNNLIYVSGQIPYTKDNKPVEGSISDKAEQVIQN 72

Query: 72  VRNILEEANSGLDKIVKVNIFLADIKDFAEFNGVYGKYFNEHKPARSCVAVKALPLDVDL 131
           V+NIL+++NS L++IVKVNIFLAD+ +FAEFN VY KYFN HKPARSCVAV ALPL VDL
Sbjct: 73  VQNILKDSNSDLNRIVKVNIFLADMNNFAEFNKVYAKYFNVHKPARSCVAVAALPLGVDL 132

Query: 132 EMEVVAVE 139
           EMEV+A E
Sbjct: 133 EMEVIATE 140

>YER057C (HMF1) [1487] chr5 complement(270735..271124) Protein that
           inhibits cell growth and contributes to cell death at
           high temperature, member of the p14.5 family [390 bp,
           129 aa]
          Length = 129

 Score =  172 bits (435), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 87/127 (68%), Positives = 106/127 (83%)

Query: 14  MSTLTPVRTQLSPPPAASYSQAMRVNKMVFVSGQIPYTAENKRVEGTIADKAEQVIQNVR 73
           ++TLTPV  + +P  AASYS AM+VN ++F+SGQIP T +NK VEG+IADKAEQVIQN++
Sbjct: 2   VTTLTPVICESAPAAAASYSHAMKVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIK 61

Query: 74  NILEEANSGLDKIVKVNIFLADIKDFAEFNGVYGKYFNEHKPARSCVAVKALPLDVDLEM 133
           N+LE +NS LD++VKVNIFLADI  FAEFN VY KYFN HKPARSCVAV ALPL VD+EM
Sbjct: 62  NVLEASNSSLDRVVKVNIFLADINHFAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEM 121

Query: 134 EVVAVEK 140
           E +A E+
Sbjct: 122 EAIAAER 128

>Kwal_47.16590
          Length = 126

 Score = 60.8 bits (146), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 48/99 (48%), Gaps = 1/99 (1%)

Query: 39  NKMVFVSGQIPYTAENKRVEGTIADKAEQVIQNVRNILEEANSGLDKIVKVNIFLADIKD 98
           N  VF SG I        V   I D+    I+N+  +L    S L K+ KV +F++    
Sbjct: 26  NGHVFTSGIIGANYGTGEVPHEIEDQVHLAIKNLETVLVAGGSSLSKVFKVTMFISHADY 85

Query: 99  FAEFNGVYGKYFNEHKPARSCVAVKALPLDVDLEMEVVA 137
               N +YG YF  HKPARSCV V  +   +  E+E +A
Sbjct: 86  SKVVNEIYGHYF-PHKPARSCVVVAFMDAAIKYELEAIA 123

>Kwal_23.2807
          Length = 129

 Score = 56.6 bits (135), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 59/107 (55%), Gaps = 9/107 (8%)

Query: 35  AMRVNKMVFVSGQIPYTAENKRVEGTIADKAEQVI----QNVRNILEEANSGLDKIVKVN 90
           A + N +VF SG +        V G + +  EQ I    +N++N+L  + S L++++KV 
Sbjct: 25  ASKSNDLVFTSGCV----GTDPVTGNLPEDLEQQIINALENLKNVLHASGSSLERVLKVL 80

Query: 91  IFLADIKDFAEFNGVYGKYFNEHKPARSCVAVKALPLDVDLEMEVVA 137
           +F++D    +  N VY +YF  + PARSC+ V      + +E+E +A
Sbjct: 81  LFVSDASYASTVNEVYSRYF-PNAPARSCIVVAFPAPALKVELECIA 126

>Kwal_55.21247
          Length = 134

 Score = 52.0 bits (123), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 52/99 (52%), Gaps = 1/99 (1%)

Query: 39  NKMVFVSGQIPYTAENKRVEGTIADKAEQVIQNVRNILEEANSGLDKIVKVNIFLADIKD 98
           + +VF SG +        +   +  +    ++N++N+L  + S L++++KV +F++D   
Sbjct: 28  SDLVFTSGCVGTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSY 87

Query: 99  FAEFNGVYGKYFNEHKPARSCVAVKALPLDVDLEMEVVA 137
               N VY +YF    PARSC+ V      + +E+E +A
Sbjct: 88  APAVNKVYSEYF-PGAPARSCIVVSFPNASLKVELECIA 125

>KLLA0B14817g 1301705..1302100 similar to sp|Q8XCD0 Escherichia coli
           O157:H7 Orf, hypothetical protein, start by similarity
          Length = 131

 Score = 52.0 bits (123), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 52/99 (52%), Gaps = 1/99 (1%)

Query: 39  NKMVFVSGQIPYTAENKRVEGTIADKAEQVIQNVRNILEEANSGLDKIVKVNIFLADIKD 98
            ++V+ SG +        +   +  +    + N+  +L+ +NS  D ++K+ +F+AD   
Sbjct: 29  TELVYTSGCVGSDLLTGEIPEDLEKQVRNALDNLGRVLKASNSSFDDVLKILLFVADGSY 88

Query: 99  FAEFNGVYGKYFNEHKPARSCVAVKALPLDVDLEMEVVA 137
            +  N VY +YF E +PARSC+ V      + +E+E VA
Sbjct: 89  ASTVNAVYKEYFPE-RPARSCIVVSFPDPTLKVELECVA 126

>Scas_506.3
          Length = 689

 Score = 49.7 bits (117), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 63/120 (52%), Gaps = 12/120 (10%)

Query: 22  TQLSPPPAASYSQAM-RVNKMVFVSGQIPYTAENKRVEGTIADKAEQVIQNVRNILEEAN 80
           TQLS  P   Y  ++ +V  ++++S   P     K  E  +  +A+QV Q +  I++E +
Sbjct: 303 TQLSTIPECKYRNSVNKVGNLLYISNLCP-----KDSELNVEQQAKQVFQQLDKIMKENS 357

Query: 81  SGLDKIVKVNIFLADIKDFAEFNGVYGKYFNEHK-----PARSCVAVKALPLDVDLEMEV 135
               +I+  ++ LA++ +FA  N VY  +F  +K     P+R+CV    L  +V L++ V
Sbjct: 358 LFPSQILFSSLILANMSNFATVNQVYNDFFRINKWGPLPPSRACVG-SVLSNNVQLQLSV 416

>KLLA0E03894g complement(364475..364888) some similarities with
           sp|Q87LF6 Vibrio parahaemolyticus Conserved hypothetical
           protein, hypothetical start
          Length = 137

 Score = 45.8 bits (107), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 57/103 (55%), Gaps = 9/103 (8%)

Query: 39  NKMVFVSGQIPYTAENKRVEGTIADKAEQVIQNVRNILEEANSGLDKIVKVNIFLADIKD 98
           N+++F SG +        +   +  +A   + N++ +LE + S +D ++K+ +F++D   
Sbjct: 29  NQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSVDSVLKILLFVSD--- 85

Query: 99  FAEFNGVYGKYFNE---HKPARSCVAVKALPLD-VDLEMEVVA 137
              + G+  K F E   ++PARSC+ V A P + + +E+E +A
Sbjct: 86  -GSYAGIVNKVFKEFFPNQPARSCIVV-AFPNNKLKVELECIA 126

>YLR143W (YLR143W) [3552] chr12 (427330..429387) Protein containing
           an endoribonuclease L-PSP domain and a DUF71 domain of
           unknown function, has moderate similarity to
           uncharacterized C. albicans Orf6.3850p [2058 bp, 685 aa]
          Length = 685

 Score = 45.1 bits (105), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 32/132 (24%), Positives = 57/132 (43%), Gaps = 20/132 (15%)

Query: 22  TQLSPPPAASYSQAMRVNKMVFVSGQIPYTAENK------------RVEGTIADKAEQVI 69
           TQ  P   A   +    N M   S  +P T  NK            R   T+  ++E + 
Sbjct: 287 TQNLPKQQAKTGEQRFENHM---SNALPQTTINKTNDKLYISNLQSRKSETVEKQSEDIF 343

Query: 70  QNVRNILEEANSGLDKIVKVNIFLADIKDFAEFNGVYGKYFNEHK-----PARSCVAVKA 124
             + +IL       + I+  ++ + D+ +F + N +Y ++ +  K     P+R+CV  K 
Sbjct: 344 TELADILHSNQIPRNHILSASLLIRDMSNFGKINKIYNEFLDLSKYGPLPPSRACVGSKC 403

Query: 125 LPLDVDLEMEVV 136
           LP D  +++ VV
Sbjct: 404 LPEDCHVQLSVV 415

>CAGL0M04521g 496157..498223 similar to tr|Q12429 Saccharomyces
           cerevisiae YLR143w, hypothetical start
          Length = 688

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 54/105 (51%), Gaps = 10/105 (9%)

Query: 37  RVNKMVFVSGQIPYTAENKRVEGTIADKAEQVIQNVRNILEEANSGLDKIVKVNIFLADI 96
           R+  ++++S   P     +  +GT+ ++ + V+Q + NIL++ +     ++  ++ L D+
Sbjct: 318 RIGNLLYISNIQP-----QYKDGTVQEQVKDVLQQLDNILKDNHLTAKNVLYSSLLLTDM 372

Query: 97  KDFAEFNGVYGKYFNEHK-----PARSCVAVKALPLDVDLEMEVV 136
             FA  N  Y K+F+  K     PAR+C+    +     L++ VV
Sbjct: 373 SLFASVNQEYSKFFDIWKNGPLPPARACIESNIINDGSALQLSVV 417

>AGL164W [4148] [Homologous to ScYLR143W - SH]
           complement(388842..390902) [2061 bp, 686 aa]
          Length = 686

 Score = 40.4 bits (93), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 12/79 (15%)

Query: 70  QNVRNILEEANSGLDK--IVKVNIF-----LADIKDFAEFNGVYGKYFNEHK-----PAR 117
           +  R++ ++ N  L +  +VK  +      LAD+  FAE N  Y  YF+  +     P+R
Sbjct: 331 KQARDVFDQLNESLTRHGVVKAQVLSSVLLLADMGTFAEINTAYNGYFSIQEIGPLPPSR 390

Query: 118 SCVAVKALPLDVDLEMEVV 136
           +C+  K+L   + L++ VV
Sbjct: 391 ACIESKSLAPGIGLQLSVV 409

>KLLA0D16984g 1439669..1441759 similar to sgd|S0004133 Saccharomyces
           cerevisiae YLR143w, start by similarity
          Length = 696

 Score = 37.4 bits (85), Expect = 0.002,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 56/122 (45%), Gaps = 14/122 (11%)

Query: 19  PVRTQLSPPPAASYSQAMRVNKMVFVSGQIPYTAENKRVEGTIADKAEQVIQNVRNILEE 78
           P    +SP    S ++   V K++++S   P   E      ++ +K   V   + +IL  
Sbjct: 305 PNHHNVSPSVPVSINE---VGKLLYISNIAPSKGE------SLKEKCLDVFSQLTSILSS 355

Query: 79  ANSGLDKIVKVNIFLADIKDFAEFNGVYGKYFNEHK-----PARSCVAVKALPLDVDLEM 133
            +    +I+  ++ L+D+ +F E N  Y +YFN  K     PAR+CV    L   V L +
Sbjct: 356 RSIFACQILSSSLLLSDMNNFQEVNSYYNEYFNVTKIGPLPPARACVESSFLKHPVQLSV 415

Query: 134 EV 135
            V
Sbjct: 416 VV 417

>Kwal_27.11310
          Length = 688

 Score = 35.0 bits (79), Expect = 0.013,   Method: Composition-based stats.
 Identities = 19/79 (24%), Positives = 42/79 (53%), Gaps = 5/79 (6%)

Query: 63  DKAEQVIQNVRNILEEANSGLDKIVKVNIFLADIKDFAEFNGVYGKYFNEHK-----PAR 117
           +K + V + + +IL +      +I+   + LAD+ DF++ N  Y ++F+  +     P+R
Sbjct: 334 EKVQDVFRQLSDILRDYELSPAQILSSLVLLADMGDFSKVNEHYNEFFHVARNGPLPPSR 393

Query: 118 SCVAVKALPLDVDLEMEVV 136
           +CV    +  +  L++ V+
Sbjct: 394 ACVGSSLVGSENILQLSVI 412

>CAGL0L02959g 344703..346787 some similarities with sp|P47029
           Saccharomyces cerevisiae YJL084c or sp|P36117
           Saccharomyces cerevisiae YKR021w, hypothetical start
          Length = 694

 Score = 28.1 bits (61), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 21/73 (28%)

Query: 42  VFVSGQIPYTAENKRV-------------------EGTIADKAEQVIQNVRNILEEANSG 82
           +++S  I YTA +K +                   EGT +   +  ++N+ N+LE+ N+G
Sbjct: 301 IYLSETITYTATDKSITRIDSEKNYLLSELNGPVQEGTGSSGKKPGVKNLGNLLEDPNTG 360

Query: 83  --LDKIVKVNIFL 93
              +K  + NIF+
Sbjct: 361 DITNKAFQFNIFV 373

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.131    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,013,850
Number of extensions: 147566
Number of successful extensions: 560
Number of sequences better than 10.0: 25
Number of HSP's gapped: 555
Number of HSP's successfully gapped: 25
Length of query: 140
Length of database: 16,596,109
Length adjustment: 91
Effective length of query: 49
Effective length of database: 13,445,871
Effective search space: 658847679
Effective search space used: 658847679
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 56 (26.2 bits)