Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.579969562062e-23
YIL052C (RPL34B)121381747e-18
YER056C-A (RPL34A)121381739e-18
CAGL0M12408g128381652e-16
ADL078C126381634e-16
KLLA0C08371g125381582e-15
Scas_704.33*124381546e-15
Scas_715.54*125381547e-15
Scas_20.1*5921924e-06
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.5799
         (69 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.5799                                                           84   2e-23
YIL052C (RPL34B) [2615] chr9 complement(256224..256552,257025..2...    72   7e-18
YER056C-A (RPL34A) [1486] chr5 complement(269421..269749,270147....    71   9e-18
CAGL0M12408g join(1236607..1236643,1237307..1237656) highly simi...    68   2e-16
ADL078C [1663] [Homologous to ScYIL052C (RPL34B) - SH; ScYER056C...    67   4e-16
KLLA0C08371g join(732878..732914,733482..733822) highly similar ...    65   2e-15
Scas_704.33*                                                           64   6e-15
Scas_715.54*                                                           64   7e-15
Scas_20.1*                                                             40   4e-06

>Kwal_23.5799
          Length = 69

 Score = 84.0 bits (206), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 42/56 (75%)

Query: 1  MRPREYATVSKTHKTVSRAYGGVLCANAVKERIVRAFLXXXXXXXXXXXXXXADAA 56
          MRPREYATVSKTHKTVSRAYGGVLCANAVKERIVRAFL              ADAA
Sbjct: 1  MRPREYATVSKTHKTVSRAYGGVLCANAVKERIVRAFLIEEQKIVKKVVKEQADAA 56

>YIL052C (RPL34B) [2615] chr9
          complement(256224..256552,257025..257061) Ribosomal
          protein L34 (rat L34), nearly identical to Rpl34Ap [366
          bp, 121 aa]
          Length = 121

 Score = 71.6 bits (174), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 33/38 (86%), Positives = 35/38 (92%)

Query: 1  MRPREYATVSKTHKTVSRAYGGVLCANAVKERIVRAFL 38
          +RPR+YATVSKTHKTVSRAYGG  CAN VKERIVRAFL
Sbjct: 57 LRPRQYATVSKTHKTVSRAYGGSRCANCVKERIVRAFL 94

>YER056C-A (RPL34A) [1486] chr5
          complement(269421..269749,270147..270183) Ribosomal
          protein L34 (rat L34), nearly identical to Rpl34Bp [366
          bp, 121 aa]
          Length = 121

 Score = 71.2 bits (173), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 35/38 (92%)

Query: 1  MRPREYATVSKTHKTVSRAYGGVLCANAVKERIVRAFL 38
          +RPR+YATVSKTHKTVSRAYGG  CAN VKERI+RAFL
Sbjct: 57 LRPRQYATVSKTHKTVSRAYGGSRCANCVKERIIRAFL 94

>CAGL0M12408g join(1236607..1236643,1237307..1237656) highly
          similar to sp|P40525 Saccharomyces cerevisiae YIL052c
          RPL34B or sp|P87262 Saccharomyces cerevisiae YER056BC
          RPL34A
          Length = 128

 Score = 68.2 bits (165), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 30/38 (78%), Positives = 34/38 (89%)

Query: 1  MRPREYATVSKTHKTVSRAYGGVLCANAVKERIVRAFL 38
          +RPR+YA++SKTHKTVSR YGG  CAN VKERIVRAFL
Sbjct: 57 LRPRQYASISKTHKTVSRVYGGSRCANCVKERIVRAFL 94

>ADL078C [1663] [Homologous to ScYIL052C (RPL34B) - SH;
          ScYER056C-A (RPL34A) - SH]
          (548697..549040,549209..549245) [381 bp, 126 aa]
          Length = 126

 Score = 67.4 bits (163), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 30/38 (78%), Positives = 34/38 (89%)

Query: 1  MRPREYATVSKTHKTVSRAYGGVLCANAVKERIVRAFL 38
          +RPR+YA+VSKTHKTVSR YGG  CAN VK+RIVRAFL
Sbjct: 57 LRPRQYASVSKTHKTVSRPYGGSRCANCVKQRIVRAFL 94

>KLLA0C08371g join(732878..732914,733482..733822) highly similar
          to sp|P40525 Saccharomyces cerevisiae YIL052c RPL34B
          ribosomal protein or sp|P87262 Saccharomyces cerevisiae
          YER056ca ribosomal protein, start by similarity
          Length = 125

 Score = 65.5 bits (158), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 31/38 (81%), Positives = 34/38 (89%)

Query: 1  MRPREYATVSKTHKTVSRAYGGVLCANAVKERIVRAFL 38
          +RPR+YATVS+T KTVSRAYGG   ANAVKERIVRAFL
Sbjct: 57 LRPRQYATVSRTKKTVSRAYGGSKSANAVKERIVRAFL 94

>Scas_704.33*
          Length = 124

 Score = 63.9 bits (154), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 28/38 (73%), Positives = 33/38 (86%)

Query: 1  MRPREYATVSKTHKTVSRAYGGVLCANAVKERIVRAFL 38
          +RPR+YA++SKT KTVSR YGG  C+N VKERIVRAFL
Sbjct: 57 LRPRQYASISKTSKTVSRVYGGSRCSNCVKERIVRAFL 94

>Scas_715.54*
          Length = 125

 Score = 63.9 bits (154), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 28/38 (73%), Positives = 33/38 (86%)

Query: 1  MRPREYATVSKTHKTVSRAYGGVLCANAVKERIVRAFL 38
          +RPR+YA++SKT KTVSR YGG  C+N VKERIVRAFL
Sbjct: 57 LRPRQYASISKTSKTVSRVYGGSRCSNCVKERIVRAFL 94

>Scas_20.1*
          Length = 59

 Score = 40.0 bits (92), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 18/21 (85%), Positives = 18/21 (85%)

Query: 18 RAYGGVLCANAVKERIVRAFL 38
          RAYGG  CAN VKERIVRAFL
Sbjct: 39 RAYGGSRCANCVKERIVRAFL 59

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.128    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 983,132
Number of extensions: 14824
Number of successful extensions: 42
Number of sequences better than 10.0: 9
Number of HSP's gapped: 42
Number of HSP's successfully gapped: 9
Length of query: 69
Length of database: 16,596,109
Length adjustment: 42
Effective length of query: 27
Effective length of database: 15,142,153
Effective search space: 408838131
Effective search space used: 408838131
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 54 (25.4 bits)