Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.57891133111759940.0
Sklu_2193.11143113946450.0
KLLA0C08393g1148114242850.0
Scas_704.381161115242780.0
YIL048W (NEO1)1151114242670.0
CAGL0L00715g1144113541300.0
ADL079C1166116041270.0
Scas_89.127125411831e-154
CAGL0G06270g1328103911351e-134
KLLA0A04015g1343103611341e-134
Kwal_26.7070131594011291e-134
YAL026C (DRS2)1355104311091e-131
ADR350W131186910391e-121
YER166W (DNF1)15718899001e-101
Scas_576.815919998723e-97
CAGL0L11814g15768638633e-96
Scas_636.1615548918607e-96
YDR093W (DNF2)16128798546e-95
KLLA0C17644g15768908474e-94
CAGL0G08085g15788938422e-93
AGR120C15479878377e-93
KLLA0E01650g15504045523e-57
CAGL0H04477g16264455516e-57
YMR162C (DNF3)16564425338e-55
Kwal_23.355615974075302e-54
AFL191W15753565231e-53
Scas_669.316384315071e-51
Scas_505.410253523621e-34
Kwal_26.920714697972692e-23
KLLA0B08217g14397252575e-22
Scas_665.3014397872567e-22
AFR567W14497082541e-21
YOR291W14727262352e-19
KLLA0A08910g12807682227e-18
CAGL0M11308g14527202227e-18
CAGL0A00517g11227782191e-17
Kwal_23.316011007712145e-17
CAGL0I04312g9517922111e-16
KLLA0F20658g10825402065e-16
YDR039C (ENA2)10918342056e-16
YDR038C (ENA5)10918342056e-16
YDR040C (ENA1)10917632047e-16
Kwal_47.1754712405302031e-15
Kwal_14.14989397792012e-15
AGL097C10967601903e-14
CAGL0J01870g9467351904e-14
CAGL0K12034g10877691885e-14
AFL011W12429321852e-13
YGL167C (PMR1)9507881823e-13
KLLA0E14630g10827431805e-13
AEL301W9576861716e-12
Scas_707.48*7416801681e-11
KLLA0A03157g9387081538e-10
YGL006W (PMC1)11733701521e-09
CAGL0L01419g12145491466e-09
YPL036W (PMA2)9475481412e-08
YGL008C (PMA1)9185521384e-08
Scas_688.19134661367e-08
AGL085C9094601342e-07
Kwal_47.175228994691322e-07
KLLA0A09031g8994691313e-07
AFR354C12102841199e-06
YEL031W (SPF1)12155611134e-05
CAGL0A00495g9024771118e-05
Scas_583.14*8754321072e-04
KLLA0E22352g12065611000.001
Scas_710.41904279940.006
KLLA0F07447g97590900.019
AGL041C123357860.065
Scas_227.0d307114830.081
KLLA0D04092g115241850.082
Scas_297.1800192800.30
Scas_678.1929845770.43
Scas_569.0d468210760.71
Kwal_26.7055155564741.7
YBR295W (PCA1)121649732.1
YDR270W (CCC2)100465722.6
Kwal_55.2157598974722.7
Scas_675.36557115722.8
YKL139W (CTK1)52854713.4
ADL122C31482685.5
CAGL0M08602g1012165695.9
Sklu_1951.532771686.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.5789
         (1117 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.5789                                                         2313   0.0  
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement        1793   0.0  
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...  1655   0.0  
Scas_704.38                                                          1652   0.0  
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...  1648   0.0  
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...  1595   0.0  
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...  1594   0.0  
Scas_89.1                                                             460   e-154
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...   441   e-134
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...   441   e-134
Kwal_26.7070                                                          439   e-134
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...   431   e-131
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...   404   e-121
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...   351   e-101
Scas_576.8                                                            340   3e-97
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...   337   3e-96
Scas_636.16                                                           335   7e-96
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...   333   6e-95
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...   330   4e-94
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...   328   2e-93
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...   327   7e-93
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...   217   3e-57
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...   216   6e-57
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...   209   8e-55
Kwal_23.3556                                                          208   2e-54
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...   206   1e-53
Scas_669.3                                                            199   1e-51
Scas_505.4                                                            144   1e-34
Kwal_26.9207                                                          108   2e-23
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...   103   5e-22
Scas_665.30                                                           103   7e-22
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...   102   1e-21
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    95   2e-19
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...    90   7e-18
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...    90   7e-18
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...    89   1e-17
Kwal_23.3160                                                           87   5e-17
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...    86   1e-16
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    84   5e-16
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...    84   6e-16
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...    84   6e-16
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...    83   7e-16
Kwal_47.17547                                                          83   1e-15
Kwal_14.1498                                                           82   2e-15
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....    78   3e-14
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    78   4e-14
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    77   5e-14
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    76   2e-13
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...    75   3e-13
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...    74   5e-13
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...    70   6e-12
Scas_707.48*                                                           69   1e-11
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....    64   8e-10
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...    63   1e-09
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    61   6e-09
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    59   2e-08
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...    58   4e-08
Scas_688.1                                                             57   7e-08
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...    56   2e-07
Kwal_47.17522                                                          55   2e-07
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    55   3e-07
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    50   9e-06
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    48   4e-05
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    47   8e-05
Scas_583.14*                                                           46   2e-04
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    43   0.001
Scas_710.41                                                            41   0.006
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...    39   0.019
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...    38   0.065
Scas_227.0d                                                            37   0.081
KLLA0D04092g complement(344666..348124) some similarities with s...    37   0.082
Scas_297.1                                                             35   0.30 
Scas_678.19                                                            34   0.43 
Scas_569.0d                                                            34   0.71 
Kwal_26.7055                                                           33   1.7  
YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transpo...    33   2.1  
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...    32   2.6  
Kwal_55.21575                                                          32   2.7  
Scas_675.36                                                            32   2.8  
YKL139W (CTK1) [3128] chr11 (182963..184549) C-terminal domain (...    32   3.4  
ADL122C [1619] [Homologous to ScYIL019W - SH] (475029..475973) [...    31   5.5  
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...    31   5.9  
Sklu_1951.5 YMR033W, Contig c1951 5929-6912 reverse complement         31   6.6  

>Kwal_23.5789
          Length = 1133

 Score = 2313 bits (5994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1117/1117 (100%), Positives = 1117/1117 (100%)

Query: 1    MSFSPPPGSNKESIPHNNRHNSFDLLDPQLEDSLDAALESLQIHTGGSPAREDFEMTSLR 60
            MSFSPPPGSNKESIPHNNRHNSFDLLDPQLEDSLDAALESLQIHTGGSPAREDFEMTSLR
Sbjct: 1    MSFSPPPGSNKESIPHNNRHNSFDLLDPQLEDSLDAALESLQIHTGGSPAREDFEMTSLR 60

Query: 61   SNESQKNARQSDTEPLINNGATAPNSWSHDPRHDSDRSTASGSPFWSRITKFMRSSHSPK 120
            SNESQKNARQSDTEPLINNGATAPNSWSHDPRHDSDRSTASGSPFWSRITKFMRSSHSPK
Sbjct: 61   SNESQKNARQSDTEPLINNGATAPNSWSHDPRHDSDRSTASGSPFWSRITKFMRSSHSPK 120

Query: 121  VSTYKATSNSIQLKDDQQLDREIHPSTTPVYDRYKYAPNAISNAKYNPVTFIPKILYEQF 180
            VSTYKATSNSIQLKDDQQLDREIHPSTTPVYDRYKYAPNAISNAKYNPVTFIPKILYEQF
Sbjct: 121  VSTYKATSNSIQLKDDQQLDREIHPSTTPVYDRYKYAPNAISNAKYNPVTFIPKILYEQF 180

Query: 181  KFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFVLTVTMSKEALDDIQRRRRDRESNNE 240
            KFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFVLTVTMSKEALDDIQRRRRDRESNNE
Sbjct: 181  KFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFVLTVTMSKEALDDIQRRRRDRESNNE 240

Query: 241  LYEVLSKSQLVPSKDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWK 300
            LYEVLSKSQLVPSKDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWK
Sbjct: 241  LYEVLSKSQLVPSKDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWK 300

Query: 301  LRIACPLTQHLSQDDLLYRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVF 360
            LRIACPLTQHLSQDDLLYRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVF
Sbjct: 301  LRIACPLTQHLSQDDLLYRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVF 360

Query: 361  ASAGTAIACVVYTGADTRQAMNTSMSSVKTGLLELEINSLSKILCACVFILSVALVAFAG 420
            ASAGTAIACVVYTGADTRQAMNTSMSSVKTGLLELEINSLSKILCACVFILSVALVAFAG
Sbjct: 361  ASAGTAIACVVYTGADTRQAMNTSMSSVKTGLLELEINSLSKILCACVFILSVALVAFAG 420

Query: 421  FNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPEDL 480
            FNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPEDL
Sbjct: 421  FNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPEDL 480

Query: 481  GRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDTMDIVTDYVRAMSDNLNSSAVPSASK 540
            GRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDTMDIVTDYVRAMSDNLNSSAVPSASK
Sbjct: 481  GRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDTMDIVTDYVRAMSDNLNSSAVPSASK 540

Query: 541  KDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDEIAIVKFTESVGLTLFRRDRHSI 600
            KDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDEIAIVKFTESVGLTLFRRDRHSI
Sbjct: 541  KDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDEIAIVKFTESVGLTLFRRDRHSI 600

Query: 601  TLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWFLQKGADVVMSKIVQKNDW 660
            TLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWFLQKGADVVMSKIVQKNDW
Sbjct: 601  TLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWFLQKGADVVMSKIVQKNDW 660

Query: 661  LEEETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHD 720
            LEEETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHD
Sbjct: 661  LEEETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHD 720

Query: 721  LEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQYVHT 780
            LEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQYVHT
Sbjct: 721  LEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQYVHT 780

Query: 781  VTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVVNLPAVIACRCTP 840
            VTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVVNLPAVIACRCTP
Sbjct: 781  VTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVVNLPAVIACRCTP 840

Query: 841  QQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQFC 900
            QQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQFC
Sbjct: 841  QQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQFC 900

Query: 901  HLSKLLLWHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGWLMVGYAT 960
            HLSKLLLWHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGWLMVGYAT
Sbjct: 901  HLSKLLLWHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGWLMVGYAT 960

Query: 961  CYTMAPVFSLTLDHDIDESLTKTYPELYKELTAGKSLSYKTFFVWVVLSLFQGCVIQGLS 1020
            CYTMAPVFSLTLDHDIDESLTKTYPELYKELTAGKSLSYKTFFVWVVLSLFQGCVIQGLS
Sbjct: 961  CYTMAPVFSLTLDHDIDESLTKTYPELYKELTAGKSLSYKTFFVWVVLSLFQGCVIQGLS 1020

Query: 1021 QGFTSLDELDFKRLVALSFTVLILNELIMVAIEIYTWNKTMVVSEVVTFLIFVGSVPLLE 1080
            QGFTSLDELDFKRLVALSFTVLILNELIMVAIEIYTWNKTMVVSEVVTFLIFVGSVPLLE
Sbjct: 1021 QGFTSLDELDFKRLVALSFTVLILNELIMVAIEIYTWNKTMVVSEVVTFLIFVGSVPLLE 1080

Query: 1081 EYFDLTYMSRPEYYGKLAIILSLSIIPVWAAKALHRR 1117
            EYFDLTYMSRPEYYGKLAIILSLSIIPVWAAKALHRR
Sbjct: 1081 EYFDLTYMSRPEYYGKLAIILSLSIIPVWAAKALHRR 1117

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score = 1793 bits (4645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 867/1139 (76%), Positives = 984/1139 (86%), Gaps = 33/1139 (2%)

Query: 1    MSFSPPPGSNK--ESIPHNNRHNSFDLLDPQLEDSLDAALESLQIHTGGSPAREDFEMTS 58
            MSFSPPPGSNK  ++   NN  +S D  D Q EDSLDAALESLQI+   + + E+FEM +
Sbjct: 1    MSFSPPPGSNKLNQAPSSNNGRSSIDSFDLQFEDSLDAALESLQINNSLNTSGENFEMRT 60

Query: 59   LRS----------------NESQKNARQS---DTEPLINNGATAPNSWSHDPRHDSDRST 99
            +                  N+S KN   S   DT+PLI    T    WS++      +  
Sbjct: 61   IDQDGDDTQSFKHSRVSSLNDSAKNTHLSSGRDTQPLI---GTTQEPWSNN------QQG 111

Query: 100  ASGSPFWSRITKFMRSSHSPKVSTYKATSNSIQLKDDQQLDREIHPSTTPVYDRYKYAPN 159
            ++ SP WS+  + +++  +  +S Y++T++SI+L D Q ++REIHP TTP+YD+ KY  N
Sbjct: 112  SNQSP-WSKFIRLIKTPTTTDLSKYRSTNSSIELTD-QHVEREIHPDTTPIYDKNKYPSN 169

Query: 160  AISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFVLTVT 219
            AISNAKYNP+TFIP ILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFVL VT
Sbjct: 170  AISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFVLMVT 229

Query: 220  MSKEALDDIQRRRRDRESNNELYEVLSKSQLVPSKDLKVGDLIKIGKGARAPADLVLLQS 279
            MSKEA+DDIQRR+RD+ESNNELYEVL+K+QLVPSKDLKVGDLIKI KG R PADLVLLQS
Sbjct: 230  MSKEAMDDIQRRQRDKESNNELYEVLNKAQLVPSKDLKVGDLIKIHKGTRIPADLVLLQS 289

Query: 280  SEPSGEIFIKTDQLDGETDWKLRIACPLTQHLSQDDLLYRISITASVPEKSINNFLGKLT 339
            SEPSGE FIKTDQLDGETDWKLR+AC LTQ+LS DDLL +ISITAS PEKSI+ FLGKLT
Sbjct: 290  SEPSGESFIKTDQLDGETDWKLRVACSLTQNLSTDDLLNKISITASSPEKSIHRFLGKLT 349

Query: 340  FGEIQSQPLSVDNTMWANTVFASAGTAIACVVYTGADTRQAMNTSMSSVKTGLLELEINS 399
            + +  S  LSVDNTMWANTV AS G+ I CVVYTG DTRQAMNT+MSSVKTGLLELEINS
Sbjct: 350  YKDSSSNALSVDNTMWANTVLASVGSCIGCVVYTGTDTRQAMNTTMSSVKTGLLELEINS 409

Query: 400  LSKILCACVFILSVALVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQ 459
            LSKILCACVF+LS+ LVAFAGF N DWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYA Q
Sbjct: 410  LSKILCACVFVLSIVLVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQ 469

Query: 460  IEHDSTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDTMDIV 519
            IEHD+TIP+TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDM+LKKLHLGTVSYTMDTMDIV
Sbjct: 470  IEHDATIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLGTVSYTMDTMDIV 529

Query: 520  TDYVRAMSDNLNSSAVP-SASKKDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDE 578
            TDYV+ +  +  ++ +P S +KKDLP RVRDLV+TLA+CH VTPTFEDGELTYQAASPDE
Sbjct: 530  TDYVQELVSSSTTTPMPQSTAKKDLPNRVRDLVVTLAICHNVTPTFEDGELTYQAASPDE 589

Query: 579  IAIVKFTESVGLTLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKD 638
            IAIVKFTESVGL+LF+RDRHS++L H  S TNFEYDIL VFPFNSD KRMGI+++DK K 
Sbjct: 590  IAIVKFTESVGLSLFKRDRHSVSLFHQHSATNFEYDILQVFPFNSDTKRMGIIVYDKVKG 649

Query: 639  EYWFLQKGADVVMSKIVQKNDWLEEETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDA 698
            E+WF+QKGAD VM++IVQ NDWL+EE GN+AREGLRTLVIGRK+LS K  + F K+Y DA
Sbjct: 650  EHWFMQKGADTVMARIVQSNDWLDEEVGNMAREGLRTLVIGRKKLSPKSYEQFRKEYHDA 709

Query: 699  SLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDK 758
            SL MLNR+ TMS+VI KHLEH+LE+LGLTGVEDKLQ DVKSSIELLRNAG+KIWMLTGDK
Sbjct: 710  SLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVKIWMLTGDK 769

Query: 759  VETARCVSISAKLVSRGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEY 818
            VETARCVSISAKL+SRGQYVHTVTK+++PEGAL  LE LKIN +SCLLIDGESLG++L Y
Sbjct: 770  VETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLIDGESLGMFLTY 829

Query: 819  YRQQFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGV 878
            Y+Q+FF+IVV+LPAVIACRCTPQQKADVA  IRE+TGKRVCCIGDGGNDVSMIQ ADVGV
Sbjct: 830  YKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSMIQCADVGV 889

Query: 879  GIVGKEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRSAKLAQFVIHRGLLISVCQAVY 938
            GIVGKEGKQASLAADFS+TQFCHL+KLLLWHGRNSYKRSAKLAQFVIHRGL+ISVCQAVY
Sbjct: 890  GIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHRGLIISVCQAVY 949

Query: 939  SISSKFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKTYPELYKELTAGKSLS 998
            S+ SKFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTK YPELYKELTAG SLS
Sbjct: 950  SVCSKFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKIYPELYKELTAGTSLS 1009

Query: 999  YKTFFVWVVLSLFQGCVIQGLSQGFTSLDELDFKRLVALSFTVLILNELIMVAIEIYTWN 1058
            YKTFFVWV+LSLFQGC IQG+SQ FTSLDE+DFK+LVALSFT L++NELIMVA+EIYTWN
Sbjct: 1010 YKTFFVWVILSLFQGCAIQGISQYFTSLDEVDFKKLVALSFTALVINELIMVALEIYTWN 1069

Query: 1059 KTMVVSEVVTFLIFVGSVPLLEEYFDLTYMSRPEYYGKLAIILSLSIIPVWAAKALHRR 1117
            KTMV++E+VTFLI+V SVP L EYFDLT++S+  +Y KL  IL++S+ PVWAAKA+HR+
Sbjct: 1070 KTMVITEIVTFLIYVVSVPFLSEYFDLTFVSQLPFYAKLIFILAVSVFPVWAAKAIHRK 1128

>KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, start by similarity
          Length = 1148

 Score = 1655 bits (4285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 815/1142 (71%), Positives = 946/1142 (82%), Gaps = 34/1142 (2%)

Query: 1    MSFSPPPGS---NK--ESIPHNNRHNSFDLLDPQLEDSLDAALESLQI--HTG---GSPA 50
            MSFSPPPGS   NK  +S  H  +    D  D Q EDSLDAALESLQ+  H+     S  
Sbjct: 1    MSFSPPPGSQIPNKYSKSNQHQAQSTDRDSFDLQFEDSLDAALESLQLPEHSHRRENSTV 60

Query: 51   REDFEMTSLRSN-ESQKNARQSDTEPLI----NNGATAPNSWSHDPRHDSDRSTASGSPF 105
             EDFEM S+  + ++      +DT PLI    NNG    NS       D +    +    
Sbjct: 61   FEDFEMKSMHGDHQTGMLHSDADTAPLITNHSNNGRMLSNS-------DRNAQNTNNITV 113

Query: 106  WSRITK-----FMRSSHSPK-VSTYKATS----NSIQLKDDQQLDREIHPSTTPVYDRYK 155
            WS+        F ++   P  +S Y +T+    N I+L +D  ++REIHP+TTP+YDR K
Sbjct: 114  WSKAKSWFEHSFTKAKSKPSSLSVYSSTNSVDGNKIEL-NDHNVEREIHPATTPIYDRKK 172

Query: 156  YAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFV 215
            Y  N ISNAKYNP TFIP ILYEQFKFFFNLYFL+VALSQAIP LRIGYLSSYIVPLAFV
Sbjct: 173  YPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVALSQAIPQLRIGYLSSYIVPLAFV 232

Query: 216  LTVTMSKEALDDIQRRRRDRESNNELYEVLSKSQLVPSKDLKVGDLIKIGKGARAPADLV 275
            LTVTMSKEA+DDI RR+RDRE+NNELYEV++K   +PSKDLKVGD+IK+ KGAR PAD+V
Sbjct: 233  LTVTMSKEAMDDINRRKRDREANNELYEVVNKPCPIPSKDLKVGDIIKLKKGARVPADVV 292

Query: 276  LLQSSEPSGEIFIKTDQLDGETDWKLRIACPLTQHLSQDDLLYRISITASVPEKSINNFL 335
            +LQ++EP+GE FIKTDQLDGETDWKLR+AC LTQ L+++DLL  I+ITAS PE SI+NFL
Sbjct: 293  VLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSLTENDLLNNITITASAPEHSIHNFL 352

Query: 336  GKLTFGEIQSQPLSVDNTMWANTVFASAGTAIACVVYTGADTRQAMNTSMSSVKTGLLEL 395
            GK+T+ +  S PLSVDNTMW NTV AS+   I C+VYTG +TRQA+NT+ S  KTGLLEL
Sbjct: 353  GKITYKDSTSSPLSVDNTMWENTVLASSAACICCIVYTGRETRQALNTTKSKAKTGLLEL 412

Query: 396  EINSLSKILCACVFILSVALVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSV 455
            EIN LSKILCACVF+LS+ LVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSV
Sbjct: 413  EINGLSKILCACVFLLSIMLVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSV 472

Query: 456  YAHQIEHDSTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDT 515
            YA++IEHD  I +TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDM+LKK+HLGTVSYT +T
Sbjct: 473  YAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTNET 532

Query: 516  MDIVTDYVRAMSDNLNSSAVPSASKKDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAAS 575
            MDIVTD++++M ++  S++ P+ ++K++  RV DLV TLA+CH VTPTFEDGELTYQAAS
Sbjct: 533  MDIVTDFIQSM-NSRTSNSTPTTTRKNISDRVIDLVTTLAICHNVTPTFEDGELTYQAAS 591

Query: 576  PDEIAIVKFTESVGLTLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDK 635
            PDEIAIVKFTESVGL+LFRRDRHSI+L HD SG   EYDI  +FPFNSD+KRMG++IFDK
Sbjct: 592  PDEIAIVKFTESVGLSLFRRDRHSISLFHDHSGMKLEYDIKILFPFNSDSKRMGVIIFDK 651

Query: 636  QKDEYWFLQKGADVVMSKIVQKNDWLEEETGNLAREGLRTLVIGRKRLSKKLLQTFTKDY 695
             K EYWFLQKGAD VMS IV +NDWLEEET N+A EGLRTLVIGRK+LS  L + F K+Y
Sbjct: 652  LKQEYWFLQKGADTVMSSIVVRNDWLEEETSNMATEGLRTLVIGRKKLSTNLFEQFEKEY 711

Query: 696  EDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLT 755
             +ASL M++REV M NV+ K LE+DLE+LGLTGVEDKLQ+DVKSSIELLRNAGIKIWMLT
Sbjct: 712  SEASLTMMDREVHMQNVVRKFLENDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLT 771

Query: 756  GDKVETARCVSISAKLVSRGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGESLGLY 815
            GDKVETARCVSISAKL+SRGQYVHTVTKVNKPEGAL HLE L++N NSCLLIDGESLGLY
Sbjct: 772  GDKVETARCVSISAKLISRGQYVHTVTKVNKPEGALHHLEYLQVNQNSCLLIDGESLGLY 831

Query: 816  LEYYRQQFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSAD 875
            L+Y+  +FF+IVVNLP V+ACRCTPQQKADVA FIR+ TGKRVCCIGDGGNDVSMIQ AD
Sbjct: 832  LQYFPDEFFDIVVNLPTVVACRCTPQQKADVAVFIRQATGKRVCCIGDGGNDVSMIQCAD 891

Query: 876  VGVGIVGKEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRSAKLAQFVIHRGLLISVCQ 935
            VGVGIVGKEGKQASLAADFSITQFCHL+KLLLWHGRNSYK SAKL+QFVIHRGL+ISVCQ
Sbjct: 892  VGVGIVGKEGKQASLAADFSITQFCHLTKLLLWHGRNSYKSSAKLSQFVIHRGLIISVCQ 951

Query: 936  AVYSISSKFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKTYPELYKELTAGK 995
            AVYSI S FEP+ALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLT  YPELYKELT GK
Sbjct: 952  AVYSICSMFEPLALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTTLYPELYKELTLGK 1011

Query: 996  SLSYKTFFVWVVLSLFQGCVIQGLSQGFTSLDELDFKRLVALSFTVLILNELIMVAIEIY 1055
            SLS+KTFFVWV LS+FQGCVIQ  SQ FTSL++ DF ++VA+SFT L+LNELIMV +EI 
Sbjct: 1012 SLSFKTFFVWVALSVFQGCVIQMASQFFTSLNDSDFTKMVAISFTALVLNELIMVGLEIN 1071

Query: 1056 TWNKTMVVSEVVTFLIFVGSVPLLEEYFDLTYMSRPEYYGKLAIILSLSIIPVWAAKALH 1115
            TWNK M ++EVVT LI++GS+P L EYFDL+Y+S  ++  ++ +IL +S++PVWAAK+++
Sbjct: 1072 TWNKIMAITEVVTLLIYLGSIPFLGEYFDLSYVSTTKFPLRVLVILVISVVPVWAAKSIY 1131

Query: 1116 RR 1117
            RR
Sbjct: 1132 RR 1133

>Scas_704.38
          Length = 1161

 Score = 1652 bits (4278), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 804/1152 (69%), Positives = 949/1152 (82%), Gaps = 41/1152 (3%)

Query: 1    MSFSP---PPGSNKESIPHNNRHNSFDLLDPQLEDSLDAALESLQIHT------------ 45
            M FSP   P      SI   N  +SFDL   Q EDS DA L++++++T            
Sbjct: 1    MPFSPSLNPDRQKSNSIGPRNSADSFDL---QFEDSFDAVLDNIELNTDTRNQNNTLPNN 57

Query: 46   ---------GGSPAREDFEMTSLRSNES----QKNARQSDTEPLINNGATAPNS--WSHD 90
                          +E FEM SL +        +N+   D +PL+++ A+ P+   + + 
Sbjct: 58   QNINKASSENKDKLQESFEMKSLNARNGGLGHSRNSSNGDRQPLMHDSASNPDGSPYKYT 117

Query: 91   PRHDSDRSTASGSPFWSRITKFMRSSHSPKVSTYKATSNSIQLKDDQQLDREIHPSTTPV 150
               +S  +  S + F + ITK ++   + K   +  T  S++L DD+ ++REIHPSTTPV
Sbjct: 118  NVSESALNLHSNNRFSNWITK-LKMVGAQKWKKFH-TMGSVEL-DDRHMEREIHPSTTPV 174

Query: 151  YDRYKYAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIV 210
            YDR +Y  N ISNAKYN  TFIP +LYEQFKFF+NLYFL+VALSQAIPALRIGYLSSY+V
Sbjct: 175  YDRNRYPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVV 234

Query: 211  PLAFVLTVTMSKEALDDIQRRRRDRESNNELYEVLSKSQLVPSKDLKVGDLIKIGKGARA 270
            PLAFVLTVTMSKEA+DDIQRRRRD ESN+ELY VL++S+LVPSKDLKVGDLIKI KG R 
Sbjct: 235  PLAFVLTVTMSKEAMDDIQRRRRDNESNSELYHVLNQSKLVPSKDLKVGDLIKISKGDRL 294

Query: 271  PADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLTQHLSQDDLLYRISITASVPEKS 330
            PADLVLLQSSEPSGE FIKTDQLDGETDWKLRIA  LTQ+L++ DL+ ++SITAS PEK+
Sbjct: 295  PADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNLTEPDLMNKVSITASAPEKA 354

Query: 331  INNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAIACVVYTGADTRQAMNTSMSSVKT 390
            I+NFLGK+T+ +  S PLS+DNT+WANTV AS G  I CVVYTG DTRQAMNT+ ++VKT
Sbjct: 355  IHNFLGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIGCVVYTGRDTRQAMNTTTATVKT 414

Query: 391  GLLELEINSLSKILCACVFILSVALVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLD 450
            GLLELEINS+SKILCA VF LS+ LV FAGF+N+DWY+D+MRYLILFSTIIPVSLRVNLD
Sbjct: 415  GLLELEINSISKILCASVFALSIILVVFAGFHNSDWYLDVMRYLILFSTIIPVSLRVNLD 474

Query: 451  LGKSVYAHQIEHDSTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVS 510
            L KSVYAHQIEHD TIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDM+LKK+HLGTVS
Sbjct: 475  LAKSVYAHQIEHDDTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVS 534

Query: 511  YTMDTMDIVTDYVRAMSDNLNSS-----AVPSASKKDLPGRVRDLVLTLALCHQVTPTFE 565
            YT +T+DIV+DYV A+ ++ NS+     +VPS S+KDL  RVRD+V+TLA+CH VTPTFE
Sbjct: 535  YTSETLDIVSDYVDALVNSSNSANPSGKSVPSTSRKDLSARVRDMVVTLAICHNVTPTFE 594

Query: 566  DGELTYQAASPDEIAIVKFTESVGLTLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDN 625
            D ELTYQAASPDEIAIVKFTESVGL+LF+RDRHSI+LLH  SG+   Y+IL VFPFNSD+
Sbjct: 595  DDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSISLLHGHSGSILTYEILQVFPFNSDS 654

Query: 626  KRMGIVIFDKQKDEYWFLQKGADVVMSKIVQKNDWLEEETGNLAREGLRTLVIGRKRLSK 685
            KRMGI++ D+QKDEYWF+QKGAD VM++IV+ NDWLEEETGN+AREGLRTLV+GRK+LS+
Sbjct: 655  KRMGIIVHDEQKDEYWFMQKGADTVMARIVENNDWLEEETGNMAREGLRTLVVGRKKLSR 714

Query: 686  KLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLR 745
             +   F KDY+DASL M+NR+  M+ VI+K+LE+DLE+LGLTGVEDKLQ DVKSSIELLR
Sbjct: 715  NIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLR 774

Query: 746  NAGIKIWMLTGDKVETARCVSISAKLVSRGQYVHTVTKVNKPEGALTHLELLKINTNSCL 805
            NAGIKIWMLTGDKVETARCVSISAKL+SRGQYVH +TK+ KPEGAL  LE LK+N  +CL
Sbjct: 775  NAGIKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVNKGACL 834

Query: 806  LIDGESLGLYLEYYRQQFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKRVCCIGDGG 865
            LIDGESLG++L YY+++FF++V+ LP V+ACRCTPQQKADVA  IRE TGKRVCCIGDGG
Sbjct: 835  LIDGESLGMFLRYYKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDGG 894

Query: 866  NDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRSAKLAQFVI 925
            NDVSMIQ ADVGVGIVGKEGKQASLAADFSIT+FCHL++LLLWHGRNSYKRSAKLAQF++
Sbjct: 895  NDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLTELLLWHGRNSYKRSAKLAQFIM 954

Query: 926  HRGLLISVCQAVYSISSKFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKTYP 985
            HRGL+I++CQAVYSI SKFEPI LYQG+LMVGYATCYTMAPVFS+TLDHDI+ESLTK YP
Sbjct: 955  HRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCYTMAPVFSMTLDHDIEESLTKIYP 1014

Query: 986  ELYKELTAGKSLSYKTFFVWVVLSLFQGCVIQGLSQGFTSLDELDFKRLVALSFTVLILN 1045
            ELYK+LT GKSLSYKTFFVW  LSLFQGCVIQG SQ F+SL E+DF ++VA+ FT LILN
Sbjct: 1015 ELYKDLTEGKSLSYKTFFVWCALSLFQGCVIQGCSQVFSSLLEVDFTKMVAIGFTALILN 1074

Query: 1046 ELIMVAIEIYTWNKTMVVSEVVTFLIFVGSVPLLEEYFDLTYMSRPEYYGKLAIILSLSI 1105
            ELIMVA+EIYTWNK MV +E++TFL +V SVP L EYFDL YM    +YG+L  IL +S+
Sbjct: 1075 ELIMVALEIYTWNKIMVFTEILTFLCYVISVPFLGEYFDLKYMMTLRFYGELLFILLVSV 1134

Query: 1106 IPVWAAKALHRR 1117
             PVWAAKA+HRR
Sbjct: 1135 FPVWAAKAIHRR 1146

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-like
            ATPases family in the superfamily of P-type ATPases,
            overproduction confers neomycin resistance [3456 bp, 1151
            aa]
          Length = 1151

 Score = 1648 bits (4267), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 814/1142 (71%), Positives = 960/1142 (84%), Gaps = 39/1142 (3%)

Query: 6    PPG--SNKESI--PHNNRH-NSFDLLDPQLEDSLDAALESLQIHTGGSPA--------RE 52
            PP   S+K+++   +NN+H NS D  D  L+DS DAAL+SLQI+    P         RE
Sbjct: 4    PPSFKSHKQNLFNSNNNQHANSVDSFDLHLDDSFDAALDSLQINNNPEPLSKHNTVGDRE 63

Query: 53   DFEMTSL--------RSNESQKNARQSDTEPLINNGATAPNSWSHDPRHD----SDRSTA 100
             FEM ++         S++S + +  +DT PL+ +     N  S D        +    +
Sbjct: 64   SFEMRTVDDLDNFSNHSSDSHRKSSNTDTHPLMYD-----NRLSQDDNFKFTNIASSPPS 118

Query: 101  SGSPFWSRITKFMRSSHSPKVSTYKATSNSIQLKDDQQLDREIHPSTTPVYDRYKYAPNA 160
            S +  +S+   +++ S++   S +    + I+L D Q ++REIHP TTPVYDR +Y  N 
Sbjct: 119  SSNNIFSKALSYLKVSNTKNWSKF---GSPIELSD-QHIEREIHPDTTPVYDRNRYVSNE 174

Query: 161  ISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFVLTVTM 220
            +SNAKYN VTF+P +LYEQFKFF+NLYFL+VALSQA+PALRIGYLSSYIVPLAFVLTVTM
Sbjct: 175  LSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFVLTVTM 234

Query: 221  SKEALDDIQRRRRDRESNNELYEVLSKSQLVPSKDLKVGDLIKIGKGARAPADLVLLQSS 280
            +KEA+DDIQRRRRDRESNNELY V+++++ +PSKDLKVGDLIK+ KG R PADLVLLQSS
Sbjct: 235  AKEAIDDIQRRRRDRESNNELYHVITRNRSIPSKDLKVGDLIKVHKGDRIPADLVLLQSS 294

Query: 281  EPSGEIFIKTDQLDGETDWKLRIACPLTQHLSQDDLLYRISITASVPEKSINNFLGKLTF 340
            EPSGE FIKTDQLDGETDWKLR+ACPLTQ+LS++DL+ RISITAS PEKSI+ FLGK+T+
Sbjct: 295  EPSGESFIKTDQLDGETDWKLRVACPLTQNLSENDLINRISITASAPEKSIHKFLGKVTY 354

Query: 341  GEIQSQPLSVDNTMWANTVFASAGTAIACVVYTGADTRQAMNTSMSSVKTGLLELEINSL 400
             +  S PLSVDNT+WANTV AS+G  IACVVYTG DTRQAMNT+ + VKTGLLELEINS+
Sbjct: 355  KDSTSNPLSVDNTLWANTVLASSGFCIACVVYTGRDTRQAMNTTTAKVKTGLLELEINSI 414

Query: 401  SKILCACVFILSVALVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQI 460
            SKILCACVF LS+ LVAFAGF+N+DWY+DI+RYLILFSTIIPVSLRVNLDL KSVYAHQI
Sbjct: 415  SKILCACVFALSILLVAFAGFHNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQI 474

Query: 461  EHDSTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDTMDIVT 520
            EHD TIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDM+LKK+HLGTVSYT +T+DIV+
Sbjct: 475  EHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVS 534

Query: 521  DYVRAM----SDNLNSSAVP-SASKKDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAAS 575
            DYV+++    +D+LN+S V  S ++KD+  RVRD++LTLA+CH VTPTFED ELTYQAAS
Sbjct: 535  DYVQSLVSSKNDSLNNSKVALSTTRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQAAS 594

Query: 576  PDEIAIVKFTESVGLTLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDK 635
            PDEIAIVKFTESVGL+LF+RDRHSI+LLH+ SG    Y+IL VFPFNSD+KRMGI++ D+
Sbjct: 595  PDEIAIVKFTESVGLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDE 654

Query: 636  QKDEYWFLQKGADVVMSKIVQKNDWLEEETGNLAREGLRTLVIGRKRLSKKLLQTFTKDY 695
            Q DEYWF+QKGAD VMSKIV+ NDWLEEETGN+AREGLRTLVIGRK+L+KK+ + F K+Y
Sbjct: 655  QLDEYWFMQKGADTVMSKIVESNDWLEEETGNMAREGLRTLVIGRKKLNKKIYEQFQKEY 714

Query: 696  EDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLT 755
             DASL MLNR+  MS VI+K+LEHDLE+LGLTGVEDKLQ+DVKSSIELLRNAGIKIWMLT
Sbjct: 715  NDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLT 774

Query: 756  GDKVETARCVSISAKLVSRGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGESLGLY 815
            GDKVETARCVSISAKL+SRGQYVHT+TKV +PEGA   LE LKIN N+CLLIDGESLG++
Sbjct: 775  GDKVETARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLIDGESLGMF 834

Query: 816  LEYYRQQFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSAD 875
            L++Y Q+FF++VV+LP VIACRCTPQQKADVA  IR++TGKRVCCIGDGGNDVSMIQ AD
Sbjct: 835  LKHYEQEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCAD 894

Query: 876  VGVGIVGKEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRSAKLAQFVIHRGLLISVCQ 935
            VGVGIVGKEGKQASLAADFSITQFCHL++LLLWHGRNSYKRSAKLAQFV+HRGL+I++CQ
Sbjct: 895  VGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQ 954

Query: 936  AVYSISSKFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKTYPELYKELTAGK 995
            AVYSI S FEPIALYQGWLMVGYATCYTMAPVFSLTLDHDI+ESLTK YPELYKELT GK
Sbjct: 955  AVYSICSLFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIEESLTKIYPELYKELTEGK 1014

Query: 996  SLSYKTFFVWVVLSLFQGCVIQGLSQGFTSLDELDFKRLVALSFTVLILNELIMVAIEIY 1055
            SLSYKTFFVWV+LSLFQG VIQ  SQ FTSL + DF R+VA+SFT L++NELIMVA+EIY
Sbjct: 1015 SLSYKTFFVWVLLSLFQGSVIQLFSQAFTSLLDTDFTRMVAISFTALVVNELIMVALEIY 1074

Query: 1056 TWNKTMVVSEVVTFLIFVGSVPLLEEYFDLTYMSRPEYYGKLAIILSLSIIPVWAAKALH 1115
            TWNKTM+V+E+ T L ++ SVP L +YFDL YM+   YY  L +IL +SI PVW AKA++
Sbjct: 1075 TWNKTMLVTEIATLLFYIVSVPFLGDYFDLGYMTTVNYYAGLLVILLISIFPVWTAKAIY 1134

Query: 1116 RR 1117
            RR
Sbjct: 1135 RR 1136

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, hypothetical start
          Length = 1144

 Score = 1595 bits (4130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 787/1135 (69%), Positives = 926/1135 (81%), Gaps = 42/1135 (3%)

Query: 15   PHN-NRHNSFDLLDPQLEDSLDAALESLQIHTGGSPAR--------------------ED 53
            PHN N  NS  L     E+S D AL++++I+    P R                    E+
Sbjct: 5    PHNLNSRNSVSL--DSFENSFDEALDNIEIN----PVRGYHIDNSLNNSNRITDFDIDEN 58

Query: 54   FEMTSLRSNESQKNARQSDTEPLI-----NNGATAPNSWSHDPRHDSDRSTASGSP--FW 106
            FEM S+  +E   +   +D  PL+     +N +T  + ++        RS    +P    
Sbjct: 59   FEMRSVLEDEEHFD---NDGHPLMRDRTRSNASTLNSRYNKYNNVSGSRSVTGYTPSTIG 115

Query: 107  SRITKFMRSSHSPKVSTYKATSNSIQLKDDQQLDREIHPSTTPVYDRYKYAPNAISNAKY 166
              + K+  +  +   S +K  S S+ L D+   +RE+HP TT VYDR+++  N +SNAKY
Sbjct: 116  VGLKKWFVNVKTAISSGWKDYSTSVALGDEHT-EREVHPGTTQVYDRHRFPSNEVSNAKY 174

Query: 167  NPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFVLTVTMSKEALD 226
            N VTF+P +LYEQFKFFFNLYFLLVALSQAIPALRIGYLSSY+VPLAFVLTVTM+KEA D
Sbjct: 175  NAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAFVLTVTMAKEASD 234

Query: 227  DIQRRRRDRESNNELYEVLSKSQLVPSKDLKVGDLIKIGKGARAPADLVLLQSSEPSGEI 286
            DIQRRRRDRESN ELYEVL + + V SKDLKVGDLIKI KGAR PADL+LLQSSEPSGE 
Sbjct: 235  DIQRRRRDRESNMELYEVLGRPRPVASKDLKVGDLIKISKGARVPADLILLQSSEPSGEA 294

Query: 287  FIKTDQLDGETDWKLRIACPLTQHLSQDDLLYRISITASVPEKSINNFLGKLTFGEIQSQ 346
            FIKTDQLDGETDWKLRIAC LTQ+L++DDLL +I+ITAS PEKSI++FLG++T+ +  + 
Sbjct: 295  FIKTDQLDGETDWKLRIACTLTQNLNEDDLLEKITITASAPEKSIHSFLGRVTYKDTNTS 354

Query: 347  PLSVDNTMWANTVFASAGTAIACVVYTGADTRQAMNTSMSSVKTGLLELEINSLSKILCA 406
             L++DNT+WANTV AS+G  I CV+YTG DTRQAMNT+ + VKTGLLELEIN +SKILCA
Sbjct: 355  GLTIDNTLWANTVLASSGFCIGCVIYTGRDTRQAMNTTSAKVKTGLLELEINDISKILCA 414

Query: 407  CVFILSVALVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTI 466
            CVFILS+ LV FAG +N+DWYVDIMRYLILFSTIIPVSLRVNLDL KSVYAHQIEHD TI
Sbjct: 415  CVFILSILLVVFAGLHNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTI 474

Query: 467  PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDTMDIVTDYVRAM 526
            PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDM+LKK+HLG VSYT +T DIV+DY++ M
Sbjct: 475  PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETADIVSDYIQGM 534

Query: 527  SDNLNSSAVP----SASKKDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDEIAIV 582
             ++ N S       S ++KD    V DL+ TLA+CH VTPTFED ELTYQAASPDEIAIV
Sbjct: 535  IESKNDSVTNLGPRSTTRKDAATHVIDLITTLAICHNVTPTFEDDELTYQAASPDEIAIV 594

Query: 583  KFTESVGLTLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWF 642
            KFTESVGL+LF+RDRHS++LLH+ SGT   YD+L +FPFNSD KRMGI+++DKQKD+YWF
Sbjct: 595  KFTESVGLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGIIVYDKQKDQYWF 654

Query: 643  LQKGADVVMSKIVQKNDWLEEETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMM 702
            LQKGAD VM++IV  NDWLEEETGN+AREGLRTLVIGRK+L+KK+ + F K+YE+ S  M
Sbjct: 655  LQKGADTVMNRIVANNDWLEEETGNMAREGLRTLVIGRKKLTKKIYEQFKKEYEEVSASM 714

Query: 703  LNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETA 762
             NRE  M+N ISK+LEHDLE+LGLTGVEDKLQ+DVKSSIELLRNAGIKIWMLTGDKVETA
Sbjct: 715  YNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETA 774

Query: 763  RCVSISAKLVSRGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQ 822
            RCVSISAKL+SRGQYVH VTK++KPEGA   LE LK+N N+CLLIDGESLG++L+YYRQ+
Sbjct: 775  RCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQE 834

Query: 823  FFEIVVNLPAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVG 882
            FF++VV+LP VIACRCTPQQKADVA  IRE+TGKRVCCIGDGGNDVSMIQ ADVGVGIVG
Sbjct: 835  FFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVG 894

Query: 883  KEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSISS 942
            KEGKQASLAADFSITQFCHL++LLLWHGRNSYKRSAKLAQFV+HRGL+I++CQAV+S+ S
Sbjct: 895  KEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCS 954

Query: 943  KFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKTYPELYKELTAGKSLSYKTF 1002
            +FEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTK YPELYK+LT GKSLSYKTF
Sbjct: 955  QFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKMYPELYKDLTEGKSLSYKTF 1014

Query: 1003 FVWVVLSLFQGCVIQGLSQGFTSLDELDFKRLVALSFTVLILNELIMVAIEIYTWNKTMV 1062
            FVWV LS +QG VIQG SQ FTSL E+DF ++VA+ FT LI NELIMVA+EIYTWNKTM+
Sbjct: 1015 FVWVALSFYQGLVIQGFSQTFTSLAEIDFTKMVAIGFTALIFNELIMVALEIYTWNKTMI 1074

Query: 1063 VSEVVTFLIFVGSVPLLEEYFDLTYMSRPEYYGKLAIILSLSIIPVWAAKALHRR 1117
            ++E+VT  I+V SVP L EYFDL Y+S  ++  +L +IL +SI PVW  KA++RR
Sbjct: 1075 ITEIVTLAIYVFSVPFLGEYFDLKYISTLKFITELILILVVSIFPVWLTKAIYRR 1129

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..548354)
            [3501 bp, 1166 aa]
          Length = 1166

 Score = 1594 bits (4127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 793/1160 (68%), Positives = 933/1160 (80%), Gaps = 52/1160 (4%)

Query: 1    MSFSPPP-----------------------GSNKESIPHNNRHNSFDLLDPQLEDSLDAA 37
            MSF+PPP                       GS++ +     R  S D  + + +DSLDAA
Sbjct: 1    MSFTPPPETSSAYNYHPGKPFGSDRGQQGVGSSRRA--RQERRGSLDSFELEFDDSLDAA 58

Query: 38   LESLQIHTGGSPAR-------EDFEMTSLRSNESQKNA-----RQSDTEPLINNGATAPN 85
            LESLQI    S  R       EDFE+ S+   +   ++        DT+PLI+      +
Sbjct: 59   LESLQIKRSASHERHSGIRGAEDFELKSMGRVDDGGHSPSGVLTNQDTQPLISQ-----D 113

Query: 86   SWSHDPRHDSDRSTASGSPFWSRITKFM---RSSHSP--KVSTYKATSNSIQLKDDQQLD 140
            SW +                W R+  ++     + +P   V+   ++++SI+L D Q +D
Sbjct: 114  SWDYGQVKRLRSGWLGPQSSWQRLKSWVLPGAKAGAPLLGVTATYSSTHSIELTD-QHVD 172

Query: 141  REIHPSTTPVYDRYKYAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPAL 200
            REIH  TTP+YD+ KY  NAISNAKYN +TF+P +LYEQFKFFFNLYFLLV+LSQ+IPAL
Sbjct: 173  REIHLDTTPIYDKRKYPTNAISNAKYNAITFLPIVLYEQFKFFFNLYFLLVSLSQSIPAL 232

Query: 201  RIGYLSSYIVPLAFVLTVTMSKEALDDIQRRRRDRESNNELYEVLSKSQLVPSKDLKVGD 260
            RIGYLSSYIVPLAFVL VTMSKEA+DDIQRRRRDRE+NNELYEVL+ SQLVPSK+L+VGD
Sbjct: 233  RIGYLSSYIVPLAFVLVVTMSKEAMDDIQRRRRDRETNNELYEVLNNSQLVPSKNLRVGD 292

Query: 261  LIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLTQHLSQDDLLYRI 320
            L+K+ K +R PAD++LLQSSEPSGE F+KTDQLDGETDWKLR+A  LTQ+L+QD++L ++
Sbjct: 293  LVKLHKDSRIPADMILLQSSEPSGETFVKTDQLDGETDWKLRVAPSLTQNLTQDEMLTKV 352

Query: 321  SITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAIACVVYTGADTRQA 380
             ITAS PEKSI+ F GKLT+ +  S PLSVDNT+WANTV AS+GT +ACV+YTG DTRQA
Sbjct: 353  HITASAPEKSIHMFTGKLTY-KGSSAPLSVDNTLWANTVLASSGTCVACVIYTGTDTRQA 411

Query: 381  MNTSMSSVKTGLLELEINSLSKILCACVFILSVALVAFAGFNNNDWYVDIMRYLILFSTI 440
            MNTS SSVKTGLLELEINSLSKILC CVF LS+ LV   G +++ WYVDIMRYLILFSTI
Sbjct: 412  MNTSKSSVKTGLLELEINSLSKILCICVFTLSILLVVIGGLDDDKWYVDIMRYLILFSTI 471

Query: 441  IPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDME 500
            IPVSLRVNLDLGKSVYA QIE D +IP+TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDM+
Sbjct: 472  IPVSLRVNLDLGKSVYARQIESDKSIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQ 531

Query: 501  LKKLHLGTVSYTMDTMDIVTDYVRAMSDNLNSSAVPSA---SKKDLPGRVRDLVLTLALC 557
            L+K+HLGTVSYTM+TMD+VTDY++ ++   N  A   A   S+K++  RVRDLV+TLA C
Sbjct: 532  LRKIHLGTVSYTMETMDMVTDYIQTLTSPANMGAAGVAVTGSRKEVSQRVRDLVVTLATC 591

Query: 558  HQVTPTFEDGELTYQAASPDEIAIVKFTESVGLTLFRRDRHSITLLHDQSGTNFEYDILH 617
            H VTP FED EL YQAASPDEIAIVKFTE VGL+LF+RDRHS+TL H+ SG N +YDILH
Sbjct: 592  HNVTPNFEDNELAYQAASPDEIAIVKFTERVGLSLFKRDRHSLTLFHEYSGVNLQYDILH 651

Query: 618  VFPFNSDNKRMGIVIFDKQKDEYWFLQKGADVVMSKIVQKNDWLEEETGNLAREGLRTLV 677
            VFPF SD KRMGI++ D+ K+E WFLQKGAD VMSKIVQ NDWLEEE  N+AREGLRTLV
Sbjct: 652  VFPFTSDTKRMGIIVRDRTKNEIWFLQKGADTVMSKIVQSNDWLEEEVSNMAREGLRTLV 711

Query: 678  IGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDV 737
            I RK+LS +L + F+K+Y+DASL MLNR+  M+ V+ +HLEH+LE+LGLTGVEDKLQ+DV
Sbjct: 712  IARKKLSTRLYEQFSKEYKDASLSMLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDV 771

Query: 738  KSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQYVHTVTKVNKPEGALTHLELL 797
            K+SIELLRNAG+KIWMLTGDKVETARCV +SAKL+SRGQYVHT+TK+ + +GAL+ LE L
Sbjct: 772  KTSIELLRNAGVKIWMLTGDKVETARCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYL 831

Query: 798  KINTNSCLLIDGESLGLYLEYYRQQFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKR 857
            K N NSCLLIDG+SL +Y+ +YR +FFEIV+ LP VIACRCTPQQKADVA  IRE+TGKR
Sbjct: 832  KANRNSCLLIDGDSLAIYMSHYRAEFFEIVICLPVVIACRCTPQQKADVALLIREMTGKR 891

Query: 858  VCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRS 917
            VCCIGDGGNDVSMIQ ADVGVGIVGKEGKQASLAAD+SITQFCHL+KLLLWHGRNSYKRS
Sbjct: 892  VCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADYSITQFCHLTKLLLWHGRNSYKRS 951

Query: 918  AKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDID 977
            AKL+QFVIHRGLLISVCQAVYSISS  +PIALYQGWLMVGYATCYTMAPVFSLTLDHDID
Sbjct: 952  AKLSQFVIHRGLLISVCQAVYSISSNLKPIALYQGWLMVGYATCYTMAPVFSLTLDHDID 1011

Query: 978  ESLTKTYPELYKELTAGKSLSYKTFFVWVVLSLFQGCVIQGLSQGFTSLDELDFKRLVAL 1037
            ESLTKTYPELYKELT G+SLSYKTFFVWV+LSLFQG VIQG SQ F  +    FK++VAL
Sbjct: 1012 ESLTKTYPELYKELTEGRSLSYKTFFVWVILSLFQGAVIQGFSQLFIGVGSEVFKKMVAL 1071

Query: 1038 SFTVLILNELIMVAIEIYTWNKTMVVSEVVTFLIFVGSVPLLEEYFDLTYMSRPEYYGKL 1097
            SFT L++NELIMVA+EIYTWNKTM +SE+VTF I+V S+PLL EYFDLT M    ++ +L
Sbjct: 1072 SFTALVINELIMVALEIYTWNKTMAISEIVTFAIYVLSIPLLGEYFDLTSMLALPFFIQL 1131

Query: 1098 AIILSLSIIPVWAAKALHRR 1117
             IIL++SI PVWAAK +HRR
Sbjct: 1132 TIILTVSIFPVWAAKTIHRR 1151

>Scas_89.1
          Length = 271

 Score =  460 bits (1183), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 215/254 (84%), Positives = 237/254 (93%)

Query: 691 FTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIK 750
           F K+Y DASL MLN + TMS+VI KHLEH+LE+LGLTGVEDKLQ DVKSSIELLRNAG+K
Sbjct: 5   FEKEYHDASLSMLNXDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNAGVK 64

Query: 751 IWMLTGDKVETARCVSISAKLVSRGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGE 810
           IWMLTGDKVETARCVSISAKL+SRGQYVHTVTK+++PEGAL  LE LKIN +SCLLIDGE
Sbjct: 65  IWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLIDGE 124

Query: 811 SLGLYLEYYRQQFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSM 870
           SLG++L YY+Q+FF+IVV+LPAVIACRCTPQQKADVA  IRE+TGKRVCCIGDGGNDVSM
Sbjct: 125 SLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGNDVSM 184

Query: 871 IQSADVGVGIVGKEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRSAKLAQFVIHRGLL 930
           IQ ADVGVGIVGKEGKQASLAADFS+TQFCHL+KLLLWHGRNSYKRSAKLAQFVIHRGL+
Sbjct: 185 IQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHRGLI 244

Query: 931 ISVCQAVYSISSKF 944
           ISVCQAVYS+ SK 
Sbjct: 245 ISVCQAVYSVCSKL 258

>CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharomyces
            cerevisiae YAL026c DRS2, start by similarity
          Length = 1328

 Score =  441 bits (1135), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 322/1039 (30%), Positives = 512/1039 (49%), Gaps = 76/1039 (7%)

Query: 141  REIHPSTTPVYDRYKYAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPAL 200
            REIH S     +R+ Y  N IS  KYN  TF+PK L+++F  + NL+FL  +  Q +P +
Sbjct: 166  REIHISDRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHV 225

Query: 201  RIGYLSSYIVPLAFVLTVTMSKEALDDIQRRRRDRESNNELYEVL--SKSQLVPSK--DL 256
                  + I  L  VL V+  KE+++D++R   D E NN   E+   ++   +  +  D+
Sbjct: 226  SPTNRYTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEIYFEAEGDFIQKRWIDI 285

Query: 257  KVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLTQHLSQDDL 316
            KVGD+I++      PAD+++L SSEP G  +I+T  LDGET+ K++ A   T  +     
Sbjct: 286  KVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSRE 345

Query: 317  LYRIS--ITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAIACVVYTG 374
            L  I   I++  P  S+  + G L     +  PLS +  +       + G     V++TG
Sbjct: 346  LRNIKGVISSEQPNSSLYTYEGTLEMNGTKI-PLSPEQMILRGATLRNTGWIFGIVIFTG 404

Query: 375  ADTRQAMNTSMSSVKTGLLELEIN----SLSKILCACVFILSVALVAFA----------- 419
             +T+   N + + +K   +E  IN    +L  +L   + I S+  V  +           
Sbjct: 405  HETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIMSTADAKHLSYLY 464

Query: 420  --GFNNND-WYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHD------STIPETI 470
              G N    ++ D + + ILFS ++P+SL V ++L K   A  I  D       T   T+
Sbjct: 465  LQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEETDTPTV 524

Query: 471  VRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTM----DTMDIVTDYVRAM 526
            V+TS++ E+LG+IEY+ SDKTGTLT+N ME K   +    Y      D      D +   
Sbjct: 525  VKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPEDKAATFEDGIEVG 584

Query: 527  SDNLNSSAVPSASKKDLPGRVRDLVLTLALCHQVTPTFE-DGELTYQAASPDEIAIVKFT 585
              + +       +  D    + + +  LA CH V P F+ DG + YQAASPDE A+V+  
Sbjct: 585  YRSFDDLKKQLTTNSDDCKIIDEFLTLLATCHTVIPEFQADGSIKYQAASPDEGALVEGG 644

Query: 586  ESVGLTLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWFLQK 645
              +G     R  +S+T+L ++     EY +L++  FNS  KRM   IF    D    L K
Sbjct: 645  ALLGYKFLIRKPNSVTILINEEEER-EYQLLNICEFNSTRKRMS-AIFRFPDDSIKLLCK 702

Query: 646  GAD-VVMSKIVQKNDWLEEETG----NLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASL 700
            GAD V++ ++ +  ++  + T     + A EGLRTL +  K + +     + K Y DA+ 
Sbjct: 703  GADSVILERLSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMDAAT 762

Query: 701  MMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVE 760
             + +R   + + +++ +E  L ++G T +EDKLQE V  +I  L+ AGIKIW+LTGDK E
Sbjct: 763  TLDHRAEKL-DAVAEEIESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGDKQE 821

Query: 761  TARCVSISAKLVSR-------GQYVHTVTKVNKPE--GALTHLELLKINTNS-CLLIDGE 810
            TA  + +S +L+S         +     T+ N  E   AL    L + + N+  L+IDG 
Sbjct: 822  TAINIGMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVIDGH 881

Query: 811  SLGLYLEYYRQQFFEIVVNL-PAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVS 869
            SL   LE   + +F  +  +  AVI CR +P QKA V   ++  T   +  IGDG NDVS
Sbjct: 882  SLSFALEADLEDYFLAIGKMCKAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGANDVS 941

Query: 870  MIQSADVGVGIVGKEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRSAKLAQFVIHRGL 929
            MIQ+A VGVGI G EG QA+ +AD S+ QF  L KLLL HG  SY+R +    +  ++  
Sbjct: 942  MIQAAHVGVGISGMEGMQAARSADISVGQFRFLKKLLLVHGAWSYQRISVAILYSFYKNT 1001

Query: 930  LISVCQAVYSISSKFEPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIDESLTKTYPELY 988
             + + Q  Y  ++ F   ++ + W M  Y   +T+ P F +   D  ++  L + YP+LY
Sbjct: 1002 ALYMTQFWYVFANAFSGQSIMESWTMSLYNVFFTVLPPFVIGVFDQFVNSRLLERYPQLY 1061

Query: 989  KELTAGKSLSYKTFFVWVVLSLFQGCVI-----------QGLSQGFTSLDELDFKRLVAL 1037
            K    G+  S   F+ W+V   +   V+             L +   + D   +   +  
Sbjct: 1062 KLGQKGQFFSVSIFWGWIVNGFYHSAVVFVGTILFYRYGFALRKHGETADHWSWGIAIYT 1121

Query: 1038 SFTVLILNELIMVAIEIYTWNKTMVVSEVVTFLIFVGSVPLLEEYFDLTYMSRPEY---- 1093
            S  +++L +  +V  +   +    +   +  +LIF    P+    F    +SR  +    
Sbjct: 1122 SSVIIVLGKAALVTNQWTKFTLFAIPGSLFFWLIF---FPIYGSIFPYAKISREYFGVVE 1178

Query: 1094 --YGKLAIILSLSIIPVWA 1110
              YG     L+L ++P +A
Sbjct: 1179 HTYGSATFWLTLIVLPTFA 1197

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score =  441 bits (1134), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 321/1036 (30%), Positives = 519/1036 (50%), Gaps = 93/1036 (8%)

Query: 153  RYKYAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPL 212
            R+ Y  N IS  KYN  TF+PK L+++F  + NL+FL  ++ Q +P +      + I  L
Sbjct: 199  RFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRYTTIGTL 258

Query: 213  AFVLTVTMSKEALDDIQRRRRDRESNNELYEVLSK--SQLVPSK--DLKVGDLIKIGKGA 268
              VL V+  KE+++D++R   D+E N+ L +VL +   + V  K  D+ VGD+I++    
Sbjct: 259  LVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAVGDIIRVRSEE 318

Query: 269  RAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLTQHLSQDDLLYRI--SITASV 326
              PADL++L SSEP G  +I+T  LDGET+ K++ A   T +   +  L ++   + +  
Sbjct: 319  AIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALCKLHGRVQSEH 378

Query: 327  PEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAIACVVYTGADTRQAMNTSMS 386
            P  S+  + G +T     + PLS D  +       +       +V+TG +T+   N + +
Sbjct: 379  PNSSLYTYEGTMTLNG-STFPLSPDQMLLRGATLRNTAWIFGLIVFTGHETKLMRNATAT 437

Query: 387  SVKTGLLELEINSLSKILCACVFILSVALVAFAG---FNNND-----------------W 426
             +K   +E  IN   +IL     ++ +AL++  G       D                 +
Sbjct: 438  PIKRTAVERVINM--QILALFGVLIVLALISSTGNVIMTKRDSAHLGYLYIEGTNKAGLF 495

Query: 427  YVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIE------HDSTIPETIVRTSTIPEDL 480
            + DI+ + ILFS ++P+SL V +++ K   A+ I       H+ +   T+VRTS++ E+L
Sbjct: 496  FKDILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEEL 555

Query: 481  GRIEYLLSDKTGTLTQNDMELKKLHLGTVSY-----------TMDTMDIVTDYVRAMSDN 529
            G+IEY+ SDKTGTLT+N ME K + +    Y             D ++I      ++ D 
Sbjct: 556  GQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEIGFHSFESLKDK 615

Query: 530  LNSSAVPSASKKDLPGRVRDLVLTLALCHQVTP-TFEDGELTYQAASPDEIAIVKFTESV 588
            +      +  + D  G V + +  LA CH V P T  DG + YQAASPDE A+V+    +
Sbjct: 616  M------TDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEGALVQGAADL 669

Query: 589  GLTLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWFLQKGAD 648
            G     R  +S+++    S    EY +L++  FNS  KRM   IF           KGAD
Sbjct: 670  GFRFDIRRPNSVSISTPFS-EQLEYQLLNICEFNSTRKRMS-AIFRMPDGSIKLFCKGAD 727

Query: 649  VVMSKIVQK--NDWLEEETGNL---AREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMML 703
             V+ + +    N +++    +L   A EGLRTL I  + + +K  + ++K YE AS  M 
Sbjct: 728  TVILERLDSEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMK 787

Query: 704  NREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETAR 763
            +R   +    ++ +EHDL  LG T +EDKLQE V  +I  L+ AG+K+W+LTGD+ ETA 
Sbjct: 788  DRTEELDRA-AELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAI 846

Query: 764  CVSISAKLVSRGQYVHTVTKVNKPE---------GALTHLELLKINTNS-CLLIDGESLG 813
             + +S +L+S    +  V +  K +          A+   ++ + + NS  L+IDG+SLG
Sbjct: 847  NIGMSCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLG 906

Query: 814  LYLEY-YRQQFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQ 872
              LE     QF  I     AVI CR +P QKA V   ++  T   +  IGDG NDVSMIQ
Sbjct: 907  YALEEDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQ 966

Query: 873  SADVGVGIVGKEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRSAKLAQFVIHRGLLIS 932
            +A VGVGI G EG QA+ +ADF+I QF  L KLL+ HG  SY+R +    +  ++ + + 
Sbjct: 967  AAHVGVGISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALY 1026

Query: 933  VCQAVYSISSKFEPIALYQGWLMVGYATCYTMAPVFSLTL-DHDIDESLTKTYPELYKEL 991
            + Q  Y  ++ F   ++ + W +  Y   +T+ P F + + D  +   L   YP+LYK  
Sbjct: 1027 MTQFWYVFANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLG 1086

Query: 992  TAGKSLSYKTFFVWVVLSLFQGCVI-----------QGLSQGFTSLDELDFKRLVALSFT 1040
              G+  S   F+ WV+   +   V+             L+ G  + D   +   +  +  
Sbjct: 1087 QKGQFFSVTIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVGIYTTSI 1146

Query: 1041 VLILNELIMVAIEIYTWNKTMVVSEVVTFLIFVGSVPLLEEYFDLTYMSRPEY------Y 1094
            +++L +  ++  +   W K  +V+   + +I++   P     F    +S+  Y      Y
Sbjct: 1147 IIVLGKAALITSQ---WTKFTLVAIPGSLVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVY 1203

Query: 1095 GKLAIILSLSIIPVWA 1110
            G     L   ++PV+A
Sbjct: 1204 GSATFWLMCIVLPVFA 1219

>Kwal_26.7070
          Length = 1315

 Score =  439 bits (1129), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 303/940 (32%), Positives = 487/940 (51%), Gaps = 68/940 (7%)

Query: 135  DDQQLDREIHPSTTPVYDRYKYAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALS 194
            DD+   R+I+ +         +  N IS  KYN  TFIPK L+++F  + NL+FL  +  
Sbjct: 176  DDKSSPRQIYINDKEANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAI 235

Query: 195  QAIPALRIGYLSSYIVPLAFVLTVTMSKEALDDIQRRRRDRESNNELYEVLSKS----QL 250
            Q +P +      + I  L  VL V+  KE ++D++R + D E N+   +V S+      L
Sbjct: 236  QQVPNVTPTNRYTTIGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVFSEQLQDFTL 295

Query: 251  VPSKDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIA-CPLTQ 309
                ++ VGD+IK+      PAD++++ SSEP G  +I+T  LDGET+ K++ A    ++
Sbjct: 296  SKWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSK 355

Query: 310  HLSQDDLL-YRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAIA 368
             + +DDL   R  + +  P  S+  + G +     ++  LS +  +       +      
Sbjct: 356  FIDKDDLAGMRGKVLSEHPNSSLYTYEGTMNLNG-KNISLSPEQMVLRGATLRNTAWIYG 414

Query: 369  CVVYTGADTRQAMNTSMSSVKTGLLELEIN----SLSKILCACVFILSVALVA------- 417
             VV+TG +T+   N + + +K   +E  IN    +L  +L     I S+  V        
Sbjct: 415  LVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALISSIGNVIKVTSDAE 474

Query: 418  ------FAGFNNND-WYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHD------S 464
                    G N    ++ DI+ Y ILFS ++P+SL V +++ K   A+ I  D      +
Sbjct: 475  HLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLYDEA 534

Query: 465  TIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSY-----------TM 513
            +   T+VRTS++ E+LG+IEY+ SDKTGTLT+N ME K   +    Y           T 
Sbjct: 535  SDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYIETIPEDKAATTE 594

Query: 514  DTMDIVTDYVRAMSDNLNSSAVPSASKKDLPGRVRDLVLTLALCHQVTPTF-EDGELTYQ 572
            D ++I      +M + LN +  P +        + D +  LA CH V P F EDG + YQ
Sbjct: 595  DGIEIGFRKFDSMKETLNDTQDPDSHI------INDFLTLLATCHTVIPEFQEDGSIKYQ 648

Query: 573  AASPDEIAIVKFTESVGLTLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVI 632
            AASPDE A+V+   S+G     R  +S+++L +  G   EY +L++  FNS  KRM   I
Sbjct: 649  AASPDEGALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMS-AI 707

Query: 633  FDKQKDEYWFLQKGADVVMSKIVQ--KNDWLEEETGNL---AREGLRTLVIGRKRLSKKL 687
            F     E     KGAD V+ + ++  +N ++E    +L   A EGLRTL +  + +++  
Sbjct: 708  FRLPNGEIKLFCKGADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESE 767

Query: 688  LQTFTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNA 747
               +   Y+ AS  + +R   + +  ++ +E DL +LG T +EDKLQ+ V  +I  L++A
Sbjct: 768  YAEWKDIYDAASTTLDDRAQKLDDA-AELIEKDLFLLGATAIEDKLQDGVPETIHTLQDA 826

Query: 748  GIKIWMLTGDKVETARCVSISAKLVSRGQYVHTVTKVNKPE---------GALTHLELLK 798
            GIK+W+LTGD+ ETA  + +S +L+S    +  + + +K            A++  ++ +
Sbjct: 827  GIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQ 886

Query: 799  INTNS-CLLIDGESLGLYLEYYRQQFFEIVVNL-PAVIACRCTPQQKADVATFIREVTGK 856
             + NS  L+IDG+SLG  LE   + +   +  L  AVI CR +P QKA V   ++  T  
Sbjct: 887  QDMNSLALVIDGKSLGFALEADLEDYLLAIGKLCKAVICCRVSPLQKALVVKMVKRKTDS 946

Query: 857  RVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCHLSKLLLWHGRNSYKR 916
             +  IGDG NDVSMIQ+A VGVGI G EG QA+ +ADF+I QF +L KLLL HG  SY+R
Sbjct: 947  LLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQR 1006

Query: 917  SAKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGWLMVGYATCYTMAPVFSL-TLDHD 975
             ++   +  ++ + + + Q  Y  ++ +   ++ + W M  Y   +T+ P F +   D  
Sbjct: 1007 ISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQF 1066

Query: 976  IDESLTKTYPELYKELTAGKSLSYKTFFVWVVLSLFQGCV 1015
            +   L   YP+LYK    G+  S + F+ WV+   +   V
Sbjct: 1067 VSSRLLDRYPQLYKLGQRGQFFSVRIFWGWVINGFYHSAV 1106

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
            Ca-ATPase (P-type) required for ribosome assembly and
            involved in late Golgi function, member of the cation
            transporting (E1-E2) P-type ATPase superfamily [4068 bp,
            1355 aa]
          Length = 1355

 Score =  431 bits (1109), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 318/1043 (30%), Positives = 511/1043 (48%), Gaps = 82/1043 (7%)

Query: 141  REIHPSTTPVYDRYKYAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPAL 200
            R IH + +     + Y+ N IS  KYN  TF+PK L+++F  + NL+FL  +  Q +P +
Sbjct: 183  RVIHINDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHV 242

Query: 201  RIGYLSSYIVPLAFVLTVTMSKEALDDIQRRRRDRESNNELYEVLSKSQ--LVPSK--DL 256
                  + I  L  VL V+  KE ++DI+R   D+E NN   E+ S++    V  +  D+
Sbjct: 243  SPTNRYTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWIDI 302

Query: 257  KVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLTQHLSQDDL 316
            +VGD+I++      PAD ++L SSEP G  +I+T  LDGET+ K++ +   T        
Sbjct: 303  RVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDVKT 362

Query: 317  LYRIS--ITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAIACVVYTG 374
            L  ++  + +  P  S+  + G +T  + Q  PLS D  +       +       V++TG
Sbjct: 363  LKNMNGKVVSEQPNSSLYTYEGTMTLNDRQI-PLSPDQMILRGATLRNTAWIFGLVIFTG 421

Query: 375  ADTRQAMNTSMSSVKTGLLELEINS----LSKILCACVFILSVALVAFA----------- 419
             +T+   N + + +K   +E  IN     L  +L   + I S+  V  +           
Sbjct: 422  HETKLLRNATATPIKRTAVEKIINRQIIRLFTVLIVLILISSIGNVIMSTADAKHLSYLY 481

Query: 420  --GFNNND-WYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHD------STIPETI 470
              G N    ++ D + + ILFS ++P+SL V ++L K   A  I  D       T   T+
Sbjct: 482  LEGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPTV 541

Query: 471  VRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYT----MDTMDIVTDYVRAM 526
            VRTS++ E+LG+IEY+ SDKTGTLT+N ME K   +    Y      D    V D +   
Sbjct: 542  VRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGIEVG 601

Query: 527  SDNLN--SSAVPSASKKDLPGRVRDLVLTLALCHQVTPTFE-DGELTYQAASPDEIAIVK 583
                +     +   S +D P  + D +  LA CH V P F+ DG + YQAASPDE A+V+
Sbjct: 602  YRKFDDLKKKLNDPSDEDSP-IINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGALVQ 660

Query: 584  FTESVGLTLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWFL 643
                +G     R  +S+T+L +++G   EY +L++  FNS  KRM   IF          
Sbjct: 661  GGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMS-AIFRFPDGSIKLF 719

Query: 644  QKGADVVMSKIV--QKNDWLEEETGNL---AREGLRTLVIGRKRLSKKLLQTFTKDYEDA 698
             KGAD V+ + +  + N ++E    +L   A EGLRTL +  + +S+   + +   Y +A
Sbjct: 720  CKGADTVILERLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEA 779

Query: 699  SLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDK 758
            +  + NR   +    +  +E +L ++G T +EDKLQ+ V  +I  L+ AGIKIW+LTGD+
Sbjct: 780  ATTLDNRAEKLDEA-ANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDR 838

Query: 759  VETARCVSISAKLVSRGQYVHTVTKVNKPEGALTHLELLKINT------------NSCLL 806
             ETA  + +S +L+S    +  + +  + +     LE  KIN             +  L+
Sbjct: 839  QETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLE--KINALNEHQLSTHDMKSLALV 896

Query: 807  IDGESLGLYLEYYRQQFFEIVVNL-PAVIACRCTPQQKADVATFIREVTGKRVCCIGDGG 865
            IDG+SLG  LE   + +   V  L  AVI CR +P QKA V   ++  +   +  I  G 
Sbjct: 897  IDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKSSSLLLAIASGA 956

Query: 866  NDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRSAKLAQFVI 925
            NDVSMIQ+A VGVGI G EG QA+ +AD ++ QF  L KLLL HG  SY+R +    +  
Sbjct: 957  NDVSMIQAAHVGVGISGMEGMQAARSADIALGQFKFLKKLLLVHGSWSYQRISVAILYSF 1016

Query: 926  HRGLLISVCQAVYSISSKFEPIALYQGWLMVGYATCYTMAPVFSL-TLDHDIDESLTKTY 984
            ++   + + Q  Y  ++ F   ++ + W M  Y   +T+ P F +   D  +   L + Y
Sbjct: 1017 YKNTALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERY 1076

Query: 985  PELYKELTAGKSLSYKTFFVWVVLSLFQGCVI-----------QGLSQGFTSLDELDFKR 1033
            P+LYK    G+  S   F+ W++   F   ++             L+      D   +  
Sbjct: 1077 PQLYKLGQKGQFFSVYIFWGWIINGFFHSAIVFIGTILIYRYGFALNMHGELADHWSWGV 1136

Query: 1034 LVALSFTVLILNELIMVAIEIYTWNKTMVVSEVVTFLIFVGSVPLLEEYFDLTYMSRPEY 1093
             V  +  +++L +  +V  +   W K  +++   + L ++   P+    F    +SR  Y
Sbjct: 1137 TVYTTSVIIVLGKAALVTNQ---WTKFTLIAIPGSLLFWLIFFPIYASIFPHANISREYY 1193

Query: 1094 ------YGKLAIILSLSIIPVWA 1110
                  YG     L+L ++P++A
Sbjct: 1194 GVVKHTYGSGVFWLTLIVLPIFA 1216

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score =  404 bits (1039), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 289/869 (33%), Positives = 452/869 (52%), Gaps = 67/869 (7%)

Query: 156  YAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFV 215
            Y  N IS  KYN  TF+PK L+++F  + NL+FL  ++ Q +P +      + I  L  V
Sbjct: 194  YGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRFTTIGTLIVV 253

Query: 216  LTVTMSKEALDDIQRRRRDRESNNELYEVLSK--SQLVPSK--DLKVGDLIKIGKGARAP 271
            L V+  KE+++D++R   D+E N+   +V S    Q +  K  D+ VGD+I++      P
Sbjct: 254  LVVSAIKESVEDLKRSNSDKELNHSRADVYSDEMGQFISKKWIDIAVGDIIRVRSEEAIP 313

Query: 272  ADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLTQHLSQDDLL--YRISITASVPEK 329
            ADL++L SSEP G  +I+T  LDGET+ K++ A P T  +     L   R  I +  P  
Sbjct: 314  ADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPETSKILDVRELSAMRGKILSEQPNT 373

Query: 330  SINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAIACVVYTGADTRQAMNTSMSSVK 389
            S+  + G +        PLS D  +       +       V++TG +T+   N + + +K
Sbjct: 374  SLYTYEGTMILHN-NRIPLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRNATATPIK 432

Query: 390  TGLLE----LEINSLSKILCACVFILSVALVAFAGFNNND---------------WYVDI 430
               +E    L+I +L  +L  C+ ++S        +N  +               ++ +I
Sbjct: 433  RTAVERVINLQIVALFGVLI-CLSLISSFGNLIVMYNQKENLSYLYLQGTNMVALFFKNI 491

Query: 431  MRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHD-------STIPETIVRTSTIPEDLGRI 483
            + + ILFS ++P+SL V +++ K   A+ I  D       S +P T+VRTS++ E+LG+I
Sbjct: 492  LTFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMP-TVVRTSSLVEELGQI 550

Query: 484  EYLLSDKTGTLTQNDMELKKLHLGTVSYTMDTMDIVTDYVRAMSDNLNSSAVPSASKKDL 543
            EY+ SDKTGTLTQN ME K   +    Y      I  D   A  + +           +L
Sbjct: 551  EYIFSDKTGTLTQNVMEFKSCSIAGRCYIQS---IPEDKDAAFDEGIEVGYRTYDDMHEL 607

Query: 544  ---PGR-----VRDLVLTLALCHQVTPTF-EDGELTYQAASPDEIAIVKFTESVGLTLFR 594
               PG      + + +  L++CH V P F E+G + YQAASPDE A+V+    +G     
Sbjct: 608  LHTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQGAADLGYKFII 667

Query: 595  RDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWFLQKGAD-VVMSK 653
            R  +S+T+L +       Y++L++  FNS  KRM   IF    +    L KGAD V++ +
Sbjct: 668  RKPNSVTILREDITEEVVYELLNICEFNSTRKRMS-AIFRFPDNSIRLLCKGADTVILER 726

Query: 654  IVQ-KNDWLEEETGNL---AREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTM 709
            +    N ++     +L   A EGLRTL I  + + +   + ++K Y+ A+  M NR   +
Sbjct: 727  LAATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEEL 786

Query: 710  SNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISA 769
              V ++ +E  L +LG T +EDKLQ+ V  +I  L+ AGIK+W+LTGD+ ETA  + +S 
Sbjct: 787  DKV-AEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSC 845

Query: 770  KLVSRGQYVHTVTKVNKPEGALTHL--ELLKINTNS---------CLLIDGESLGLYLEY 818
            KL+S    +  V +  K E    +L  +L  IN +           L+IDG+SLG  LE 
Sbjct: 846  KLLSEDMNLLIVNEDTK-ESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEP 904

Query: 819  YRQQFFEIVVNL-PAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVG 877
              ++F   +  +  AVI CR +P QKA V   ++  T   +  IGDG NDVSMIQ+A VG
Sbjct: 905  DLEEFLLAIGKMCRAVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVG 964

Query: 878  VGIVGKEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRSAKLAQFVIHRGLLISVCQAV 937
            VGI G EG QA+ +ADF++ QF +L KLLL HG  SY+R ++   +  ++ + + + Q  
Sbjct: 965  VGISGMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFW 1024

Query: 938  YSISSKFEPIALYQGWLMVGYATCYTMAP 966
            Y + + F   ++ + W +  Y    T AP
Sbjct: 1025 YVLYNAFSGQSIMESWTLTFYNWGGTAAP 1053

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score =  351 bits (900), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 258/889 (29%), Positives = 435/889 (48%), Gaps = 131/889 (14%)

Query: 254  KDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLR--IACPLTQHL 311
            K +KVGD+++I      PAD++LL +S+  G  +++T  LDGET+ K+R  + C  T   
Sbjct: 399  KGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRT 458

Query: 312  SQDDLLYRISITASVPEKSINNFLGKLTF-----GEIQSQPLSVDNTMWANTVFASAGTA 366
            S+D    +  I +  P  ++  + G + +     GEI+++P++++N +       +   A
Sbjct: 459  SKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWA 518

Query: 367  IACVVYTGADTRQAMNTSMSSVKTGLLELEINSLSKILCACVFIL--------------- 411
            +  V++TG DT+  +N+ ++  K   +  E+N    I    +FIL               
Sbjct: 519  MGVVMFTGGDTKIMLNSGITPTKKSRISRELNFSVVINFVLLFILCFVSGIANGVYYDKK 578

Query: 412  -----SVALVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTI 466
                 S      AG    + +V     +IL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 579  GRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 638

Query: 467  PETIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSY--------- 511
                +      ++  I +DLG++EY+ SDKTGTLTQN ME KK  +  VSY         
Sbjct: 639  YNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 698

Query: 512  --------------------TMDTMDIVTDYVRAMSDN--LNSSAVPSASK---KDLPGR 546
                                     D + D +RA+S N       V   SK   +DL G 
Sbjct: 699  GLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRDLKGA 758

Query: 547  --------VRDLVLTLALCHQV----TPTFEDGELTYQAASPDEIAIVKFTESVGLTLFR 594
                        +L LALCH V     P     +L  +A SPDE A+V     VG +   
Sbjct: 759  SGEVQQRCCEHFMLALALCHSVLVEANPD-NPKKLDLKAQSPDEAALVATARDVGFSFVG 817

Query: 595  RDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVI-----FDKQKDEYWFLQKGAD- 648
            + +    L+ +  G   E++IL++  FNS  KRM  ++         +     + KGAD 
Sbjct: 818  KTKKG--LIIEMQGIQKEFEILNILEFNSSRKRMSCIVKIPGLNPGDEPRALLICKGADS 875

Query: 649  VVMSKIVQKN----DWLEEETG----NLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASL 700
            ++ S++ +++    + + E+T       A EGLRTL I ++ LS    + + + Y+ A+ 
Sbjct: 876  IIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKYDIAAA 935

Query: 701  MMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVE 760
             + NRE  +  V++  +E +L +LG T +ED+LQ+ V   IELL  AGIK+W+LTGDKVE
Sbjct: 936  SLANREDELE-VVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLTGDKVE 994

Query: 761  TARCVSISAKLVSRGQYVHTVTKV--------NKPEGALTHL----------------EL 796
            TA  +  S  L++    +  +           ++P   +  L                E+
Sbjct: 995  TAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTGSEEEI 1054

Query: 797  LKINT-------NSCLLIDGESL--GLYLEYYRQQFFEIVVNLPAVIACRCTPQQKADVA 847
             +          N  ++IDG++L   LY E  R++F  +  N  AV+ CR +P QKA V 
Sbjct: 1055 FEAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQKAAVV 1114

Query: 848  TFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCHLSKLLL 907
              +++        IGDG NDV+MIQSADVG+GI G+EG+QA + +D++I QF +L++L+L
Sbjct: 1115 KLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLARLVL 1174

Query: 908  WHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGWLMVGYATCYTMAPV 967
             HGR SYKR A++     ++ ++ ++    Y I + F+   LY+   M+ Y   +T  PV
Sbjct: 1175 VHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAFTSLPV 1234

Query: 968  FSL-TLDHDIDESLTKTYPELYKELTAGKSLSYKTFFVWVVLSLFQGCV 1015
              L  LD D++++++   P+LY+     K  + + F  +++  L+Q  +
Sbjct: 1235 IFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSII 1283

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 48/91 (52%)

Query: 155 KYAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAF 214
           +Y  N I   KY P+TF+PK +  QF  F N+YFL++ +  A     +       VPL  
Sbjct: 190 QYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTNPGLSAVPLVV 249

Query: 215 VLTVTMSKEALDDIQRRRRDRESNNELYEVL 245
           ++ +T  K+A++D +R   D E NN    +L
Sbjct: 250 IVIITAIKDAIEDSRRTVLDLEVNNTKTHIL 280

>Scas_576.8
          Length = 1591

 Score =  340 bits (872), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 281/999 (28%), Positives = 476/999 (47%), Gaps = 150/999 (15%)

Query: 254  KDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLR--IACPLTQHL 311
            K++KVGD+++I      PAD++LL +S+  G  +++T  LDGET+ K+R  + C  +   
Sbjct: 415  KNVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYLETKNLDGETNLKVRESLKCSHSIRN 474

Query: 312  SQDDLLYRISITASVPEKSINNFLGKLTF-----GEIQSQPLSVDNTMWANTVFASAGTA 366
            S+D    +  + +  P  ++ ++ G + +     G+++++P++++N +       +   A
Sbjct: 475  SRDIARTKFWVESEGPHANLYSYQGNVKWVDSKDGDLKNEPVTINNLLLRGCTLRNTKWA 534

Query: 367  IACVVYTGADTRQAMNTSMSSVKTGLLELEIN---SLSKILCACVFILSVALVAF----- 418
            +  VV+TG DT+  +N+  +  K   +  E+N   SL+ +    +  +S  +        
Sbjct: 535  MGMVVFTGDDTKIMLNSGATPTKKSRISRELNLSVSLNFLFLFIICFISAIINGVDYDKH 594

Query: 419  ------------AGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTI 466
                        AG  + + +V     +IL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 595  PRSRDFFEFGTVAGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 654

Query: 467  PETIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSY--------- 511
                +      ++  I +D+G+IEY+ SDKTGTLTQN ME KK  +  +SY         
Sbjct: 655  YNAKLDYPCTPKSWNISDDMGQIEYIFSDKTGTLTQNVMEFKKCTINGISYGRAYTEALA 714

Query: 512  --------------------TMDTMDIVTDYVRAMSDN--LNSSAVPSASKK---DLPGR 546
                                     D + + +R +S N       +   SK+   DL G 
Sbjct: 715  GLRKRQGIDVEEEGRREKEEIAKDRDTMINTLRNLSHNSQFYPDDITFISKEFVNDLKGA 774

Query: 547  VRDL--------VLTLALCHQV--TPTFEDGE-LTYQAASPDEIAIVKFTESVGLTLFRR 595
              D+        +L LALCH V   P   D + L  +A SPDE A+V     VG +   +
Sbjct: 775  SGDMQQKCCEHFMLALALCHSVLVEPNKHDSKKLDVKAQSPDEAALVCTARDVGFSFIGK 834

Query: 596  DRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVI---FDKQKDE--YWFLQKGAD-V 649
             +    L+ +  G   E+ IL+   FNS  KRM  ++        DE     + KGAD +
Sbjct: 835  TKTG--LIIEVQGVQKEFQILNTLEFNSTRKRMSCIVKIPGANPDDEPRALLICKGADSI 892

Query: 650  VMSKIVQKN-----DWLEEETGNL---AREGLRTLVIGRKRLSKKLLQTFTKDYEDASLM 701
            + S++  KN     + LE+   +L   A EGLRTL I ++ LS      + K Y+ A+  
Sbjct: 893  IYSRLGTKNGANSENLLEKTALHLEQYATEGLRTLCIAQRELSWPEYLEWNKRYDIAAAS 952

Query: 702  MLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVET 761
            + NRE  +   +S  +E +L +LG T +ED+LQ+ V  SI +L  AGIK+W+LTGDKVET
Sbjct: 953  VTNREEQLE-AVSDEIERELTLLGGTAIEDRLQDGVPESISILAQAGIKLWVLTGDKVET 1011

Query: 762  ARCVSISAKLV----------SRGQYVHT------------VTKVNKPEGALT--HLELL 797
            A  +  S  L+          + G  V              +TK  + +  LT   +EL 
Sbjct: 1012 AINIGFSCNLLNNDMELLVVKTNGDDVQEFGNDPAEIAESLITKYLREKFGLTGSEMELA 1071

Query: 798  KINTNS-------CLLIDGESLGLYL--EYYRQQFFEIVVNLPAVIACRCTPQQKADVAT 848
                N         ++IDGE+L L L  E  R++F  +  N  AV+ CR +P QKA V  
Sbjct: 1072 DAKKNHDFPRGDFAVVIDGEALKLALNGESIRRKFLLLCKNCKAVLCCRVSPAQKAAVVK 1131

Query: 849  FIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCHLSKLLLW 908
             +          IGDG NDV+MIQSADVGVGI G+EG+QA + +D++I QF +L++L+L 
Sbjct: 1132 LVMTSLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYLTRLVLV 1191

Query: 909  HGRNSYKRSAKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGWLMVGYATCYTMAPV- 967
            HGR SY+R A++     ++ ++ ++    Y I + F+   L++   ++ Y   +T  PV 
Sbjct: 1192 HGRWSYRRLAEMIPAFFYKNVIFTLALFWYGIYNNFDGSYLFEYTFLMFYNLAFTSLPVI 1251

Query: 968  FSLTLDHDIDESLTKTYPELYKELTAGKSLSYKTFFVWVVL-SLFQGCVI---------- 1016
            F   +D D+ ++++   P+LY+        + +T F+W +L  L+Q C+           
Sbjct: 1252 FMGIMDQDVSDTVSLVMPQLYRSGILRLDWN-QTKFLWYMLDGLYQSCICFFFPYCLYHK 1310

Query: 1017 -QGLSQGFTSLDELDFKRLVALSFTVLILNELIMVAIEIYTWNKTMVVSEVVTFLIF--- 1072
             Q +S     LD   +  ++  S  V+  N  +++    + W   + +      L F   
Sbjct: 1311 NQIVSNNGLGLDHRFYVGVMVTSLAVVSCNIYMLLHQYRWDWFSCLFIGLSCIILFFWTG 1370

Query: 1073 VGSVPLLEEYFDLTYMSR----PEYYGKLAIILSLSIIP 1107
            V S  L  + F     SR    P ++G   + +   ++P
Sbjct: 1371 VWSSSLTSKEF-FKAASRIYGAPSFWGVFFVGIVYCLLP 1408

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 50/97 (51%), Gaps = 3/97 (3%)

Query: 149 PVYDRYKYAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSY 208
           P+ D   Y  N I   KY+P+ F PK +  QF+ F N+YFL++ +  A     +      
Sbjct: 197 PITD---YPRNKIRTTKYSPLNFFPKNIMFQFQNFANVYFLVLIILGAFQIFGVTNPGLA 253

Query: 209 IVPLAFVLTVTMSKEALDDIQRRRRDRESNNELYEVL 245
            VPL  ++ +T  K+A++D +R   D E NN    +L
Sbjct: 254 AVPLIVIVIITAIKDAIEDSRRTLLDMEVNNTRTHIL 290

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score =  337 bits (863), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 253/863 (29%), Positives = 422/863 (48%), Gaps = 131/863 (15%)

Query: 254  KDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIA--CPLTQHL 311
            K +KVGD+++I      PAD++LL +S+  G  +++T  LDGET+ K+R A  C      
Sbjct: 395  KSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKT 454

Query: 312  SQDDLLYRISITASVPEKSINNFLGKL-----TFGEIQSQPLSVDNTMWANTVFASAGTA 366
            S+D    R  I +  P  ++ ++ G L     T  E++++P++++N +       +   A
Sbjct: 455  SRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWA 514

Query: 367  IACVVYTGADTRQAMNTSMSSVKTGLLELEINSLSKILCACVFILSV------------- 413
            +  VV+TG DT+  +N  ++  K   +  E+N    I    +FIL               
Sbjct: 515  MGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANGIDYDKH 574

Query: 414  -------ALVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTI 466
                        AG    + +V     +IL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 575  PRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 634

Query: 467  PETIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSY--------- 511
                +      ++  I +DLG+IEY+ SDKTGTLTQN ME KK  +  VSY         
Sbjct: 635  YNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 694

Query: 512  --------------------TMDTMDIVTDYVRAMSDNLN--SSAVPSASK---KDLPGR 546
                                     D++ + +R +S+N       +   SK   +D  GR
Sbjct: 695  GLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEIVQDFKGR 754

Query: 547  VRDL--------VLTLALCHQV----TPTFEDGELTYQAASPDEIAIVKFTESVGLTLFR 594
              D+        +L LALCH V    +PT    +L  +A SPDE A+V     +G     
Sbjct: 755  NGDIQKKCCEHFMLALALCHSVLTEPSPT-NPNKLEMKAQSPDEAALVTTARDLGFCFMG 813

Query: 595  RDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVI-----FDKQKDEYWFLQKGADV 649
            + +  + +  +  G   E++IL++  FNS  KRM  +I         +     + KGAD 
Sbjct: 814  KTKTGMVV--EIQGIQKEFEILNILEFNSARKRMSCIIKIPGATPNDEPRALLICKGADS 871

Query: 650  VM-----SKIVQKNDWLEEETG----NLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASL 700
            V+     +K  + ++ L E+T       A EGLRTL + ++ L+      +   Y+ A+ 
Sbjct: 872  VIYSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIAAA 931

Query: 701  MMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVE 760
             + NRE  +  ++S  +E DL +LG T +ED+LQ+ V  SI LL  AGIK+W+LTGDKVE
Sbjct: 932  SLTNREEQLE-IVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDKVE 990

Query: 761  TARCVSISAKLVSR-----------------GQYVHTV-----TKVNKPEGALTHLELLK 798
            TA  +  S  L++                  G+  H V     +K  + +  L+  E+  
Sbjct: 991  TAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEMEL 1050

Query: 799  INTNS---------CLLIDGESLGLYL--EYYRQQFFEIVVNLPAVIACRCTPQQKADVA 847
             N             ++IDG++L + L  +  +++F  +  N  AV+ CR +P QKA V 
Sbjct: 1051 DNAKGDHSFPKGDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAAVV 1110

Query: 848  TFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCHLSKLLL 907
              ++         IGDG NDV+MIQSADVG+GI G+EG+QA + +D++I QF +L++LLL
Sbjct: 1111 KLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRLLL 1170

Query: 908  WHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGWLMVGYATCYTMAPV 967
             HGR SYKR +++     ++ ++ ++    Y I + F+   L++   ++ Y   +T  PV
Sbjct: 1171 VHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTSIPV 1230

Query: 968  FSL-TLDHDIDESLTKTYPELYK 989
              L  LD D++++++   P+LY+
Sbjct: 1231 ILLGILDQDVNDTISLVVPQLYR 1253

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 54/110 (49%), Gaps = 7/110 (6%)

Query: 136 DQQLDREIHPSTTPVYDRYKYAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQ 195
           ++ LD E +P         +Y  N I   KY P++F PK L  QF+ F N+YFL++ +  
Sbjct: 171 EEMLDEEGNPIM-------EYPRNKIRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILG 223

Query: 196 AIPALRIGYLSSYIVPLAFVLTVTMSKEALDDIQRRRRDRESNNELYEVL 245
           A     +       VPL  ++ +T  K+ ++D +R   D E NN    +L
Sbjct: 224 AFQIFGVTNPGLSAVPLIVIVIITAIKDGIEDSRRTILDLEVNNTRTHIL 273

>Scas_636.16
          Length = 1554

 Score =  335 bits (860), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 257/891 (28%), Positives = 436/891 (48%), Gaps = 135/891 (15%)

Query: 254  KDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLR--IACPLTQHL 311
            K+++VGD+++I      PAD++LL +S+  G  +++T  LDGE++ K+R  + C      
Sbjct: 378  KNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRN 437

Query: 312  SQDDLLYRISITASVPEKSINNFLGKLTF-----GEIQSQPLSVDNTMWANTVFASAGTA 366
            S+D    +  + +  P  ++  + G L +     G+  ++P++++N +       +   A
Sbjct: 438  SRDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWA 497

Query: 367  IACVVYTGADTRQAMNTSMSSVKTGLLELEINSLSKILCACVFILSVALVA--------- 417
            +  VV+TG DT+  +N  ++  K   +  E+N    +L   VF+  + L+A         
Sbjct: 498  MGIVVFTGDDTKTMINAGVTPTKKSRISRELNF--SVLINFVFLFILCLIAGVANGAYYR 555

Query: 418  -------------FAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDS 464
                          AG    + +V     +IL+ +++P+SL +++++ K+  A  I  D 
Sbjct: 556  KKPRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDV 615

Query: 465  TI-------PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYT----- 512
             +       P T  ++ +I +DLG+IEY+ SDKTGTLTQN ME KK  +  VSY      
Sbjct: 616  LLYNERLDYPCT-PKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTE 674

Query: 513  ----------MDT--------------MDIVTDYVRAMSDNLNS-----SAVPSASKKDL 543
                      +DT               +I+ D +R +S+N        + V     +DL
Sbjct: 675  ALAGLRKRQGIDTEKEGRIEREGIAQDREIMIDDLRKISNNSQFYPEELTFVSKEFSQDL 734

Query: 544  PG--------RVRDLVLTLALCHQV--TPTFED-GELTYQAASPDEIAIVKFTESVGLTL 592
             G        R +  +L LALCH V   P   D  +L   A SPDE A+V     +G + 
Sbjct: 735  LGNNGEVQQKRCQHFMLALALCHSVLVEPDKNDPNKLELTAQSPDETALVTTARDMGFSF 794

Query: 593  FRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVI-----FDKQKDEYWFLQKGA 647
              + +    LL +  G   E+ IL++  FNS  KRM  ++      +K +     + KGA
Sbjct: 795  IGKTKQG--LLVEVQGIQKEFQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICKGA 852

Query: 648  D-VVMSKIVQK----NDWLEEETG----NLAREGLRTLVIGRKRLSKKLLQTFTKDYEDA 698
            D V+ S++ +K    ++ L E+T       A EGLRTL +G++ +S    Q + + Y  A
Sbjct: 853  DSVIYSRLSRKPGYNDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYNIA 912

Query: 699  SLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDK 758
            +  +  RE  + +V +  +E DL +LG T +ED+LQ+ V  SI LL  AGIK+W+LTGDK
Sbjct: 913  AASLAGREEELDHV-ADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDK 971

Query: 759  VETARCVSISAKLVSRGQ---YVHTVTKVNKPEG--------ALTHLELL-KINTNS--- 803
            VETA  +  S  L++       + T  +  K  G        AL    L+ K N      
Sbjct: 972  VETAINIGFSCNLLNTDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGSEE 1031

Query: 804  ----------------CLLIDGESLGLYL--EYYRQQFFEIVVNLPAVIACRCTPQQKAD 845
                             ++IDGE+L + L  +  +++F  +  N  AV+ CR +P QKA 
Sbjct: 1032 ELAAAKKDHSPPQGEFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQKAA 1091

Query: 846  VATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCHLSKL 905
            V   +++        IGDG NDV+MIQSADVGVGI G+EG+QA + +D++I QF ++++L
Sbjct: 1092 VVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRL 1151

Query: 906  LLWHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGWLMVGYATCYTMA 965
            +L HG+  YKR A++     ++ ++ ++    Y + + F+   L++   +  Y   +T  
Sbjct: 1152 VLVHGKWCYKRLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFTSL 1211

Query: 966  PVFSL-TLDHDIDESLTKTYPELYKELTAGKSLSYKTFFVWVVLSLFQGCV 1015
            PV  L  LD D+  +++   P+LY+     +  +   F  ++   ++Q  +
Sbjct: 1212 PVIFLGILDQDVSATVSMIVPQLYRSGILRQEWNQTKFLWYMFDGIYQSVI 1262

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 47/91 (51%)

Query: 155 KYAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAF 214
           +Y  N I   KY P+TF PK +  QF  F N+YFL++ +  A     +       VPL  
Sbjct: 167 EYPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGVTNPGLAAVPLIV 226

Query: 215 VLTVTMSKEALDDIQRRRRDRESNNELYEVL 245
           ++ +T  K+A++D +R   D E NN    +L
Sbjct: 227 IIILTAIKDAIEDSRRTLLDMEVNNTRTHIL 257

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score =  333 bits (854), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 257/879 (29%), Positives = 434/879 (49%), Gaps = 128/879 (14%)

Query: 254  KDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLR--IACPLTQHL 311
            K++KVGD++++      PAD++LL +S+  G  +++T  LDGET+ K+R  + C      
Sbjct: 444  KNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKS 503

Query: 312  SQDDLLYRISITASVPEKSINNFLGKLTF-----GEIQSQPLSVDNTMWANTVFASAGTA 366
            S+D    +  + +  P  ++ ++ G   +     G I+++P++++N +       +   A
Sbjct: 504  SRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWA 563

Query: 367  IACVVYTGADTRQAMNTSMSSVKTGLLELEIN-------SLSKILCACVFILS------- 412
            +  V++TG DT+  +N  ++  K   +  E+N        L  ILC    I++       
Sbjct: 564  MGMVIFTGDDTKIMINAGVTPTKKSRISRELNFSVILNFVLLFILCFTAGIVNGVYYKQK 623

Query: 413  ------VALVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTI 466
                         G  + + +V     +IL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 624  PRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYTDVLL 683

Query: 467  PETIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSY--------- 511
                +      ++  I +DLG+IEY+ SDKTGTLTQN ME KK  +  VSY         
Sbjct: 684  YNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 743

Query: 512  --------------------TMDTMDIVTDYVRAMSDNL-----NSSAVPSASKKDLPGR 546
                                     + + D +R+MSDN      + + V     +DL G 
Sbjct: 744  GLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKEIVEDLKGS 803

Query: 547  VRD--------LVLTLALCHQV--TPTFED-GELTYQAASPDEIAIVKFTESVGLTLFRR 595
              D         +L LALCH V   P  +D  +L  +A SPDE A+V     +G +    
Sbjct: 804  SGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLGYSFVGS 863

Query: 596  DRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVI-----FDKQKDEYWFLQKGAD-V 649
             +    L+ +  G   E+ +L+V  FNS  KRM  +I       K + +   + KGAD V
Sbjct: 864  SKSG--LIVEIQGVQKEFQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKGADSV 921

Query: 650  VMSKI--VQKNDWLEEETG----NLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMML 703
            + S++   Q +  L E+T       A EGLRTL + ++ L+    + + K Y+ A+  + 
Sbjct: 922  IYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAAASVT 981

Query: 704  NREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETAR 763
            NRE  +  V +  +E +L +LG T +ED+LQ+ V  SI LL  AGIK+W+LTGDKVETA 
Sbjct: 982  NREEELDKV-TDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKVETAI 1040

Query: 764  CVSISAKLVSR----------GQYV------------HTVTKVNKPE----GALTHLELL 797
             +  S  +++           G+ V            + VTK  + +    G+   L+  
Sbjct: 1041 NIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEELKEA 1100

Query: 798  K-----INTNSCLLIDGESLGLYL--EYYRQQFFEIVVNLPAVIACRCTPQQKADVATFI 850
            K        N  ++IDG++L + L  E  R++F  +  N  AV+ CR +P QKA V   +
Sbjct: 1101 KREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPAQKAAVVKLV 1160

Query: 851  REVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCHLSKLLLWHG 910
            ++        IGDG NDV+MIQSADVGVGI G+EG+QA + +D++I QF ++++L+L HG
Sbjct: 1161 KKTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLVLVHG 1220

Query: 911  RNSYKRSAKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGWLMVGYATCYTMAPVFSL 970
            +  YKR A++     ++ ++ ++    Y I + F+   L++   +  Y   +T  PV  L
Sbjct: 1221 KWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTSVPVILL 1280

Query: 971  T-LDHDIDESLTKTYPELYKELTAGKSLSYKTFFVWVVL 1008
              LD D+ ++++   P+LY+     K  + +T F+W +L
Sbjct: 1281 AVLDQDVSDTVSMLVPQLYRVGILRKEWN-QTKFLWYML 1318

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 98/230 (42%), Gaps = 31/230 (13%)

Query: 31  EDSLDAALESLQI----HTGGSPAREDFEMTSLRSNESQKNARQSDTEPLINNGATAPNS 86
           E+ +D  L S Q     +TGG      FE   L +NE   N  Q+D +       T  N 
Sbjct: 107 ENEVDDDLHSFQATPMPNTGG------FEDVELDNNEGSNNDSQADHKLKRVRFGTRRNK 160

Query: 87  WSHDPRHDSDRSTA---SGSPFWSRITKFMRSSHSPKVSTYKATSNSIQ-------LKDD 136
                R D +RS     +   F + I +F     S + S  +  S+ ++       L +D
Sbjct: 161 ---SGRIDINRSKTLKWAKKNFHNAIDEFSTKEDSLENSALQNRSDELRTVYYNLPLPED 217

Query: 137 QQLDREIHPSTTPVYDRYKYAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQA 196
             LD +  P    VY R     N I   KY P+TF PK +  QF  F N+YFL++ +  A
Sbjct: 218 M-LDEDGLP--LAVYPR-----NKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGA 269

Query: 197 IPALRIGYLSSYIVPLAFVLTVTMSKEALDDIQRRRRDRESNNELYEVLS 246
                +       VPL  ++ +T  K+ ++D +R   D E NN    +LS
Sbjct: 270 FQIFGVTNPGFASVPLIVIVIITAIKDGIEDSRRTVLDLEVNNTRTHILS 319

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score =  330 bits (847), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 255/890 (28%), Positives = 435/890 (48%), Gaps = 136/890 (15%)

Query: 254  KDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLR--IACPLTQHL 311
            K + VGD++++      PAD++LL SS+  G  +++T  LDGET+ K+R  + C      
Sbjct: 444  KSVSVGDIVRVHNNDEIPADIILLSSSDSDGACYVETKNLDGETNLKVRQSLKCSHMIRN 503

Query: 312  SQDDLLYRISITASVPEKSINNFLGKLTF-----GEIQSQPLSVDNTMWANTVFASAGTA 366
            S++    +  + +  P  ++ ++ G L +     G  +++P++++N +       +   A
Sbjct: 504  SRNITRTKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTLRNTKWA 563

Query: 367  IACVVYTGADTRQAMNTSMSSVKTGLLELEINSLSKILCACVFILSVALVAFAGFNNNDW 426
            +  VV+TG DT+  +N  ++  K   +  E+N    +  A +F+L  A    AG  N  +
Sbjct: 564  MGIVVFTGPDTKIMLNAGVTPTKVSRISRELNLSVFMNFALLFVLCFA----AGIVNGVY 619

Query: 427  Y------------------------VDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEH 462
            Y                        V     LIL+ +++P+SL +++++ K+  A  I  
Sbjct: 620  YRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTAQALFIYG 679

Query: 463  DSTI-------PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSY---- 511
            D  +       P T  ++ TI +DLG+IEY+ SDKTGTLTQN ME KK  +  VSY    
Sbjct: 680  DVALYNERLDYPCT-PKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAY 738

Query: 512  -------------------TMDTMDIVTDY------VRAMSDN--LNSSAVPSASK---K 541
                                ++   I  D       ++ + +N  L    V   SK   +
Sbjct: 739  TEALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTFVSKEFVQ 798

Query: 542  DLPGRV--------RDLVLTLALCHQV--TPTFEDGE-LTYQAASPDEIAIVKFTESVGL 590
            D  G           + +L LALCH V      +D E + ++A SPDE A+V     +G 
Sbjct: 799  DTAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVGTARDMGF 858

Query: 591  TLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVI-----FDKQKDEYWFLQK 645
            +   R ++ + +  D  G   EY +L+V  FNS  KRM  ++        ++     + K
Sbjct: 859  SFVGRTKNGVIV--DIQGVQKEYRLLNVLEFNSTRKRMSCILKIPSENPNEEPRALLICK 916

Query: 646  GAD-VVMSKIVQKNDW-LEEETG----NLAREGLRTLVIGRKRLSKKLLQTFTKDYEDAS 699
            GAD ++ S++ + ND  L E+T       A EGLRTL I ++ LS K  Q + + +E A+
Sbjct: 917  GADSIIYSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWNEKHEIAA 976

Query: 700  LMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKV 759
              +++RE  M  V +  +E +L +LG T +ED+LQ+ V  SI  L  AGIK+W+LTGDKV
Sbjct: 977  AALVDREDEMEKV-ADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLWVLTGDKV 1035

Query: 760  ETARCVSISAKLVSRGQYVHTVTKV--------NKP------------------EGALTH 793
            ETA  +  S  L++    +  +           +KP                   G+   
Sbjct: 1036 ETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQMSGSYEE 1095

Query: 794  LELLKI-----NTNSCLLIDGESLGLYL--EYYRQQFFEIVVNLPAVIACRCTPQQKADV 846
            LE  K        N  ++IDG++L L L  +  +++F  +     AV+ CR +P QKA V
Sbjct: 1096 LEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVSPAQKAAV 1155

Query: 847  ATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCHLSKLL 906
               ++         IGDG NDV+MIQSAD+GVGI G+EG+QA +++D++I QF +L++L+
Sbjct: 1156 VKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLV 1215

Query: 907  LWHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGWLMVGYATCYTMAP 966
            L HGR SYKR A++     ++ ++ ++    Y + + ++   L++   +  +   +T  P
Sbjct: 1216 LVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFNLAFTSLP 1275

Query: 967  VFSL-TLDHDIDESLTKTYPELYKELTAGKSLSYKTFFVWVVLSLFQGCV 1015
            V  L  LD D+++ ++   P+LY+        +   F++++  +++Q  +
Sbjct: 1276 VIFLGILDQDVNDIVSMVVPQLYRVGILRSEWNQTKFWLYMFDAMYQSVI 1325

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 50/103 (48%)

Query: 156 YAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFV 215
           Y  N I   KY P+TF PK +  QFK   N+YFL++ +        +       VPL  +
Sbjct: 240 YPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVI 299

Query: 216 LTVTMSKEALDDIQRRRRDRESNNELYEVLSKSQLVPSKDLKV 258
           + +T  K+A++D +R   D E NN    +L   + V   + KV
Sbjct: 300 VVLTSFKDAIEDSRRTILDMEVNNAPTHILKGVENVNVSNDKV 342

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score =  328 bits (842), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 251/893 (28%), Positives = 425/893 (47%), Gaps = 140/893 (15%)

Query: 254  KDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLTQHL-- 311
            K++KVGD+++I      PAD++LL +S+  G  +++T  LDGET+ K+R +   T  +  
Sbjct: 406  KNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDIRS 465

Query: 312  SQDDLLYRISITASVPEKSINNFLGKLTFG-----EIQSQPLSVDNTMWANTVFASAGTA 366
            S D    R  I +  P  ++ ++ G   +      +++++P++++N +       +   A
Sbjct: 466  SIDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWA 525

Query: 367  IACVVYTGADTRQAMNTSMSSVKTGLLELEINSLSKILCACVFILSVALVAFAGFNNN-- 424
            +  V +TG DT+  +N  ++  K   +  E+N       A +F+L      + G  +N  
Sbjct: 526  MGVVAFTGDDTKIMLNAGVTPTKKSRISKELNLSVLFNFALLFVLCFIAGLYNGIYHNKH 585

Query: 425  ------------------DWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTI 466
                                +V     +IL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 586  PRSRDFFDFGTGTGGSATSGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVMM 645

Query: 467  PETIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDTMDIVT 520
                +      ++  I +DLG+IEY+ SDKTGTLTQN ME KK  +  VSY     + + 
Sbjct: 646  YNEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 705

Query: 521  DYVR-------------------------------AMSDNLNSSAVPSASKK---DLPG- 545
               +                               A +       V   SK+   DL G 
Sbjct: 706  GLRKRQGVDVAHESKIEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEFVDDLTGG 765

Query: 546  -------RVRDLVLTLALCHQV--TPTFED-GELTYQAASPDEIAIVKFTESVGLTLFRR 595
                     +  +L LALCH V   P+ ED  +L  +A SPDE A+V     +G +  ++
Sbjct: 766  SGSVQQKSCQHFMLALALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTARDMGFSFLKK 825

Query: 596  DRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIF-----DKQKDEYWFLQKGADVV 650
             +  + L  +  G   E+ IL++  FNS  KRM  ++         K +   + KGAD V
Sbjct: 826  TKEGMVL--EVQGIEKEFQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSV 883

Query: 651  MSKIVQKNDWLEE--------ETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMM 702
            +   + K    EE             A EGLRTL + ++ LS +  + + K Y+ A+  +
Sbjct: 884  IYSRLDKTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAV 943

Query: 703  LNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETA 762
            ++RE  +  V S  +E  L +LG T +ED+LQ+ V  SI LL  AGIK+W+LTGDKVETA
Sbjct: 944  VDREEELEKV-SDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETA 1002

Query: 763  RCVSISAKLVSR-----------------------------GQYVHTVTKVNKPEGALTH 793
              +  S  L++                               QY+H     +K   A + 
Sbjct: 1003 INIGFSCNLLNNDMELLVIKTTGPDVEDLGATPKDIVDTLISQYLH-----DKFGMAGSE 1057

Query: 794  LELLKINTNS-------CLLIDGESL--GLYLEYYRQQFFEIVVNLPAVIACRCTPQQKA 844
             EL K             ++IDGE+L   L  E  +++F  +  N  +V+ CR +P QKA
Sbjct: 1058 EELKKAKAEHDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKA 1117

Query: 845  DVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCHLSK 904
             V   ++         IGDG NDV+MIQSA++GVGI G+EG+QA +++D++I QF +L++
Sbjct: 1118 AVVKLVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTR 1177

Query: 905  LLLWHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGWLMVGYATCYTM 964
            LLL HG+  YKR A++     ++ ++ ++    + I + ++   L++   +  Y   +T 
Sbjct: 1178 LLLVHGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAFTS 1237

Query: 965  APVFSLTL-DHDIDESLTKTYPELYKELTAGKSLSYKTFFVWVVL-SLFQGCV 1015
             PV  L + D D+ ++++  +P+LY+     K  S +T F+W +L  L+Q  +
Sbjct: 1238 IPVILLGIFDQDVSDTISLVFPQLYRVGILRKEWS-QTKFLWYMLDGLYQSVI 1289

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 47/91 (51%)

Query: 156 YAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFV 215
           Y  N I   KY P+TF+PK +  QF  F N+YFL++ +  A     +       VPL  +
Sbjct: 196 YPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIFGVTNPGFSAVPLIVI 255

Query: 216 LTVTMSKEALDDIQRRRRDRESNNELYEVLS 246
           + +T  K+ ++D +R   D E NN    VL+
Sbjct: 256 IIITAIKDGIEDSRRTVLDLEVNNTKTHVLT 286

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score =  327 bits (837), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 274/987 (27%), Positives = 455/987 (46%), Gaps = 162/987 (16%)

Query: 254  KDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLR--IACPLTQHL 311
            KD++VGD+++I      PAD++LL +S+  G  +++T  LDGET+ K+R  + C      
Sbjct: 406  KDIRVGDIVRIHNNDEIPADIILLSTSDADGACYVETKNLDGETNLKVRQSLKCSHRIRN 465

Query: 312  SQDDLLYRISITASVPEKSINNFLGKLTF-----GEIQSQPLSVDNTMWANTVFASAGTA 366
            S+D    +  + +  P  ++ ++ G   +     G + ++P++++N +       +   A
Sbjct: 466  SKDISRCKFWVESEGPHANLYSYQGNFKWVDSETGVMHNEPVNINNMLLRGCSLRNTKWA 525

Query: 367  IACVVYTGADTRQAMNTSMSSVKTGLLELEINSLSKILCACVFILSVALVAFAGFNNNDW 426
            +  V++TG DT+  +N  ++  K   +  E+N    +    +F+L +A    AG  N  +
Sbjct: 526  MGIVMFTGTDTKIMLNAGVTPTKRSRISRELNYSVILNFVFLFVLCLA----AGLVNGIY 581

Query: 427  Y------------------------VDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEH 462
            Y                        +     LIL+ +++P+SL +++++ K+  A  I  
Sbjct: 582  YRRDATSRTFFEFGTVAGTPFANGILAFFVALILYQSLVPISLYISIEIIKTAQAAFIYG 641

Query: 463  DSTI--PE----TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTM--- 513
            D  +  P+       RT  I +DLG+IEY+ SDKTGTLTQN ME KK  +  VSY     
Sbjct: 642  DVLLYNPKLDYPCTPRTWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYT 701

Query: 514  ---------------------------DTMDIVTDYVR-AMSDNLNSSAVPSASK---KD 542
                                       D   +V   ++   +  L+   V   SK   +D
Sbjct: 702  EALAGLRKRQGVDIEEEGARERAEIEEDKKQMVELLLKLGKNSQLDPHTVTFVSKELVQD 761

Query: 543  LPGR--------VRDLVLTLALCHQVTPTFEDG---ELTYQAASPDEIAIVKFTESVGLT 591
            L G         V   +L+LALCH V          +L  +A SPDE A+V+    +G +
Sbjct: 762  LGGANSQEQKEAVEHFMLSLALCHSVVVEENKNNPEKLDIKAQSPDEAALVETARDMGFS 821

Query: 592  LFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKDE-----YWFLQKG 646
               R ++ + +  +  G   E+ IL+V  FNS  KRM  ++     DE        L KG
Sbjct: 822  FVGRTKNGVII--EIQGVQKEFRILNVLEFNSTRKRMSCIVKIPAADENSKPKALLLCKG 879

Query: 647  AD-VVMSKIVQ-KND-WLEEETG----NLAREGLRTLVIGRKRLSKKLLQTFTKDYEDAS 699
            AD V+ S++ + +ND  L E T       A EGLRTL + ++ +       + +  E A+
Sbjct: 880  ADSVIYSRLDRSRNDPKLLERTALHLEQFATEGLRTLCVAQREIDWDEYLNWNERRELAA 939

Query: 700  LMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKV 759
              + NRE  +  V +  +E  L +LG T +ED+LQ+ V  SI +L +AGIK+W+LTGDKV
Sbjct: 940  ASLDNREEALERV-ADAIERQLVLLGGTAIEDRLQDGVPDSISILADAGIKLWVLTGDKV 998

Query: 760  ETARCVSISAKLV----------SRGQYV---------------------HTVTKVNKPE 788
            ETA  +  S  L+          S G+ V                     H   K +  E
Sbjct: 999  ETAINIGFSCNLLGSDMELLVIKSSGEDVEHLGEKDSDVVLALIDKYLETHFNMKGSPEE 1058

Query: 789  GALTHLELLKINTNSCLLIDGESLGLYL--EYYRQQFFEIVVNLPAVIACRCTPQQKADV 846
             A    +     +   ++IDG++L L L  E  R++F  +  N  AV+ CR +P QKA V
Sbjct: 1059 LAAARKDHTPPQSAFGVVIDGDALKLALHGEDIRRKFLLLCKNCKAVLCCRVSPSQKAAV 1118

Query: 847  ATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCHLSKLL 906
               ++E        IGDG NDV+MIQ+ADVG+GI G+EG+QA ++AD++I QF +L++L+
Sbjct: 1119 VKLVKESLDVVTLAIGDGSNDVAMIQAADVGIGIAGEEGRQAVMSADYAIGQFRYLTRLV 1178

Query: 907  LWHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGWLMVGYATCYTMAP 966
            L HGR SYKR A++     ++ +  ++    + I S ++   L++   ++ Y   +T  P
Sbjct: 1179 LVHGRWSYKRLAEMIPQFFYKNITFTLALFWFGICSNYDGSYLFEYTYLMFYNLAFTSLP 1238

Query: 967  VFSL-TLDHDIDESLTKTYPELYKELTAGKSLSYKTFFVWVVLSLFQGCVIQGLSQGFTS 1025
            V  L  +D D  + L+   P+LYK        +   F+ +    ++Q             
Sbjct: 1239 VIFLGIMDQDASDVLSVVVPQLYKVGILRTEWTQNKFWWYCFDGVYQS------------ 1286

Query: 1026 LDELDFKRLVALSFTVLILNELIMVAIEIYTWNKTMVVSEVVTFLIFVGSVPLLE-EYFD 1084
                    ++   F  L      ++    Y       +    TF +FV S+ ++    + 
Sbjct: 1287 --------IICFFFPYLCYYRTGLITKNAYG------LDHRYTFGVFVTSIAVVSCNLYV 1332

Query: 1085 LTYMSRPEYYGKLAIILSLSIIPVWAA 1111
            L +  R +++  L I LS  I+  W  
Sbjct: 1333 LIHQYRWDWFTTLFIFLSCGILFFWTG 1359

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 46/90 (51%)

Query: 156 YAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFV 215
           Y  N I   KY P++F+PK L  QFK   N+YFLL+     +    +   +   +PL  +
Sbjct: 203 YPRNKIRTTKYTPLSFLPKNLAYQFKNAANIYFLLLVCLSFVSIFGVTNPALAAIPLIAI 262

Query: 216 LTVTMSKEALDDIQRRRRDRESNNELYEVL 245
           + +T  K+A +D +R   D E NN    +L
Sbjct: 263 VVITGLKDAFEDSRRTILDLEVNNMRSHIL 292

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score =  217 bits (552), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 140/404 (34%), Positives = 217/404 (53%), Gaps = 18/404 (4%)

Query: 653  KIVQKNDWLEEETGN----LAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVT 708
            K+++  +++ E+T N     + EGLRTL+   K +  +  + +   Y +A   + NR   
Sbjct: 928  KLIKNEEFILEKTLNAIDEFSTEGLRTLLYSYKWIPAEEYKAWEAKYHEAKTSLTNRSTQ 987

Query: 709  MSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSIS 768
            ++ V   H+E DLE+LG T +EDKLQE V  +I+ +R AGIK+WMLTGDK ETA  +  +
Sbjct: 988  IAEV-GGHIETDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYA 1046

Query: 769  AKLVSRGQYVHTVTK-----VNKPEGALTHLELLKINTNSCLLIDGESLGLYLE--YYRQ 821
             KL+     V  + K     ++K       L+  KI  +  L+IDG SL ++        
Sbjct: 1047 CKLIYDYSTVVILKKNDDNLISKMTALGEELDTGKI-AHCVLVIDGASLAVFENNPTMMS 1105

Query: 822  QFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKRVC-CIGDGGNDVSMIQSADVGVGI 880
             F E+     +VI CR +P QKA + T IR      V   IGDG ND++MIQSAD+GVGI
Sbjct: 1106 VFIELCTKTDSVICCRASPSQKALIVTNIRLKNKDLVTLAIGDGANDIAMIQSADIGVGI 1165

Query: 881  VGKEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSI 940
             GKEG QAS ++D+SI QF +L KLL  HGR +Y R++K      ++ +L  + Q +Y  
Sbjct: 1166 TGKEGLQASRSSDYSIAQFRYLLKLLFVHGRYNYVRTSKFVLCTFYKEVLFYLTQMIYQR 1225

Query: 941  SSKFEPIALYQGWLMVGYATCYTMAPVFSLTL-DHDIDESLTKTYPELYKELTAGKSLSY 999
             + F   +LY+ W +  + T +T  PV  + + + D+        PELY      ++ + 
Sbjct: 1226 QTMFSGTSLYEPWSLSMFNTLFTSLPVICIGMFEKDLKPMTLLAVPELYTMGQKCQAFNL 1285

Query: 1000 KTFFVWVVLSLFQGCVIQGLS---QGFTSLDELDFKRLVALSFT 1040
            K F VW++ +     +I  L+    GFT+  +     +  ++FT
Sbjct: 1286 KIFLVWMLTAAGISVLITFLNFEIWGFTAQSDNSIYPIGVINFT 1329

 Score =  114 bits (284), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 86/288 (29%), Positives = 149/288 (51%), Gaps = 35/288 (12%)

Query: 254 KDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACP-LTQHLS 312
           KDLKVG+ + +      PAD++LL +   + E F++T  LDGET+ K +   P L + ++
Sbjct: 275 KDLKVGEFVLLNSDDWVPADILLLSTDGENNEAFVETMALDGETNLKSKNPLPELAKRMT 334

Query: 313 QDDLLYRISITASV--PEKSINNFLGKLTF-GEIQSQPLSVDNTMWANTVFASAGTAIAC 369
               L   S T ++  P   + NF G +   GE+   PL  DN ++  ++  +  + +  
Sbjct: 335 SATGLSMHSATTTLEDPNNDLYNFEGTVEIDGEL--YPLGSDNVVYRGSILRNTQSIVGI 392

Query: 370 VVYTGADTRQAMNTSMS-SVKTGLLELEINSLSKILCACVFILSVALVAFAGF------- 421
           V++TG +T+  MN   +   K   L+ +IN +  +L     + ++A+ ++ G        
Sbjct: 393 VIFTGEETKIRMNAIKNPRTKAPKLQGKINLI--VLFMVFVVAAMAMFSYLGQHILKKNY 450

Query: 422 --NNNDWYV---------DIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHD------- 463
             NN  WY+          IM ++I+++T+IP+SL V  ++ K++ +  +E D       
Sbjct: 451 VDNNRAWYLFQEDAGTAPTIMSFIIMYNTLIPLSLYVTTEIIKAMQSKLMEWDIDMYHIE 510

Query: 464 STIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSY 511
           S  P    RT+TI E+LG++ Y+ SDKTGTLT N M  +K  +   S+
Sbjct: 511 SDTP-CESRTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSICGSSW 557

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 59/91 (64%)

Query: 156 YAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFV 215
           Y  N I++++Y   +F+P+ LY QF    N YFLLVA+ Q IP+       + IVPL+  
Sbjct: 116 YRDNVITSSRYTVYSFLPRQLYAQFSKLANAYFLLVAILQMIPSWSTTGTYTTIVPLSIF 175

Query: 216 LTVTMSKEALDDIQRRRRDRESNNELYEVLS 246
           L+++M++EA DD +R R D+E NN+  +VL+
Sbjct: 176 LSISMAREAWDDFKRHRLDKEENNKSTKVLT 206

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 59/115 (51%), Gaps = 9/115 (7%)

Query: 546 RVRDLVLTLALCHQVTPT-FEDG--ELTYQAASPDEIAIVKFTESVGLTLFRRDRHSITL 602
           R +  +L+LALCH   P    DG   + YQ++SPDE+A+V     +G  +  R+  ++++
Sbjct: 668 RAKFFILSLALCHTCLPKKTHDGTDSILYQSSSPDELALVTAARDMGFVVTNRNSSTLSI 727

Query: 603 LHDQSGTN-----FEYDILHVFPFNSDNKRMGIVI-FDKQKDEYWFLQKGADVVM 651
               +G +      +Y++L    F+S  KRM + +      D    + KGAD V+
Sbjct: 728 ATYPNGFDDQPIVEDYEVLEYINFDSQRKRMSVAVKMPNDDDRVLLICKGADNVI 782

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score =  216 bits (551), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 151/445 (33%), Positives = 229/445 (51%), Gaps = 23/445 (5%)

Query: 663  EETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHDLE 722
            E+  + + EGLRTL+   K +S +  + +   Y +A   +  R+  +  V    +E +L 
Sbjct: 963  EDIESFSTEGLRTLLFAHKWISNEDFEQWRTRYHEAKTSLSERKQKIDEV-GAQIEDELY 1021

Query: 723  ILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQYVHTVT 782
            +LG T +EDKLQE V  +IE +R AGIK+WMLTGDK ETA  +  S KL+    Y   V 
Sbjct: 1022 LLGATAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCKLIH--DYSTVVI 1079

Query: 783  KVNKPEGALTHL-----ELLKINTNSCLL-IDGESLGLYLE--YYRQQFFEIVVNLPAVI 834
                 E  ++ +     E+   N   C++ IDG +L ++ +       F E+     +V+
Sbjct: 1080 LTTSDENIISKMNAISQEVDSGNVAHCVIVIDGATLAMFEDNPTLMSVFTELCTKTDSVV 1139

Query: 835  ACRCTPQQKADVATFIREVTGKRVC-CIGDGGNDVSMIQSADVGVGIVGKEGKQASLAAD 893
             CR +P QKA + + IR      V   IGDG ND++MIQSAD+GVGI GKEG QAS +AD
Sbjct: 1140 CCRASPAQKALMVSNIRNTDKSIVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRSAD 1199

Query: 894  FSITQFCHLSKLLLWHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGW 953
            +SI QF  + KLLL HGR +Y R+AK      ++ L   + Q +Y   + F   +LY+ W
Sbjct: 1200 YSIGQFRFILKLLLVHGRYNYIRTAKFILCTFYKELTFYLTQLIYQRYTMFSGTSLYEPW 1259

Query: 954  LMVGYATCYTMAPVFSLTL-DHDIDESLTKTYPELYKELTAGKSLSYKTFFVWVVLSLFQ 1012
             +  Y T +T  PV  + + + D+      T PELY      K+ ++  F  WV L    
Sbjct: 1260 SLSMYNTLFTSLPVLCVGMFEKDLKPVTLLTVPELYSMGRLSKAFNWSIFAEWVFLGTAN 1319

Query: 1013 GCVIQGL---SQGFTSLDELDFKRL--VALSFTVLILN-ELIMVAIEIYTWNK-TMVVSE 1065
              +I  L   + G TSL +     L  V  S TV ++N +   + +    W   T V+  
Sbjct: 1320 ALIITFLNIVAWGETSLSDNTLYPLGFVNFSATVALINVKAQFIEMRNRNWLAFTSVILS 1379

Query: 1066 VVTFLIFVGSVPLLEE---YFDLTY 1087
               +L++  ++P+L      +D+TY
Sbjct: 1380 CGGWLVWCCALPILNRSDGIYDVTY 1404

 Score =  176 bits (445), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 129/452 (28%), Positives = 215/452 (47%), Gaps = 75/452 (16%)

Query: 154 YKYAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLA 213
           Y Y  N I++++Y  ++F P+ LY QF    N+YF +VA+ Q IP        + IVPL 
Sbjct: 121 YAYCNNLITSSRYTIISFFPRQLYAQFSKLANVYFFIVAILQMIPGWSTTGTYTTIVPLC 180

Query: 214 FVLTVTMSKEALDDIQRRRRDRESNNELYEVL-------------------------SKS 248
             + ++M++EA DD +R + D+E NN+L +VL                         S S
Sbjct: 181 VFMAISMAREAYDDYRRHKLDKEENNKLTKVLQILHEREDNDLDLENNAQHSANNPESIS 240

Query: 249 QLVPS------------------KDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKT 290
            L  +                  KD++VGD + + +    PAD+++L S   + E+FI+T
Sbjct: 241 NLYFNNFDLLAKKYNVRIVEKKWKDIRVGDFVLLQQDDWVPADILILTSDGDNSEVFIET 300

Query: 291 DQLDGETDWKLRIACPLTQHLSQD-DLLYRIS--ITASVPEKSINNFLGKLTFGEIQSQ- 346
             LDGET+ K ++  P    L++    L  I+  +T   P   + NF G L      S  
Sbjct: 301 MALDGETNLKGKVPHPEINKLTKSASGLANINAQVTVEDPNNDLYNFEGNLELNSGSSSK 360

Query: 347 ---PLSVDNTMWANTVFASAGTAIACVVYTGADTRQAMNTSMS-SVKTGLLELEINSLSK 402
              PL  DN ++  ++  +    +  V++TG +++  MN   +   K   L+ +IN +  
Sbjct: 361 KKYPLGPDNVIYRGSIIRNTRNCVGMVIFTGEESKIRMNALRNPRTKAPKLQRKINMIVV 420

Query: 403 ILC---ACVFILS-----VALVAFAGFNNNDWYV---------DIMRYLILFSTIIPVSL 445
            +    AC+ + S     + +  +   NN  WY+          IM ++I+++TIIP+SL
Sbjct: 421 FMVFVVACMSLFSYLGHTIQIKRYVN-NNKAWYLLQEDAGTAPTIMSFIIMYNTIIPLSL 479

Query: 446 RVNLDLGKSVYAHQIE------HDSTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDM 499
            V ++L K   +  +E      H  +     VRT+TI E+LG++ Y+ SDKTGTLT N M
Sbjct: 480 YVTMELIKVAQSRMMEWDIDMYHAESDTPCAVRTATILEELGQVSYIFSDKTGTLTDNKM 539

Query: 500 ELKKLHLGTVSYTMDTMDIVTDYVRAMSDNLN 531
             +KL     S+  +    ++++  A   N N
Sbjct: 540 LFRKLSFCGTSWVHNATQDISEFKPAQLSNKN 571

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 67/129 (51%), Gaps = 12/129 (9%)

Query: 535 VPSASKKDLPGRVRDLVLTLALCHQVTPTF------EDGELTYQAASPDEIAIVKFTESV 588
           + S  K     + +  +L+LA+CH   P        ED  + YQ++SPDE+A+V     +
Sbjct: 663 IQSNPKSLFAKKAKMFILSLAICHICLPKRTEEGNDEDDIIEYQSSSPDELALVTAARDM 722

Query: 589 GLTLFRRDRHSITLLHDQSGTN----FE-YDILHVFPFNSDNKRMGIVI-FDKQKDEYWF 642
           G  ++ R+ + +TL     G +    FE ++IL +  FNS  KRM +++   ++KD    
Sbjct: 723 GYIVYNRNANILTLKTFPDGFDELPRFENFEILELVDFNSQRKRMSVIVRVPEEKDRVLL 782

Query: 643 LQKGADVVM 651
             KGAD V+
Sbjct: 783 FCKGADNVI 791

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score =  209 bits (533), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 143/442 (32%), Positives = 227/442 (51%), Gaps = 27/442 (6%)

Query: 668  LAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLT 727
             + EGLRTLV   K +     + + K Y  A   + +R++ +       +E  L +LG+T
Sbjct: 1028 FSTEGLRTLVYAYKWIDIGQYENWNKRYHQAKTSLTDRKIKVDEA-GAEIEDGLNLLGVT 1086

Query: 728  GVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQYVHTVTKVNKP 787
             +EDKLQ+ V  +IE +R AGIK+WMLTGDK ETA  +  S  L+    Y   V      
Sbjct: 1087 AIEDKLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCMLIK--DYSTVVILTTTD 1144

Query: 788  EGALTHL-----ELLKINTNSCLL-IDGESLGLYL--EYYRQQFFEIVVNLPAVIACRCT 839
            E  ++ +     E+   N   C++ IDG ++ ++     Y   F E+     +VI CR +
Sbjct: 1145 ENIISKMNAVSQEVDSGNIAHCVVVIDGATMAMFEGNPTYMSVFVELCTKTDSVICCRAS 1204

Query: 840  PQQKADVATFIREVTGKRVC-CIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQ 898
            P QKA + + IR      V   IGDG ND++MIQSAD+GVGI GKEG QAS  +D+SI Q
Sbjct: 1205 PSQKALMVSNIRNTDPNLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRVSDYSIGQ 1264

Query: 899  FCHLSKLLLWHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGWLMVGY 958
            F  L KLL  HGR +Y R++K      ++ +     Q +Y   + F   +LY+ W +  +
Sbjct: 1265 FRFLLKLLFVHGRYNYIRTSKFMLCTFYKEITFYFTQLIYQRYTMFSGSSLYEPWSLSMF 1324

Query: 959  ATCYTMAPVFSLTL-DHDIDESLTKTYPELYKELTAGKSLSYKTFFVWVVLSLFQGCVIQ 1017
             T +T  PV  + + + D+      T PELY      +  ++  F  WV+L+     +I 
Sbjct: 1325 NTLFTSLPVLCIGMFEKDLKPMTLLTVPELYSYGRLSQGFNWLIFMEWVILATTNSLIIT 1384

Query: 1018 GLS---QGFTSLDELDFKRLVALSFTVLILNELIMVA---IEIYTWNKTMVVSEVVT--- 1068
             L+    G +SL +     L  ++FT ++   LI V    +E++  N     S V++   
Sbjct: 1385 FLNVVMWGMSSLSDNTMYPLGLINFTAIV--ALINVKSQFVEMHNRNWLAFTSVVLSCGG 1442

Query: 1069 FLIFVGSVPLL---EEYFDLTY 1087
            +L++  ++P+L   ++ +D+ Y
Sbjct: 1443 WLVWCCALPILNNTDQIYDVAY 1464

 Score =  153 bits (386), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 130/480 (27%), Positives = 221/480 (46%), Gaps = 102/480 (21%)

Query: 156 YAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFV 215
           Y  N I++++Y   +F+P+ LY QF    N YF +VA+ Q IP        + I+PL   
Sbjct: 138 YCDNRITSSRYTFYSFLPRQLYAQFSKLANTYFFIVAVLQMIPGWSTTGTYTTIIPLCVF 197

Query: 216 LTVTMSKEALDDIQRRRRDRE------------SNNELYEV-------------LSKS-- 248
           + ++M++EA DD +R R D+E             NN+  EV             L+KS  
Sbjct: 198 MGISMTREAWDDFRRHRLDKEENNKPVGVLVKDGNNDAQEVYTLPSSVVSSTAYLTKSAA 257

Query: 249 --------------------------QLVPSK-----------DLKVGDLIKIGKGARAP 271
                                     +L+ +K            L+VGD + + +    P
Sbjct: 258 AENNPPLNDDRNSSQGHFLDTHFNNFELLKNKYNVHIHQKKWEKLRVGDFVLLTQDDWVP 317

Query: 272 ADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLTQHLSQD-DLLYRISITASVPEKS 330
           ADL+LL     + E F++T  LDGET+ K +   P    L++    L  I+   +V + +
Sbjct: 318 ADLLLLTCDGENSECFVETMALDGETNLKSKQPHPELNKLTKAASGLANINAQVTVEDPN 377

Query: 331 IN--NFLGKLTFGE-----IQSQPLSVDNTMWANTVFASAGTAIACVVYTGADTRQAMNT 383
           I+  NF G L         I   PL  DN ++  ++  +    +  V+++G +T+  MN 
Sbjct: 378 IDLYNFEGNLELKNHRNDTIMKYPLGPDNVIYRGSILRNTQNVVGMVIFSGEETKIRMN- 436

Query: 384 SMSSVKTGLLELEINSLSKILCACVFIL-SVALVAFAGF---------NNNDWYV----- 428
           ++ + +T   +L+   ++ I+   VF++ +++L ++ G           N  WY+     
Sbjct: 437 ALKNPRTKAPKLQ-RKINMIIVFMVFVVATISLFSYLGHVLHKKKYIDQNKAWYLFQADA 495

Query: 429 ----DIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIE------HDSTIPETIVRTSTIPE 478
                IM ++I+++T+IP+SL V +++ K V +  +E      H  T      RT+TI E
Sbjct: 496 GVAPTIMSFIIMYNTVIPLSLYVTMEIIKVVQSKMMEWDIDMYHAETNTPCESRTATILE 555

Query: 479 DLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDTMDIVT--DYVRAMSDNLNSSAVP 536
           +LG++ Y+ SDKTGTLT N M  +K  L   S+ +  +D+    D      DN NS  +P
Sbjct: 556 ELGQVSYIFSDKTGTLTDNKMIFRKFSLCGSSW-LHNVDLGNSEDNFEDNRDNTNSLRLP 614

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 62/122 (50%), Gaps = 13/122 (10%)

Query: 546 RVRDLVLTLALCHQVTPTFEDGE------LTYQAASPDEIAIVKFTESVGLTLFRRDRHS 599
           + +   L+LALCH   P     E      + YQ++SPDE+A+V     +G  +  R+   
Sbjct: 727 KAKFFFLSLALCHSCLPKKTHNESIGEDSIEYQSSSPDELALVTAARDLGYIVLNRNAQI 786

Query: 600 ITLLHDQSGTNFE-----YDILHVFPFNSDNKRMGIVI-FDKQKDEYWFLQKGAD-VVMS 652
           +T+     G + E     Y+IL+   FNS  KRM +++    Q ++   + KGAD V+M 
Sbjct: 787 LTIKTFPDGFDGEAKLENYEILNYIDFNSQRKRMSVLVRMPNQPNQVLLICKGADNVIME 846

Query: 653 KI 654
           ++
Sbjct: 847 RL 848

>Kwal_23.3556
          Length = 1597

 Score =  208 bits (530), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 140/407 (34%), Positives = 212/407 (52%), Gaps = 20/407 (4%)

Query: 654  IVQKNDWLEEET----GNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTM 709
            ++Q  +++ E T     + +  GLRTL+   K +  +  + ++K Y  A   + NR+  M
Sbjct: 949  LIQNEEFVLERTLQAIEDFSTSGLRTLLYSYKWIPSEDYEKWSKKYHAAKTSLENRKEKM 1008

Query: 710  SNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISA 769
             +V  + +E  L +LG T +EDKLQE V  +I+ +R AGIK+WMLTGDK ETA  +  S 
Sbjct: 1009 HSV-GELVETSLHLLGATAIEDKLQEGVADAIDKIRRAGIKMWMLTGDKRETAINIGYSC 1067

Query: 770  KLVSRGQYVHTVTKVNKPEGALTHL-----ELLKINTNSCLL-IDGESLGLYLE--YYRQ 821
             L+    Y   V    K E   + L     E+ + N   C++ IDG +L  +        
Sbjct: 1068 NLIH--DYSTVVILSAKDENISSKLTAVSQEIERGNIAHCVVVIDGSTLTTFESNPTLMS 1125

Query: 822  QFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKRVC-CIGDGGNDVSMIQSADVGVGI 880
             F E+     +VI CR +P QKA + T IR    K V   IGDG ND++MIQSAD+GVGI
Sbjct: 1126 VFVELCTKTDSVICCRASPSQKALMVTHIRNTDKKLVTLAIGDGANDIAMIQSADIGVGI 1185

Query: 881  VGKEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSI 940
             GKEG QAS ++D+SI QF  L KLLL HGR +Y R+ K      ++ LL  + Q +Y  
Sbjct: 1186 AGKEGLQASRSSDYSIAQFRFLLKLLLVHGRYNYVRTTKFVLCTFYKELLFYLTQMIYQR 1245

Query: 941  SSKFEPIALYQGWLMVGYATCYTMAPVFSLTL-DHDIDESLTKTYPELYKELTAGKSLSY 999
             + F   +LY+ W +  + T +T  PV  + + + D+        PELY      +S + 
Sbjct: 1246 HTMFSGTSLYEPWSLSMFNTLFTSLPVLCIGMFEKDLKPMTLLAIPELYSIGRLSQSFNL 1305

Query: 1000 KTFFVWVVLSLFQGCVIQGLS---QGFTSLDELDFKRLVALSFTVLI 1043
            + F  W+ L+     +I  L+      +SL +     +  ++FT +I
Sbjct: 1306 RVFLYWMFLAALNSLIITFLNWKIWAVSSLSDNTVYPIGVINFTAII 1352

 Score =  120 bits (301), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 90/325 (27%), Positives = 157/325 (48%), Gaps = 47/325 (14%)

Query: 254 KDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWK-----------LR 302
           KD+KVGD + + +    PAD+++L  S+   E F++T  LDGET+ K           ++
Sbjct: 268 KDIKVGDYVVLEQDEWVPADMLVLTCSDEKNECFVETMALDGETNLKNKQPLTEVSEVMK 327

Query: 303 IACPLTQHLSQDDLLYRISITASVPEKSINNFLGKLTF-GEIQSQPLSVDNTMWANTVFA 361
            A  LT+        ++  +T   P   ++NF G L   GE +   +  D+ ++  ++  
Sbjct: 328 TAAGLTE--------FKAKVTVEDPNIDLHNFEGNLELLGENRKLTIGPDHIIYRGSIIR 379

Query: 362 SAGTAIACVVYTGADTRQAMNT-SMSSVKTGLLELEINSLSKILCACVFILSVALVAFAG 420
           +   A+  VV+TG +T+  MN      +K   L+  IN +  +L     + S+AL +  G
Sbjct: 380 NTSNAVGMVVFTGEETKIRMNAIKNPRIKAPKLQRAINLI--VLFMVFVVASMALFSLLG 437

Query: 421 F---------NNNDWYV---------DIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIE- 461
                     NN  WY+          +M ++I+++T+IP+SL V +++ K++ +  +E 
Sbjct: 438 QRIIKKKYVDNNRAWYLFNSDAGLAPTVMSFIIMYNTLIPLSLYVTMEIIKAMQSKLMEW 497

Query: 462 -----HDSTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDTM 516
                H  T      RT+TI E+LG++ Y+ SDKTGTLT N M  + L +   S+  D  
Sbjct: 498 DIDMYHAETNTPCESRTATILEELGQVSYIFSDKTGTLTDNKMVFRALSVCGSSWIHDFD 557

Query: 517 DIVTDYVRAMSDNLNSSAVPSASKK 541
                  ++ S + N+  V S   +
Sbjct: 558 PAAEKLTKSESSDSNTVEVVSVDDR 582

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 73/146 (50%)

Query: 156 YAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFV 215
           Y  N I++++Y   TF+P+ LY QF    N YF LVA+ Q IP        + IVPL   
Sbjct: 108 YISNLITSSRYTIYTFLPRQLYAQFSRLANAYFFLVAVLQMIPGWSTTGTYTTIVPLLIF 167

Query: 216 LTVTMSKEALDDIQRRRRDRESNNELYEVLSKSQLVPSKDLKVGDLIKIGKGARAPADLV 275
           + ++MS+EA DD +R + DRE N++   VL KS    ++  +   L  + +  ++     
Sbjct: 168 MGISMSREAWDDFRRHKLDREENDKTARVLVKSSSPHTEFSRPNSLYSLPQWQQSATSTS 227

Query: 276 LLQSSEPSGEIFIKTDQLDGETDWKL 301
           +L +          T Q D  T+W L
Sbjct: 228 MLTNPTLESTAEAATSQNDDHTNWDL 253

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 65/125 (52%), Gaps = 11/125 (8%)

Query: 546 RVRDLVLTLALCHQVTPTFEDGE-----LTYQAASPDEIAIVKFTESVGLTLFRRDRHSI 600
           +V   +L+LALCH   P    G      + YQA+SPDE+A+V     +G  +  R+   +
Sbjct: 664 KVSFFILSLALCHACLPKSSSGVEGEDCVEYQASSPDELALVTAARDMGYAVMNRNSDVL 723

Query: 601 TLLHDQSGTNFE-----YDILHVFPFNSDNKRMGIVI-FDKQKDEYWFLQKGADVVMSKI 654
           T+    +G + E     Y+IL+   F+S  KRM +++    +++    + KGAD V+ + 
Sbjct: 724 TIKTYPNGFDAEPHLDKYEILNNIEFSSHRKRMSVLVRLPHEENRILLICKGADNVILER 783

Query: 655 VQKND 659
           +  +D
Sbjct: 784 LHNSD 788

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score =  206 bits (523), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 124/356 (34%), Positives = 192/356 (53%), Gaps = 13/356 (3%)

Query: 671  EGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVE 730
            EGLRTL+   K +  +  +T+   Y  A   ++NR   M + + + +E DL +LG  G+E
Sbjct: 951  EGLRTLLYSFKWIGNQEYETWNSRYSAAKAALVNRREQM-DTVGEIIERDLTLLGTIGIE 1009

Query: 731  DKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQYVHTVTKVNKPEGA 790
            DKLQE V  +I+ LR AGIK+WMLTGDK ETA  +  S +L+    Y   +      E  
Sbjct: 1010 DKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSCRLIH--DYSTVIILAPNDENM 1067

Query: 791  LTHL-----ELLKINTNSCLL-IDGESLGLYLEYYRQQ--FFEIVVNLPAVIACRCTPQQ 842
             + +     E+   N   C++ IDG +L ++         F E+     +VI CR +P Q
Sbjct: 1068 ASKITTITQEIEAGNVAHCVVVIDGATLTIFEGNLTLMTLFIELCTKTDSVICCRSSPSQ 1127

Query: 843  KADVATFIREVTGKRVC-CIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCH 901
            KA + T IR+   K V   IGDG ND++MIQSAD+GV I GKEG QAS ++D+SI QF +
Sbjct: 1128 KALMVTKIRKTDKKLVTLAIGDGANDIAMIQSADIGVDITGKEGLQASRSSDYSIAQFRY 1187

Query: 902  LSKLLLWHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGWLMVGYATC 961
            L KLLL HGR +Y R++K      ++  +  + Q ++ I++ F   + Y+ W +  + T 
Sbjct: 1188 LLKLLLVHGRYNYIRTSKFVLCTFYKEFVFYLTQLIFQINTMFSGTSQYEPWCLTVFNTL 1247

Query: 962  YTMAPVFSLTL-DHDIDESLTKTYPELYKELTAGKSLSYKTFFVWVVLSLFQGCVI 1016
            +T  PV  + + + D+      + PELY      ++ +   F  W+ ++     +I
Sbjct: 1248 FTSLPVLCIGMFEKDLKSVTLLSIPELYTTGRQSQAFNLVIFLRWMAIAALSSVII 1303

 Score =  164 bits (414), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 119/428 (27%), Positives = 208/428 (48%), Gaps = 74/428 (17%)

Query: 156 YAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFV 215
           Y  NAI++++Y+  +F+P+ L  QF    N YF  +A+ Q +P        + IVPL+  
Sbjct: 110 YIGNAITSSRYSVYSFLPRQLCAQFSKVVNSYFFGMAILQMVPNWSTTGQYTTIVPLSIF 169

Query: 216 LTVTMSKEALDDIQRRRRDRESNNELYEVLSKSQ-------------------------- 249
           + +++++E  +D +R + DRE NN+L +VL+++                           
Sbjct: 170 MGISIAREGWEDFRRHKLDREENNKLVKVLAQAHDSEFGDNKDISAEARAASFTDFETLQ 229

Query: 250 ------LVPS--KDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKL 301
                 +V    KD++VG+ + + +    PADL LL +   + E +++T  LDGET+ K 
Sbjct: 230 ANHGVAVVEKQWKDVEVGEFVLLNQDDWVPADLFLLATDGDNNECYVETMALDGETNLKC 289

Query: 302 RIACP--LTQHLSQDDL-LYRISITASVPEKSINNFLGKLTF----GEIQSQPLSVDNTM 354
           +   P   +Q  +   L  +R   T   P   + NF GK+      GE Q+  + +DN +
Sbjct: 290 KHVLPKIASQTRTASGLATFRGMTTVEDPNIDLYNFEGKIEVETDSGEQQAYSIGLDNVL 349

Query: 355 WANTVFASAGTAIACVVYTGADTRQAMNTSMS-SVKTGLLELEINSLSKILCACVFILSV 413
           +  ++  +  T +  VV+TG +T+  MN   +  +K+  L+ +IN     L     IL V
Sbjct: 350 FRGSIIRNTQTVVGMVVFTGEETKIRMNAIKNPRIKSPKLQTQIN-----LIVLFMILVV 404

Query: 414 ALVAFAGF------------NNNDWYV---------DIMRYLILFSTIIPVSLRVNLDLG 452
           A+ +F  F            ++  WY+          IM ++I+++T+IP+SL V +++ 
Sbjct: 405 AIFSFLSFGLQRFFKNREVDSDRAWYLMKVDAGLAPTIMSFIIMYNTLIPLSLYVTMEII 464

Query: 453 KSVYAHQIE------HDSTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHL 506
           K + +  +E      H  T      RT+TI E+LG++ Y+ SDKTGTLT N M  +K   
Sbjct: 465 KDMQSRLMEWDIDMYHLETNTGCTSRTATILEELGQVSYIFSDKTGTLTDNRMIFRKFSF 524

Query: 507 GTVSYTMD 514
              ++  D
Sbjct: 525 CGTAWEHD 532

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 66/134 (49%), Gaps = 17/134 (12%)

Query: 546 RVRDLVLTLALCHQVTPTFEDG-------ELTYQAASPDEIAIVKFTESVGLTLFRRDRH 598
           R +  +L LALCH   P    G        + YQ++SPDE+A+V     +G  +  R+  
Sbjct: 649 RAKFFILALALCHTCLPKKRQGADSGDFDSVEYQSSSPDELALVTAARDMGYVVLNRNGD 708

Query: 599 SITLLHDQSGTNFE-------YDILHVFPFNSDNKRMGIVIFDKQKDEYWFL-QKGADVV 650
            +T+     G  FE       Y++L+   F+SD KRM +++   Q  E   L  KGAD V
Sbjct: 709 ELTIKTYPDG--FEADCVLEKYEVLNTIDFSSDRKRMSVLVRMHQHPEKVLLICKGADNV 766

Query: 651 MSKIVQKNDWLEEE 664
           + + +  +D  +++
Sbjct: 767 ILERLHNSDLAQQK 780

>Scas_669.3
          Length = 1638

 Score =  199 bits (507), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 145/431 (33%), Positives = 221/431 (51%), Gaps = 24/431 (5%)

Query: 668  LAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLT 727
             + EGLRTLV   K +  +  Q +   Y DA + + NR+  ++ V  + +E DL++LG T
Sbjct: 1002 FSTEGLRTLVYSYKWVDLQEYQQWEDRYHDAKISLTNRKSKIAEV-GEEIEQDLQLLGAT 1060

Query: 728  GVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQYVHTVTKVNKP 787
             +EDKLQE V  +IE +R AGIKIWMLTGDK ETA  +  S KL+    Y   V      
Sbjct: 1061 AIEDKLQEGVSEAIEKIRRAGIKIWMLTGDKRETAINIGYSCKLIY--DYSTVVILAKGD 1118

Query: 788  EGALTHL-----ELLKINTNSC-LLIDGESLGLYL--EYYRQQFFEIVVNLPAVIACRCT 839
            E  ++ +     E+   N   C ++IDG +L ++         F E+     +VI CR +
Sbjct: 1119 ENIISKMNAISQEVDSGNVAHCVIIIDGSTLAMFEGNPTLMSVFIELCTKTDSVICCRAS 1178

Query: 840  PQQKADVATFIREVTGKRVC-CIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQ 898
            P QK+ + T IR      V   IGDG ND++MIQSAD+G+GI GKEG QAS  AD+SI Q
Sbjct: 1179 PSQKSLMVTNIRNSNKNLVTLAIGDGANDIAMIQSADIGIGIGGKEGLQASRTADYSIAQ 1238

Query: 899  FCHLSKLLLWHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGWLMVGY 958
            F  + KLLL HGR +Y R+AK       + +   + Q ++   + F   +LY+ W +  +
Sbjct: 1239 FRFILKLLLVHGRYNYIRTAKFILCTFFKEITFYLTQLIFQRYTMFSGSSLYEPWSLSMF 1298

Query: 959  ATCYTMAPVFSLTL-DHDIDESLTKTYPELYKELTAGKSLSYKTFFVWVVLSLFQGCVIQ 1017
             T +T  PV  + + + D+      T PELY      +  +   F  WV+ +     +I 
Sbjct: 1299 NTLFTSLPVLCIGMFEKDLKPMTLLTIPELYSMGRLSQGFNLIIFGEWVIQAAAYALLIT 1358

Query: 1018 GLS---QGFTSLDELDFKRLVALSFTVLILNELIMVAIEIYTWNK------TMVVSEVVT 1068
             L+    G T+L +     L  ++FT ++   L+ V  +    N       T V+     
Sbjct: 1359 FLNIIIWGETALSDHTMYPLGVINFTAIV--ALVNVKCQFIEMNNRNWVVFTSVILSCGG 1416

Query: 1069 FLIFVGSVPLL 1079
            +L++  ++P+L
Sbjct: 1417 WLVWCCALPIL 1427

 Score =  171 bits (432), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 131/462 (28%), Positives = 225/462 (48%), Gaps = 86/462 (18%)

Query: 156 YAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFV 215
           Y  N I++++Y   +F PK LY QF    N+YF +VA+ Q IP        + IVPL   
Sbjct: 140 YCNNNITSSRYTIYSFFPKQLYAQFSKVANVYFFVVAILQMIPGWSTTGTYTTIVPLCIF 199

Query: 216 LTVTMSKEALDDIQRRRRDRESNNELYEVLSK----------SQLVPSK----------- 254
           + ++M++EA DD +R R D+E NN+   +L+K          +QL PS+           
Sbjct: 200 MGISMAREAWDDFRRHRLDKEENNKTCSILTKEFSNKPMPDDAQL-PSRQNIDNLSNDSN 258

Query: 255 ----------------------------DLKVGDLIKIGKGARAPADLVLLQSSEPSGEI 286
                                       +L VGD + + +    PAD+++L S   + E 
Sbjct: 259 TDYLNTKFNNFPFLEERHGVRIQETTWSNLHVGDFVLLKQDNWVPADILVLTSDGDNNEC 318

Query: 287 FIKTDQLDGETDWKLRIACP-LTQHLSQDDLLYRIS--ITASVPEKSINNFLGKLTFGE- 342
           F++T  LDGET+ K++   P L +       L  I+  IT   P   + NF G L   + 
Sbjct: 319 FVETMALDGETNLKVKQPHPELNKLACSASGLANINALITVEDPNSDLYNFEGNLELTDN 378

Query: 343 ----IQSQPLSVDNTMWANTVFASAGTAIACVVYTGADTRQAMNTSMSSVKTGLLELEIN 398
               ++  P+  DN  +  ++  +    I  V+YTG +T+  MN ++++ +T   +L+ N
Sbjct: 379 NNNSLKKYPVGPDNVAYRGSIIRNTDNVIGMVIYTGKETKIRMN-ALNNPRTKAPKLQKN 437

Query: 399 SLSKILCACVFILSV-ALVAFAGF---------NNNDWYV---------DIMRYLILFST 439
            ++ I+   VF+++V +L ++ G           N  WY+          IM ++I+++T
Sbjct: 438 -INIIITFMVFVVAVISLFSYLGHVLQNKKAIDENQAWYLLTKDAGAAPTIMSFIIMYNT 496

Query: 440 IIPVSLRVNLDLGKSVYAHQIE------HDSTIPETIVRTSTIPEDLGRIEYLLSDKTGT 493
           IIP+SL V +++ K++ +  +E      H  T      RT+TI E+LG++ Y+ SDKTGT
Sbjct: 497 IIPLSLYVTMEIIKAMQSKMMEWDIDMYHSETNTPCESRTATILEELGQVSYMFSDKTGT 556

Query: 494 LTQNDMELKKLHLGTVSYTMDTMDIVTDYVRAMSDNLNSSAV 535
           LT N M  +K  +   S+ + + D+ ++ +   S N N+S +
Sbjct: 557 LTDNKMIFRKFSICGSSW-LHSTDLGSNALYKGSPNSNNSDI 597

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 69/139 (49%), Gaps = 16/139 (11%)

Query: 546 RVRDLVLTLALCHQVTPTF----EDGE--LTYQAASPDEIAIVKFTESVGLTLFRRDRHS 599
           + +  +L+LALCH   P      E GE  + YQ++SPDE+A+V     +G  +  ++   
Sbjct: 698 KAKFFILSLALCHTCLPKKSNFPEGGEDVIEYQSSSPDELALVTAARDLGYVVLNKNADV 757

Query: 600 ITLLHDQSGTNFE-----YDILHVFPFNSDNKRMGIVIFDKQKDE---YWFLQKGADVVM 651
           +T+     G   E     Y IL+   FNS  KRM +++  K  DE      + KGAD ++
Sbjct: 758 LTIKTYPDGFENEPIFEDYQILNYIDFNSQRKRMSVLV--KTPDEPNKVLLICKGADNMI 815

Query: 652 SKIVQKNDWLEEETGNLAR 670
            + +Q  D   ++  ++ R
Sbjct: 816 LERLQDRDLAYQKMEDINR 834

>Scas_505.4
          Length = 1025

 Score =  144 bits (362), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 102/352 (28%), Positives = 167/352 (47%), Gaps = 23/352 (6%)

Query: 779  HTVTKVNKPEGALTHLELLKINTNS-CLLIDGESLGLYLEYYRQQFFEIVVNL-PAVIAC 836
            HT   +     AL   +L +   N+  L+IDG+SL   LE   + +   +  +  AV+ C
Sbjct: 533  HTRKNMRDKIMALKEHKLSQHEMNTLALVIDGKSLSYALESDLEDYLLALGKICKAVVCC 592

Query: 837  RCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSI 896
            R +P QKA V   ++  T   +  IGDG NDVSMIQ+A VGVGI G EG QA+ +AD ++
Sbjct: 593  RVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADIAV 652

Query: 897  TQFCHLSKLLLWHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGWLMV 956
             QF  L KLLL HG  SY+R +    +  ++   + + Q  +  ++ F   ++ + W M 
Sbjct: 653  GQFRFLKKLLLVHGSWSYQRISVAILYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMS 712

Query: 957  GYATCYTMAPVFSL-TLDHDIDESLTKTYPELYKELTAGKSLSYKTFFVWVVLSLFQGCV 1015
             Y   +T+ P F +   D  +   L + YP+LYK    GK  S + F+ W+V   +   V
Sbjct: 713  YYNVFFTVFPPFVIGVFDQFVSSRLLERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAV 772

Query: 1016 I-----------QGLSQGFTSLDELDFKRLVALSFTVLILNELIMVAIEIYTWNKTMVVS 1064
            +             L+      D   +   V  S  +++L +  +V  +   W K  + +
Sbjct: 773  VYIGTMLFYRYGMALNMHGEVADHWSWGIAVYTSSILIVLGKAALVTNQ---WTKFTLFA 829

Query: 1065 EVVTFLIFVGSVPLLEEYFDLTYMSRPEY------YGKLAIILSLSIIPVWA 1110
               +F+ ++   P+    F    +SR  +      YG     L+L ++PV+A
Sbjct: 830  IPGSFIFWMIFFPIYASVFPYANISREYFGVVKHTYGSGTFWLTLIVLPVFA 881

 Score =  133 bits (334), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 86/289 (29%), Positives = 145/289 (50%), Gaps = 11/289 (3%)

Query: 136 DQQLDREIHPSTTPVYDRYKYAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQ 195
           D    REI+ +       + Y  N IS  KYN  TF+PK L+++F  + NL+FL  A  Q
Sbjct: 217 DDGTPREIYLNDRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLCTAAIQ 276

Query: 196 AIPALRIGYLSSYIVPLAFVLTVTMSKEALDDIQRRRRDRESNNELYEVLSKSQ--LVPS 253
            +P +      + +  L  VL V+  KE+++DI+R   D+E NN   E+ S+     +  
Sbjct: 277 QVPHVSPTNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEIYSEENGDFIER 336

Query: 254 K--DLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLTQHL 311
           +  D++ GD+I++      PADL+++ SSEP G  +I+T  LDGET+ K++ A P T  +
Sbjct: 337 RWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQARPETAEM 396

Query: 312 SQDDLL--YRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAIAC 369
                L  ++  + +  P  S+  + G L F   +  PLS +  +       +       
Sbjct: 397 MDSRKLNNFKGKVISEQPNSSLYTYEGTLEFNN-RKIPLSPEQMILRGATLRNTSWMFGL 455

Query: 370 VVYTGADTRQAMNTSMSSVKTGLLE----LEINSLSKILCACVFILSVA 414
           V++TG +T+   N + + +K   +E    L+I +L  +L   V I S+ 
Sbjct: 456 VIFTGHETKLMRNATATPIKRTAVERVINLQIVALFGVLIVLVLISSLG 504

>Kwal_26.9207
          Length = 1469

 Score =  108 bits (269), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 181/797 (22%), Positives = 334/797 (41%), Gaps = 168/797 (21%)

Query: 245  LSKSQLVPSKDLKVGDLIKIGKGARA--PADLVLLQSSEPSGEIFIKTDQLDGETDWKLR 302
            +S S+LVP      GD+ +I   + +  P D +LL     SG+  +    L GE+     
Sbjct: 570  VSSSELVP------GDVYEISDPSLSTFPCDSLLL-----SGDCIVNESMLTGES----- 613

Query: 303  IACPLTQHLSQDDLLYRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFAS 362
               P+++  + D+ +Y++       +  I+NFL K +F    ++ + V        +   
Sbjct: 614  --VPVSKIPASDETIYQL--LEDFQKTQISNFLAK-SFLFNGTKIIRV-------RIGGE 661

Query: 363  AGTAIACVVYTG-ADTRQAMNTSMSSVKTGLLELEINSLSKILCACVFILSVALVAFAGF 421
              TA+A VV TG + T+ ++  SM   K    +   +S         +I  + L+A AGF
Sbjct: 662  QSTALAMVVRTGFSTTKGSLLRSMIFPKPSGFKFYEDSFK-------YIGFMTLIALAGF 714

Query: 422  NNN---------DWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDS--TIPETI 470
            + +          + V I+R L + + ++P +L   L +G S    +++      I  T 
Sbjct: 715  SISCINFIRLGLAYKVMILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTR 774

Query: 471  VRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHL----GTVSYTMDTMDIVTDYVRAM 526
            V  S      G+I+ +  DKTGTLT++ +++  +H+    G  ++    +  +T+ VR +
Sbjct: 775  VNVS------GKIDVMCFDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGAL--ITN-VRGL 825

Query: 527  SD--NLNSSAVPSASKKDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDEIAIVKF 584
             +  +LN    P      +  + R+ +++L  CH +     DGEL      P +  + +F
Sbjct: 826  FNKYSLNDCGSP------IDFKSRNFLVSLLTCHSLRVV--DGELL---GDPLDFKMFQF 874

Query: 585  T--------ESVGLTLFRRDRHSITLLHDQSGT------------------NFEYDILHV 618
            T        +         +R++ + L + +G                   N  +++L V
Sbjct: 875  TNWSYAEDFQDFKFHSLNEERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLLGV 934

Query: 619  ---FPFNSDNKRMGIVIFDKQKDEYWFLQKGADVVMSKIVQKNDW---LEEETGNLAREG 672
               F F S+ +RM +++    ++ +W   KGA  V+S+I  K+      E+        G
Sbjct: 935  IRSFEFVSELRRMSVIVKPYGENVFWGFTKGAPEVISEICNKSTLPANYEQILQQYTHNG 994

Query: 673  LRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDK 732
             R +    K L K+  +   K         ++RE          +E ++E LG    E+K
Sbjct: 995  YRVIACAGKTLPKRTWRFAQK---------VSRE---------EVESNMEFLGFVVFENK 1036

Query: 733  LQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQ-YVHTVTKVNKPEGAL 791
            L+     ++  L++AGI+  M TGD V TA  V   + L++    +V  +     P   L
Sbjct: 1037 LKPSTTPTLASLQDAGIRSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDL 1096

Query: 792  ---------------THLELLKINTNSCLLIDGESLGLYL---EYYRQQFFEIVVNLPAV 833
                             LE +  +++  + + G+   L     E   + +  +V+ L + 
Sbjct: 1097 IIWRDVDDCDLILDGVTLEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVL-LKSS 1155

Query: 834  IACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAAD 893
            I  R +P +K ++   ++ +      C GDG ND   +++ADVGV +   E   AS+AA 
Sbjct: 1156 IYARMSPDEKHELVGQLQGLDYVVGFC-GDGANDCGALKAADVGVSLSEAE---ASVAAP 1211

Query: 894  FSITQF---CHLSKLLLWHGRNSYKRSAKLAQFV--------------IHRGLLISVCQA 936
            F+ + F   C L   ++  GR S   S    Q++                RG+ +   Q 
Sbjct: 1212 FTSSVFEISCILD--VIKEGRASLTTSFSCFQYMSLYSAIQFVTVTMLYSRGINLGDFQF 1269

Query: 937  VYSISSKFEPIALYQGW 953
            +Y       PIA++  W
Sbjct: 1270 LYIDLFLIVPIAIFMSW 1286

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score =  103 bits (257), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 160/725 (22%), Positives = 306/725 (42%), Gaps = 113/725 (15%)

Query: 251  VPSKDLKVGDLIKIGKGARA--PADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLT 308
            V S DL  GDL +I   +    P D VL+     SG+  +    L GE+        P++
Sbjct: 551  VNSSDLVPGDLFEISDPSLVVLPCDAVLI-----SGDCIVNESMLTGES-------VPVS 598

Query: 309  QHLSQDDLLYRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAIA 368
            ++ + +  + ++          +++F+ K +F    ++ + V N           G A+A
Sbjct: 599  KYAATEATMAQL--LQDFKSSQVSSFVSK-SFLFNGTKIIRVRNQ-------PGQGMALA 648

Query: 369  CVVYTG-ADTRQAMNTSM---SSVKTGLLELEINSLSKILCACVFILSVALVAFAGFNNN 424
             V+ TG + T+ ++  SM     V     E     +  +    +F  S++ + F      
Sbjct: 649  LVIRTGFSTTKGSLVRSMVFPKPVGFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRLGL- 707

Query: 425  DWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPEDLGRIE 484
            ++ V I+R L + + ++P +L   L +G S    +++       +  R +      G+++
Sbjct: 708  EYKVMILRALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNV----GGKVD 763

Query: 485  YLLSDKTGTLTQNDMELKKLHLGT---VSYTMDTMDIVTDYVRAMSDNLNSSAVPSASKK 541
             +  DKTGTLT+  +++  +H       S  +   D++TD    +  +  S    +   K
Sbjct: 764  MMCFDKTGTLTEEGLDVLGIHFAKPEGSSTILQLSDLITDCDEVLQKHTLSDCNSAEEFK 823

Query: 542  DLPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDEIAIVKFTESV---GLTLFR---- 594
                  ++ +++L  CH +     DGEL      P ++ + +FT+     G   ++    
Sbjct: 824  -----AKNFLVSLLTCHSLKHI--DGELL---GDPLDLKMFEFTKWAYEEGYESWKFKNA 873

Query: 595  RDRHSIT--LLHDQSGTNF-EYD------ILHVFPFNSDNKRMGIVIFDKQKDEYWFLQK 645
             D+  I+  ++H  S  NF E D      ++  F F S+ +RM +++   +++ YW   K
Sbjct: 874  EDKTGISPAVVHPTSNCNFIENDPDNLIGVIRSFEFLSELRRMSVIVKGFKENTYWSFTK 933

Query: 646  GADVVMSKIVQKNDW---LEEETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMM 702
            GA  V++ I           E   +    G R +    K L K             S  +
Sbjct: 934  GAPEVIADICNPATIPKDFHELLHHYTHNGFRIIACAGKTLPK-------------SSWL 980

Query: 703  LNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETA 762
             +++V+   V     E +LE LG    E+KL+   K++++ L+NA I+  M TGD V TA
Sbjct: 981  YSQKVSREEV-----EDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGDNVLTA 1035

Query: 763  RCVSISAKLVS--------------RGQYVHTVTKVNKPEGALTHLELLKIN---TNSCL 805
              V   + L+S                +++ +   V++    L  + L  +N    +  L
Sbjct: 1036 VSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPEKSYTL 1095

Query: 806  LIDGESLGLYL---EYYRQQFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKRVCCIG 862
             I G+   +     E     +   V+ +   I  R +P +K ++   ++++      C G
Sbjct: 1096 AITGDIFRILFRNDEILPDDYISTVL-MKGSIYARMSPDEKHELVEQLQKLDYNVGFC-G 1153

Query: 863  DGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQF---CHLSKLLLWHGRNSYKRSAK 919
            DG ND   +++A++G+ +   E   AS+AA F+   F   C L   ++  GR S   S  
Sbjct: 1154 DGANDCGALKAANIGISLSEAE---ASVAAPFTSAVFDISCVLD--VIKEGRASLVTSFS 1208

Query: 920  LAQFV 924
              Q++
Sbjct: 1209 CFQYM 1213

>Scas_665.30
          Length = 1439

 Score =  103 bits (256), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 180/787 (22%), Positives = 313/787 (39%), Gaps = 151/787 (19%)

Query: 251  VPSKDLKVGDLIKIGKGARA--PADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLT 308
            V S DL  GD+ +I   +    P D +LL     SG+  +    L GE       + P++
Sbjct: 340  VNSADLVPGDIYEISDPSLTVFPCDSLLL-----SGDCIVNESMLTGE-------SVPVS 387

Query: 309  QHLSQDDLLYRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAIA 368
            +  ++ + +  + +        I+++L K +F       L    T+    +      A+A
Sbjct: 388  KFPAEPETM--LQLLDDFQNTQISSYLSK-SF-------LFNGTTIIRARIPYGQSAALA 437

Query: 369  CVVYTG-ADTRQAMNTSMSSVKTGLLELEINSLSKILCACVFILSVALVAFAGFNNN--- 424
             VV TG + T+ ++  SM   K    +   +S         +I  +AL+A  GF+ +   
Sbjct: 438  MVVRTGFSTTKGSLVRSMVFPKPTGFKFYEDSFK-------YIGVMALIALFGFSISCIQ 490

Query: 425  ------DWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPE 478
                  D    I+R L + + ++P +L   L +G      +++       +  R +    
Sbjct: 491  FIKIGLDKRTMILRALDIITIVVPPALPATLTIGTGFALSRLKKKGIFCISPTRVNI--- 547

Query: 479  DLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSY--TMDTMDIVTDYVRAMSD-NLNSSAV 535
              G+I+ L  DKTGTLT+N +++  + L   S   +    D+V D  +     +LN  + 
Sbjct: 548  -GGKIDILCFDKTGTLTENGLDVLGVQLCVPSSHNSFQFADLVQDVHKLFPKFSLNDCSS 606

Query: 536  PSASKKDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDEIAIVKFT---------E 586
            P    +D   R ++  ++L  CH +     D EL      P +  + +FT         E
Sbjct: 607  P----RDY--RAKNFFISLLTCHSLRVV--DNELI---GDPLDFKMFQFTKWSYEEDFQE 655

Query: 587  SVGLTLFRRDRHSITL----------LH----DQSGTNFEYD------ILHVFPFNSDNK 626
                + +   RH   L          +H    D   T  + D      I+  F F S+ +
Sbjct: 656  KEFHSTYEERRHDNALPENIDIIPAVVHPNSADPENTFIDNDPHNFLGIIRSFEFLSELR 715

Query: 627  RMGIVIFDKQKDEYWFLQKGADVVMSKIVQKNDW---LEEETGNLAREGLRTLVIGRKRL 683
            RM +++    +D YW   KGA  V+++I  K       EE       +G R +    + L
Sbjct: 716  RMSVIVKPSNEDVYWAFTKGAPEVITQICNKATLPANFEEMLNYYTHKGYRVIACAGRVL 775

Query: 684  SKKLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIEL 743
             +                  N  +    V  + +E ++E LG    E+KL+++   +++ 
Sbjct: 776  PR------------------NTWLYSQKVSREEVESNMEFLGFIIFENKLKKETAKTLQT 817

Query: 744  LRNAGIKIWMLTGDKVETA-----RCVSISAKLV---------SRGQYVHTVTKVNKPEG 789
            L+ A I+  M TGD V TA     +C  I +K V         S GQ       V+  + 
Sbjct: 818  LQEASIRTVMCTGDNVLTAISVGRQCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDD 877

Query: 790  ALTHLELLKINTNS----CLLIDGESLGLYLEYYRQQFFEIVVN---LPAVIACRCTPQQ 842
             L    LL IN +S     L I G+   +          E  +N   L   I  R +P +
Sbjct: 878  TLDSRTLLPINNSSSTSYTLAITGDIFRIIFGDENNSISEDYINTVLLKGTIYARMSPDE 937

Query: 843  KADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCHL 902
            K ++   ++ +      C GDG ND   +++ADVG+ +   E   AS+AA F+ +Q   +
Sbjct: 938  KHELMEQLQRLNYTVGFC-GDGANDCGALKAADVGISLSEAE---ASVAAPFT-SQVFDI 992

Query: 903  SKLL--LWHGRNSYKRSAKLAQFV-IHRGLLISVCQAVYSISSKFE-------------P 946
            S +L  +  GR     S    Q++ ++  +       +YS  S                P
Sbjct: 993  SCVLDVIKEGRACLVTSFSCFQYMSLYSAIQFITITVLYSRGSNLGDFQFLYIDLLLIVP 1052

Query: 947  IALYQGW 953
            IA++  W
Sbjct: 1053 IAIFMSW 1059

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score =  102 bits (254), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 162/708 (22%), Positives = 296/708 (41%), Gaps = 121/708 (17%)

Query: 251  VPSKDLKVGDLIKIGKGARA--PADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLT 308
            VPS DL  GD+ ++   + +  P D +L+     SG+  +    L GE+    ++A    
Sbjct: 552  VPSSDLVPGDIYELTDPSLSLLPCDSILI-----SGDCLVNESMLTGESVPVSKVAATRE 606

Query: 309  QHLSQ-DDLLYRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAI 367
              L   DD +          +  +++F+ K +F         + N      V A+AG +I
Sbjct: 607  TMLQLLDDFM----------DTQLSSFVSK-SF---------LFNGTKLIRVRATAGQSI 646

Query: 368  AC--VVYTG-ADTRQAMNTSMSSVK-TGL--LELEINSLSKILCACVFILSVALVAFAGF 421
            A   V  TG + T+ ++  SM   K TG    E     +  I    +F  +V+ + F   
Sbjct: 647  ALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYEDSFKYIGYISIIALFGFAVSFIQFLRL 706

Query: 422  NNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPEDLG 481
               D    I+R L + + ++P +L  +L +G     ++++       +  R +      G
Sbjct: 707  GL-DKRTMILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNV----GG 761

Query: 482  RIEYLLSDKTGTLTQNDMELKKLHL-GTVSYTMDTMDIVTDYVRAMSDNLNSSAVPSASK 540
            +I+ +  DKTGTLT++ +++  +H+   +   M    +VTD V+ +  +L+ S     S 
Sbjct: 762  KIDVMCFDKTGTLTEDGLDVLGVHVVQPLQQEMKISKLVTD-VKDLLQSLSLSDC--VST 818

Query: 541  KDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDEIAIVKFTE-------------- 586
            +D+  + ++ +++L  CH +     DGEL      P +  +V+FT+              
Sbjct: 819  RDM--KAKNFLVSLLTCHSLRMV--DGELL---GDPFDFKMVQFTKWSDEEETGNRKVHS 871

Query: 587  -----SVGLTLFRRDRHSITLLHDQSGTNF-------EYDILHVFPFNSDNKRMGIVIFD 634
                   G T+    R +  ++H      F          I+  F F S+ +RM +++  
Sbjct: 872  LYEERHDGSTMPENSRFAPAIVHPSGKGRFIEREPSNVIGIVRSFEFLSNLRRMSVIVKP 931

Query: 635  KQKDEYWFLQKGADVVMSKIVQKNDW---LEEETGNLAREGLRTLVIGRKRLSKKLLQTF 691
              ++ +    KGA  V+ ++  K       E    +    G R +    K+L+++     
Sbjct: 932  FSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHHYTHNGYRVIACAGKKLTRQ----- 986

Query: 692  TKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKI 751
                           +    V  + +E +LE LG    E+KL+   K ++E L  A I+ 
Sbjct: 987  -------------SWLYSQKVSREEIESNLEFLGFIIFENKLKGTTKETLESLHRADIRT 1033

Query: 752  WMLTGDKVETARCVSISAKLVSRGQ-YVHTVTKVN-KPEG----------------ALTH 793
             M TGD V TA  V   A LV   + +V  +  ++   EG                ++T 
Sbjct: 1034 IMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANSSDTLDSVTL 1093

Query: 794  LELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVVN--LPAVIACRCTPQQKADVATFIR 851
              L     +  L + GE   L  +  + Q  E++ N  L   I  R +P +K ++   ++
Sbjct: 1094 RPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEKHELVERLQ 1153

Query: 852  EVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQF 899
             + G +V   GDG ND   +++AD+G+ +   E   AS+AA F+   F
Sbjct: 1154 SI-GYQVGFCGDGANDCGALKAADIGISLSEAE---ASVAAPFTSRLF 1197

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 163/726 (22%), Positives = 298/726 (41%), Gaps = 136/726 (18%)

Query: 239  NELYEVLSKSQLVPSKDLKVGDL-IKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGET 297
            ++ +  +S S+LVP    +V D  I I      P D +LL     S +  +    L GE 
Sbjct: 558  DKFWTTISSSELVPGDIYEVSDPNITI-----LPCDSILL-----SSDCIVNESMLTGE- 606

Query: 298  DWKLRIACPLTQHLSQDDLLYRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWAN 357
                  + P+++  + ++ +Y++          I++F+ K       S   +  N + A 
Sbjct: 607  ------SVPVSKFPATEETMYQL--CDDFQSTQISSFVSK-------SFLYNGTNIIRAR 651

Query: 358  TVFASAGTAIACVVYTG-ADTRQAMNTSMSSVKTGLLELEINSLSKI---LCACVFILSV 413
             +      A+A VV TG + T+ ++  SM   K    +   +S   I       +F   V
Sbjct: 652  -IAPGQTAALAMVVRTGFSTTKGSLVRSMVFPKPTGFKFYRDSFKYIGFMSLIAIFGFCV 710

Query: 414  ALVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRT 473
            + V F      D    I+R L + + ++P +L   L +G +    +++       +  R 
Sbjct: 711  SCVQFIKLGL-DKKTMILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRL 769

Query: 474  STIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDTM--DIVTDYVRAMSD-NL 530
            +      G+I+ +  DKTGTLT++ +++  + +   +        ++++D  +     +L
Sbjct: 770  NIS----GKIDVMCFDKTGTLTEDGLDVLGVQISEPNGVRGQKFGELLSDIRQVFPKFSL 825

Query: 531  NSSAVPSASKKDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDEIAIVKFTE-SVG 589
            N  + P      L  + R+  ++L  CH +     DG L      P +  + +FT  S  
Sbjct: 826  NDCSSP------LDFKSRNFFMSLLTCHSLRSV--DGNLL---GDPLDFKMFQFTGWSFE 874

Query: 590  LTLFRRDRHSI------------------TLLHDQSGT-------NFEYDILHV---FPF 621
                +R  HS+                   ++H  S         N  ++ L V   F F
Sbjct: 875  EDFQKRAFHSLYEGRHEDDVFPENSEIIPAVVHPDSNNRENTFTDNDPHNFLGVVRSFEF 934

Query: 622  NSDNKRMGIVIFDKQKDEYWFLQKGADVVMSKIVQKNDW---LEEETGNLAREGLRTLVI 678
             S+ +RM +++     D YW   KGA  V+S+I  K+      EE        G R +  
Sbjct: 935  LSELRRMSVIVKTNNDDVYWSFTKGAPEVISEICNKSTLPADFEEVLRCYTHNGYRVIAC 994

Query: 679  GRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVK 738
              K L K+               + +++V+   V     E +LE LG    ++KL+++  
Sbjct: 995  AGKTLPKR-------------TWLYSQKVSREEV-----ESNLEFLGFIIFQNKLKKETS 1036

Query: 739  SSIELLRNAGIKIWMLTGDKVETARCVSISAKLVS--------------RGQYVHTVTKV 784
             +++ L++A I+  M TGD + TA  V   A L+                G+ V     V
Sbjct: 1037 ETLKSLQDANIRTIMCTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVWRDV 1096

Query: 785  NKPEGAL--THLELLKINTNSC---------LLIDGESLGLYL----EYYRQQFFEIVVN 829
            N+P+  L    L+ +K+  NS          L + G+   L      E   +   EI++N
Sbjct: 1097 NEPDKILDTKTLKPVKLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEILLN 1156

Query: 830  LPAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQAS 889
              + I  R +P +K ++   ++++      C GDG ND   +++ADVG+ +   E   AS
Sbjct: 1157 --SSIYARMSPDEKHELMIQLQKLDYTVGFC-GDGANDCGALKAADVGISLSEAE---AS 1210

Query: 890  LAADFS 895
            +AA F+
Sbjct: 1211 VAAPFT 1216

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
           Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 1280

 Score = 90.1 bits (222), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 176/768 (22%), Positives = 297/768 (38%), Gaps = 140/768 (18%)

Query: 249 QLVPSKDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIAC-PL 307
            L+   DL VGD+I +  G   PAD VL+     SG        L GE+D   ++A  P 
Sbjct: 250 HLISIHDLLVGDVISLQTGDVVPADAVLI-----SGSCECDESALTGESDTIKKVALKPA 304

Query: 308 TQHLSQDDLLYRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTA- 366
            +   Q            + EK     +G    GE    PL +  +     + +  G A 
Sbjct: 305 LEKYKQ------------IFEKDPTIDIGSHGVGEKVPDPLLISGS----KLLSGIGNAV 348

Query: 367 IACVVYTGADTRQAMNTSMSSVKTGLLELEINSLSKI-LCACVFILSVALVAFAGF---- 421
           I  V     + R  M     S  T L E   N    I +  C+  L + ++ F  F    
Sbjct: 349 ITSVGENSVNGRIMMALKTESESTPLQERLSNLADNISIYGCMAALVLFIILFIRFLTYL 408

Query: 422 NNNDWYVDI------MRYLILFSTII-------PVSLRVNLDLGKSVYAHQIEHDSTIPE 468
            N   Y D+       +++ +F T +       P  L + + L  +    ++  D  +  
Sbjct: 409 PNGKKYHDLPPAQKGSKFMNIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNL-- 466

Query: 469 TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDT------------- 515
             VR     E +G    + SDKTGTLT+N M + K   G + +   T             
Sbjct: 467 --VRVLRACETMGSATAICSDKTGTLTENRMTVVKGFAGNLGFDDTTHAENKEIKSAVVL 524

Query: 516 -----MDIVTDYVRAMSDNLNSSAVPSASK----KDLP----GRVRDLVLTLALCHQVTP 562
                  ++TD +  +S  LNS+A  +       KD+      + R  +   +  ++ + 
Sbjct: 525 RSNCDASLLTDILSNIS--LNSTAFENKESQHKDKDVDENPYHKSRKSLFPWSRNNRTSQ 582

Query: 563 TFEDG--ELTYQ-AASPDEIAIVKFTESVGLTLFRRDRHSITLLHDQSGTNFEYDILHVF 619
              D   E   Q   S  E A++ F +    +L  +D H +       G +    ++ V 
Sbjct: 583 LIADAMKENDEQFLGSKTETALLAFAQK---SLGMKDVHKLRTKPSDLGID---KVVQVI 636

Query: 620 PFNSDNKRMGIVIFDKQKDEYWFLQKGADVVMSK-----------IVQKNDWLEEET--- 665
           PF S  K   I +       Y F  KGA  ++ K           IV  N  L +E+   
Sbjct: 637 PFESSRKWGAIAVQLADNKGYRFYAKGAAEILLKVCSNQRNSDNSIVPMNQDLYDESFKK 696

Query: 666 -GNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASL----MMLNREVTMSNVISKHLEHD 720
             ++A   LRT+ +  +   +   + F  D  D S+    +++  E+   N+ S+ +  D
Sbjct: 697 IQDMASHALRTISLVHRDFKEWPPKEFA-DSTDPSIASPDLVMGHELDHKNLSSEGMTLD 755

Query: 721 LEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQYVHT 780
                + G++D L+E VK S+E  + AG+ + M+TGD + TAR +S +  ++S   Y   
Sbjct: 756 ----AMVGLQDPLREGVKESVEQCQRAGVTVRMVTGDNILTARAISRNCNILSEEGY--- 808

Query: 781 VTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVVNLPAV-IACRCT 839
               N PE A+      K+     L +                      +P + +  R +
Sbjct: 809 ----NDPECAMEGPTFRKLPYKKMLRV----------------------IPKLRVLARSS 842

Query: 840 PQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVG--VGIVGKEGKQASLAADFSIT 897
           P+ K  +   ++++ G+ V   GDG ND   ++ ADVG  +GI G E  + +        
Sbjct: 843 PEDKRILVETLKKM-GEVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTD 901

Query: 898 QFCHLSKLLLWHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSISSKFE 945
            F  +   + W GR       K  QF +   +   +   V +++S  E
Sbjct: 902 DFTAIVNAIKW-GRCVSVSIKKFIQFQLTVNITAVILTFVSAVASAEE 948

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 90.1 bits (222), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 154/720 (21%), Positives = 286/720 (39%), Gaps = 136/720 (18%)

Query: 241  LYEVLSKSQLVPSKDLKVGDLIKIGKGARA--PADLVLLQSSEPSGEIFIKTDQLDGETD 298
             +  +  S+LVP      GD+ +I        P D +LL     SG+  +    L GE  
Sbjct: 548  FWSSIHSSELVP------GDIYEISDPNLNLLPCDSILL-----SGDCIVNESMLTGE-- 594

Query: 299  WKLRIACPLTQHLSQDDLLYRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANT 358
                 + P++++ + ++ +  + +        I+ FL K +F       L    T+    
Sbjct: 595  -----SVPVSKYPASEETI--LQLFDDFQSTQISTFLSK-SF-------LFNGTTLIRAK 639

Query: 359  VFASAGTAIACVVYTG-ADTRQAMNTSMSSVKTGLLELEINSLSKILCACVFILSVALVA 417
            +      A+A  V TG + T+ ++  SM   K    +   +S         +I  +A++A
Sbjct: 640  IPNGGSVALAMAVRTGFSTTKGSLIRSMVFPKPSGFKFYSDSFK-------YIGFMAIIA 692

Query: 418  FAGFNNN---------DWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTIPE 468
            F GF+ +         D    I+R L + + ++P +L   L +G S   ++++       
Sbjct: 693  FFGFSISCINFIKLGLDKRTMILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCI 752

Query: 469  TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDTMDIVTDYVRAMSD 528
               R +      G+I+ +  DKTGTLT++ +++  + +   + T +     +D +    D
Sbjct: 753  APTRVNI----GGKIDVMCFDKTGTLTEDGLDVLGVRVSCAA-TRNKASF-SDLISDTHD 806

Query: 529  NLNSSAVPSASKKDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDEIAIVKFTESV 588
                 ++   S  D   R R+ +++L  CH +     DGEL      P +  + +FT   
Sbjct: 807  IFPKFSLKDCSNPDDYKR-RNFLISLLTCHSLRVV--DGEL---LGDPLDFKMFQFTGWS 860

Query: 589  GLTLFRRDRHSITLLHDQSGTNFEYD-----------------------------ILHVF 619
                F+  +          G NF  +                             I+  F
Sbjct: 861  YEEDFQNHQFHSLYEERHEGQNFPENNDIIPAIVHPNDSDERNKFVQNDPNNILGIIRSF 920

Query: 620  PFNSDNKRMGIVIFDKQKDEYWFLQKGADVVMSKIVQ----KNDWLEEETGNLAREGLRT 675
             F S+ +RM +++    ++ YW   KGA  V+  I       +D+ ++        G R 
Sbjct: 921  EFLSELRRMSVIVKPNNENVYWAYTKGAPEVIIDICNPATLPSDY-DDILNFYTHSGYRV 979

Query: 676  LVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQE 735
            +    K L K                  N  +    V  + +E ++E LG    ++KL++
Sbjct: 980  IACAGKTLPK------------------NTWLYSQKVRREEVESNMEFLGFIIFQNKLKD 1021

Query: 736  DVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQ-YVHTV------------- 781
                ++  L+ A I+  M TGD V TA  V    +L++  + YV TV             
Sbjct: 1022 ATSPTLSKLKTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHW 1081

Query: 782  TKVNKPEGALTHLELLKINTNS---CLLIDGESLGLYL---EYYRQQFFEIVVNLPAVIA 835
             +++  E  L    L  I+  S    L I GE   +     + Y +++   ++ L   I 
Sbjct: 1082 NEISNAEHILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEIL-LKGSIF 1140

Query: 836  CRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQASLAADFS 895
             R +P +K ++   ++++      C GDG ND   +++ADVG+ +   E   AS+AA F+
Sbjct: 1141 ARMSPDEKHELVEQLQKMDYTVGFC-GDGANDCGALKAADVGISLSEAE---ASVAAPFT 1196

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
           cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 177/778 (22%), Positives = 311/778 (39%), Gaps = 151/778 (19%)

Query: 229 QRRRRDRESNNELYEVLSKSQLVPSKDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFI 288
           Q+  R RE    +    +   L+   +L VGDL+K+  G   PAD VL++     GE   
Sbjct: 148 QQLNRKREDRQVVVVRDAAESLISIHNLLVGDLLKLQTGDVVPADCVLVR-----GECET 202

Query: 289 KTDQLDGETDW--KLRIACPLTQHLSQDDLLYRISITASVPEKSINNFLGKLTFGEIQSQ 346
               L GE++   KL +A  L  H +                       G    G+  + 
Sbjct: 203 DESALTGESNTIKKLPLADALEYHSAH----------------------GGRDIGDTSAS 240

Query: 347 PLS--VDNTMWANTVFASAG---TAIACVVYTGADTRQAMNTSMSSVKTG----LLELEI 397
             S   D++   + +  S     + +A  + T          +M+S+K       L++ +
Sbjct: 241 GASGAADDSRCPDCMLISGSRVLSGLASAIVTNVGVNSVHGKTMASLKEDSEDTPLQMRL 300

Query: 398 NSLSKILC--ACVFILSVALVAFAGF-----NNNDWYVDI---------MRYLILFSTII 441
           + L+  +    CV  +++ +V FA +      +   Y D+         M   I   T+I
Sbjct: 301 SQLTDNISVYGCVAAITLFVVLFARYLSYILPSGGKYHDLPPAEKGSKFMDIFITAITVI 360

Query: 442 PVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMEL 501
            V++   L L  ++         T    +VR     E +G    + SDKTGTLT+N M +
Sbjct: 361 VVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKTGTLTENIMTV 420

Query: 502 KKLHLGTVSYTMDTMDI----------VTDYVR-AMSDN--LNSSAVPSASKKD------ 542
            +  LG   +     D            +D +R  + DN  LNS+A  +   KD      
Sbjct: 421 VRGTLGRAGFDDIGADPSKSNLVFKKKCSDLLRTVIYDNIVLNSTAFENKDYKDPNNYNS 480

Query: 543 ----LPGR-VRDLVLTLALCHQVTPTFEDGELTYQAASPDEIAIVKFTESVGLTLFRRDR 597
                P R +R +  TL    +  P  E+  L + A    E  I   TE+  L+L R+  
Sbjct: 481 IDDSQPRRLIRRITQTL---QKKKPDDEENLLAHAAEGRQEPYIGSKTETALLSLARK-- 535

Query: 598 HSITLL---------HDQSGTNFEYDILHVFPFNSDNKRMGIVIF------DKQKDEYWF 642
            S  L          H +     E  I+ + PF S  K   IV+       ++ K    +
Sbjct: 536 -SFGLKFGALQSFRGHPEKLPTVET-IVQIIPFESSRKWSAIVVKLNSNKENEGKKFRLY 593

Query: 643 LQKGADVV-------------MSKIVQKN-DWLEEETGNLAREGLRTLVIGRKRLSKKLL 688
           ++  A++V             +S+I QK+ D +EE+  +LA++ LR + +    +   + 
Sbjct: 594 VKGAAEIVAKACTLKNVCNEGISEIDQKSKDDIEEQIFSLAKDALRAISLAH--MDFDVN 651

Query: 689 QTFTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAG 748
           +   K+  D         V + +    HLE  L +  + G++D L+E+VK+S+   + AG
Sbjct: 652 EWPPKELADPENSHEALAVKLIDPKKPHLEG-LTLDAIVGIQDPLRENVKNSVAQCQKAG 710

Query: 749 IKIWMLTGDKVETARCVSISAKLVSRGQYVHTVTKVNKPEGALTHLELLKINTNSCLLID 808
           + + M+TGD + TA+ ++ +  ++S                         +N ++C + +
Sbjct: 711 VTVRMVTGDNLLTAKAIARNCGILSSKS----------------------LNDSACAM-E 747

Query: 809 GESLGLYLEYYRQQFFEIVVNLPAV-IACRCTPQQKADVATFIREVTGKRVCCIGDGGND 867
           G +     +  R++       LP + +  R +P+ K  +   ++E+ G+ V   GDG ND
Sbjct: 748 GPAFRKLSDSERKRI------LPKLRVLARSSPEDKKILVRALKEM-GEVVAVTGDGTND 800

Query: 868 VSMIQSADVG--VGIVGKEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRSAKLAQF 923
              ++ ADVG  +GI G E  + +         F  +   + W GR       K  QF
Sbjct: 801 APALKLADVGFSMGITGTEVAREASDIILMTDDFSAIVNAIKW-GRCVAASIKKFIQF 857

>Kwal_23.3160
          Length = 1100

 Score = 87.0 bits (214), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 189/771 (24%), Positives = 304/771 (39%), Gaps = 161/771 (20%)

Query: 249 QLVPSKDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQ--LDGETDWKLRIA-- 304
           + +PSK L  GDL  +  G   PADL L++       +  +TD+  L GE+   L IA  
Sbjct: 145 ETIPSKQLVPGDLCVVKAGDTVPADLRLIEC------VNFETDEALLTGES---LPIAKE 195

Query: 305 ----CPLTQHLSQDDLL---------YRISITASVPEKSINNFLGKLTFGEIQSQPLSVD 351
                P T+     D L          +   T  V +  +N  +GK+      +Q L  D
Sbjct: 196 ASQVYPATEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKI------AQSLKGD 249

Query: 352 NTMWAN----TVFASAGTAIACVVYTGADTRQAMNTSMSSVKTGL-LELEINSLSKILCA 406
           N++ +     T +A+AG  +A  +            S     TG  L  +++ L+ +L  
Sbjct: 250 NSLISKDENKTFWANAGITLAATI-----------GSFLGTTTGTPLHRKLSKLAVLLFF 298

Query: 407 CVFILSVALVAFAGFNNNDWYVDIMRYLILFS-TIIPVSLRVNLDLGKSVYAHQIEHDST 465
              + ++ ++A   F  N    ++  Y I  + ++IP SL V L +  SV A  +     
Sbjct: 299 IAVVFAIVVMATQKFVVNK---EVAIYAICVAVSMIPSSLVVVLTITMSVGAKIM----A 351

Query: 466 IPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKL---HLGTVSYT-----MDTMD 517
               +VR     E LG +  + SDKTGTLTQ  M +K+      GT++ +      D  D
Sbjct: 352 TRNVVVRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQAWVPSFGTITVSNSSNPFDPTD 411

Query: 518 IVTDYVRAMS------DNLNSSAVPSASKK-----DLPGRVRDLV----LTLALCHQVTP 562
              + +   S      D+     + ++ K       LP  +   +    L  A    +  
Sbjct: 412 GGIELIPRFSPHQYKHDSTEDVGIITSFKNKFYNDKLPAGLNSKLFLNWLKTAALANIAH 471

Query: 563 TFEDGELTYQAA--SPDEIAIVKFTESVGL---TLFRRDR------HSITLLHDQSGTNF 611
            ++D E     A   P EIAI  F   + +    L   D+          L    S    
Sbjct: 472 VYQDPETEEWKAHGDPTEIAIQVFAHKLDMPRNALTAEDKSDSESDEDAALGEKTSSVEP 531

Query: 612 EYDILHVFPFNSDNKRMGIV-----------IFDKQKDEY-------WFLQKGADVVMSK 653
            Y  +  FPF+S  KRM  V           +F K   E        W L  G +   +K
Sbjct: 532 HYKHIAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGAFERVLDCCTKW-LPDGCNESDAK 590

Query: 654 IVQKNDWLE--EETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSN 711
            + + D  E  +    L+ EGLR L    K  ++      ++D      +  NR+     
Sbjct: 591 PMTEEDKEEVFKNVETLSSEGLRVLAFATKSFTESQALKVSED------LRKNRD----- 639

Query: 712 VISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKL 771
                +E DL   GL G+ D  +++   +++    AGI + MLTGD   TA+ ++    +
Sbjct: 640 ----FVESDLIFQGLVGIYDPPRQETAGAVKQFHKAGINVHMLTGDFPGTAKAIAQEVGI 695

Query: 772 VSRGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVVNLP 831
           + R  Y +       P+  +  + +     +   L D E   L L             LP
Sbjct: 696 LPRNLYHY-------PKEVVDSMVMTAAQFDQ--LTDEEIDNLLL-------------LP 733

Query: 832 AVIACRCTPQQKADV--ATFIREVTGKRVCCI-GDGGNDVSMIQSADVGVGIVGKEGKQA 888
            VIA RC PQ K  +  A   RE    + C + GDG ND   ++ A+VG+ +       A
Sbjct: 734 LVIA-RCAPQTKVRMIDALHRRE----KFCAMTGDGVNDSPSLKKANVGIAMGINGSDVA 788

Query: 889 SLAADFSITQFCHLSKL-LLWHGRNSYKRSAKLAQFVIHRGLLISVCQAVY 938
             A+D  ++     S L  +  GR   + S  + +FV+   L  +V QA+Y
Sbjct: 789 KDASDIVLSDDNFASILNAVEEGR---RMSDNIQKFVLQL-LAENVAQALY 835

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 951

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 182/792 (22%), Positives = 304/792 (38%), Gaps = 199/792 (25%)

Query: 153 RYKYAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYI-VP 211
           R  Y PN IS    +  + + K L      F     +L+ +  AI ++ +G +   I + 
Sbjct: 76  RQYYGPNEIS--VDDDESLVKKFLSN----FVEDRLILLLMGSAIISVFLGNIDDAISIT 129

Query: 212 LAFVLTVTM----------SKEALDDIQRR-----RRDRESNNELYEVLSKSQLVPSKDL 256
           +A V+ VT+          S EAL+ +  +     R  RESN     VL+ + LVP    
Sbjct: 130 MAIVIVVTVGFVQEYRSEKSLEALNKLVPQECHLIRGGRESN-----VLA-TNLVP---- 179

Query: 257 KVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLTQH---LSQ 313
             GDL++   G R PAD+ +++ ++    + I    L GETD       P+ +    LS+
Sbjct: 180 --GDLVRFRIGDRIPADIRIIECND----LTIDESNLTGETD-------PVHKSYKALSR 226

Query: 314 DDLLYRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAIACVVYT 373
           D    + +    V E++   ++G L                         G     VV T
Sbjct: 227 DSYNDQPNSIVPVAERTNIAYMGTL----------------------VKEGNGRGIVVGT 264

Query: 374 GADTRQA----MNTSMSSVKTGLLELEINSLSKILCACVFILSVALVAFAGFNNNDWY-- 427
           G +T       M +S+   KT L +L ++ L K L    F++   +          W   
Sbjct: 265 GRETSFGNVFEMMSSIEKPKTPL-QLTMDKLGKDLSLASFVVIGIICVVGIIQGRSWLEM 323

Query: 428 --VDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPEDLGRIEY 485
             + +   +      +P+ + V L LG    A +        + IVR     E LG +  
Sbjct: 324 FQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKR--------KAIVRRLPSVETLGSVNV 375

Query: 486 LLSDKTGTLTQNDMELKKL-HLGTVSYTMDTMDIVTDYVRAMSDNLNSSAVPSASKKDLP 544
           + SDKTGTLT N M + K+  LG+                 M++ LN  ++      +L 
Sbjct: 376 ICSDKTGTLTSNHMTVSKIWCLGS-----------------MANKLNVLSLDKNKGGNLK 418

Query: 545 GRVRDLVLTLALCHQV--TPTFEDGELTYQAASPDEIAIVKFTESVGLTLFRRDRHSITL 602
             + D V T  LC  +    ++      Y   +P ++A+++  +   L   R        
Sbjct: 419 NYLTDDVKTTLLCGNLCNNASYSQEHAKY-LGNPTDVALLEQLQKFELADVRS------- 470

Query: 603 LHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWFLQKGADVVMSK----IVQKN 658
                    EY  +    FNS  K M   I D +K    F++   + ++ K    + +K 
Sbjct: 471 ---------EYTKVKELSFNSKRKMMATKIQDNEKKTTLFIKGAFERILDKSSSYLTEKG 521

Query: 659 DWLEEETGN----------LAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVT 708
              +   G+          LA EGLR L   ++ ++            D+S  ++  +++
Sbjct: 522 KIEKLTAGHRETIIDCANTLASEGLRVLAFAKRAMT------------DSSSKLVEDDIS 569

Query: 709 MSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSIS 768
                      DL   GL G+ D  +  VK +I+     GI I M+TGD   TA      
Sbjct: 570 -----------DLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTA------ 612

Query: 769 AKLVSRGQYVHTVTKVNKP--EGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFEI 826
                    V+   ++  P  +  L+ L   K+N                E    Q   +
Sbjct: 613 ---------VNIARQIGIPVIDPKLSVLSGDKLN----------------EMTDDQLANV 647

Query: 827 VVNLPAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGK 886
           + ++   I  R TP+ K ++   +R   G  V   GDG ND   ++ AD+GV + G+ G 
Sbjct: 648 IDHVN--IFARATPEHKLNIVRALRR-RGDVVAMTGDGVNDAPALKLADIGVSM-GRMGT 703

Query: 887 Q-ASLAADFSIT 897
             A  A+D  +T
Sbjct: 704 DVAKEASDMILT 715

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
           cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
           efflux, start by similarity
          Length = 1082

 Score = 84.0 bits (206), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 139/540 (25%), Positives = 223/540 (41%), Gaps = 84/540 (15%)

Query: 439 TIIPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQND 498
           ++IP SL V L +  S  A  +   + I    VR     E LG +  + SDKTGTLTQ  
Sbjct: 323 SMIPSSLVVVLTITMSAGAKVMATRNVI----VRKLDSLEALGAVNDICSDKTGTLTQGK 378

Query: 499 MELKKL---HLGTVSY---------TMDTMDIV---TDYVRAMSDNLNSSAVPSASKKDL 543
           M  K++     GT++          T+  + ++   + Y     D  +   +P    K L
Sbjct: 379 MIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGIIPDFKSKYL 438

Query: 544 PGRVRDLVLTL-------ALCHQVTPTFEDGELTYQAA--SPDEIAIVKFTESVGLTLFR 594
            G +  L ++L       A    +   F+D E     A   P EIAI  F   + L    
Sbjct: 439 AGELGPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDPTEIAIQVFATRMDLP--- 495

Query: 595 RDRHSITLL----HDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKDE----YWFLQKG 646
             RH +T         +  N  ++ +  FPF+S  KRM   I+   +D     Y    KG
Sbjct: 496 --RHVLTGEDKDDEKDARANSSFEHVAEFPFDSSVKRMS-AIYKNTEDPATPIYEVFTKG 552

Query: 647 ADVVMSKIVQKND-WLEEETGN---LAREGLRTLVIGRKRLSKKLLQ--TFTKDYEDASL 700
           A     +++Q  D W     G    L++E L T+      LS + L+   F K   + S 
Sbjct: 553 A---FERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKSFNESE 609

Query: 701 MMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVE 760
              N++  +       +E  L  LGL G+ D  +++  ++++    AGI + MLTGD   
Sbjct: 610 FNANKDKLLKE--RDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPG 667

Query: 761 TARCVSISAKLVSRGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYR 820
           TA+ ++    ++    Y +    VN    A T  + L                       
Sbjct: 668 TAKSIAQEVGILPHNLYHYPKEVVNFMVMAATDFDALS---------------------D 706

Query: 821 QQFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKRVCCI-GDGGNDVSMIQSADVGVG 879
           Q+  ++ V LP VIA RC PQ K  +   +   +  + C + GDG ND   ++ A+VG+ 
Sbjct: 707 QEIDDLRV-LPLVIA-RCAPQTKVRMIEALHRRS--KFCAMTGDGVNDSPSLKIANVGIA 762

Query: 880 IVGKEGKQASLAADFSITQFCHLSKL-LLWHGRNSYKRSAKLAQFVIHRGLLISVCQAVY 938
           +       A  A+D  ++     S L  +  GR   + S  + +FV+   L  +V QA+Y
Sbjct: 763 MGINGSDVAKDASDIVLSDDNFASILNAVEEGR---RMSDNIQKFVLQL-LAENVAQALY 818

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 83.6 bits (205), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 184/834 (22%), Positives = 341/834 (40%), Gaps = 136/834 (16%)

Query: 175 ILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFVLTVTMSKEALDDIQRRRRD 234
           +L++       +  + +A+S A+     G + S+++ +  ++ +    +A   +   +  
Sbjct: 66  VLHQVCNAMIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNL 125

Query: 235 RESNNELYEVLSKSQLVPSKDLKVGDLIKIGKGARAPADLVLLQSSE-PSGEIFIKTDQL 293
              N  +     KS+ + SKD+  GD+  +  G   PADL L+++    + E  +  + L
Sbjct: 126 SSPNAHVIRN-GKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESL 184

Query: 294 DGETDWKLRIACPLTQHLSQDDLLYRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNT 353
               D  L         +  D L    S +A V  ++     G +    + S+   +  +
Sbjct: 185 PVSKDANLVFGKEEETSVG-DRLNLAFSSSAVVKGRA----KGIVIKTALNSEIGKIAKS 239

Query: 354 MWANTVFASAGTAIACVVYTGADTRQAMNTSMSSVKTGLLELEINSLSKILCACVFILSV 413
           +  ++   S   + + +  T   T++     + +     L  +++ L+ +L     + ++
Sbjct: 240 LQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAI 299

Query: 414 ALVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRT 473
            ++A   F+  D  V I    +  S +IP SL V L +  SV A  +   + I    VR 
Sbjct: 300 IVMASQKFDV-DKRVAIYAICVALS-MIPSSLVVVLTITMSVGAAVMVSRNVI----VRK 353

Query: 474 STIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLG-----TVSYTMDTMDIVTDYVRAMSD 528
               E LG +  + SDKTGTLTQ  M  +++ +      T+S + D  +          +
Sbjct: 354 LDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFN---------PN 404

Query: 529 NLNSSAVPSAS-----------------------KKDLPGRV-----RDLVLTLALCHQV 560
             N S +P  S                       +KDLP  +     +  + T  L +  
Sbjct: 405 EGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIA 464

Query: 561 TPTFEDGELTYQA-ASPDEIAIVKFTESVGL------------TLFRRDRHSITLLHDQS 607
           T   +D    ++A   P EIAI  F   + L                 D+ S++  +++ 
Sbjct: 465 TVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKP 524

Query: 608 GTNFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWFLQKGA-DVVMS-----------KIV 655
           G+  +++ +  FPF+S  KRM  V ++   + Y    KGA + ++S           KI 
Sbjct: 525 GSA-QFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKIT 583

Query: 656 QKNDW----LEEETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSN 711
              D     + +   +L+ EGLR L    K        +FTKD        +N +  + N
Sbjct: 584 PLTDCDVETIRKNVYSLSNEGLRVLGFASK--------SFTKD-------QVNDD-QLKN 627

Query: 712 VISKHL--EHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISA 769
           + S     E DL  LGL G+ D  + +   +++    AGI + MLTGD V TA+ ++   
Sbjct: 628 ITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEV 687

Query: 770 KLVSRGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVVN 829
            ++    Y ++   V+                 S ++   +  GL      ++  + +  
Sbjct: 688 GILPTNLYHYSQEIVD-----------------SMVMTGSQFDGL-----SEEEVDDLPV 725

Query: 830 LPAVIACRCTPQQKADVATFIREVTGKRVCCI-GDGGNDVSMIQSADVGVGIVGKEGKQA 888
           LP VIA RC+PQ K  +   +     K+ C + GDG ND   ++ A+VG+ + G  G   
Sbjct: 726 LPLVIA-RCSPQTKVRMIEALHR--RKKFCAMTGDGVNDSPSLKMANVGIAM-GINGSDV 781

Query: 889 SLAADFSITQFCHLSKLL--LWHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSI 940
           S  A   +    + + +L  +  GR   + +  + +FV+   L  +V QA+Y I
Sbjct: 782 SKEASDIVLSDDNFASILNAVEEGR---RMTDNIQKFVLQL-LAENVAQALYLI 831

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 83.6 bits (205), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 184/834 (22%), Positives = 341/834 (40%), Gaps = 136/834 (16%)

Query: 175 ILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFVLTVTMSKEALDDIQRRRRD 234
           +L++       +  + +A+S A+     G + S+++ +  ++ +    +A   +   +  
Sbjct: 66  VLHQVCNAMIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNL 125

Query: 235 RESNNELYEVLSKSQLVPSKDLKVGDLIKIGKGARAPADLVLLQSSE-PSGEIFIKTDQL 293
              N  +     KS+ + SKD+  GD+  +  G   PADL L+++    + E  +  + L
Sbjct: 126 SSPNAHVIRN-GKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESL 184

Query: 294 DGETDWKLRIACPLTQHLSQDDLLYRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNT 353
               D  L         +  D L    S +A V  ++     G +    + S+   +  +
Sbjct: 185 PVSKDANLVFGKEEETSVG-DRLNLAFSSSAVVKGRA----KGIVIKTALNSEIGKIAKS 239

Query: 354 MWANTVFASAGTAIACVVYTGADTRQAMNTSMSSVKTGLLELEINSLSKILCACVFILSV 413
           +  ++   S   + + +  T   T++     + +     L  +++ L+ +L     + ++
Sbjct: 240 LQGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAI 299

Query: 414 ALVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRT 473
            ++A   F+  D  V I    +  S +IP SL V L +  SV A  +   + I    VR 
Sbjct: 300 IVMASQKFDV-DKRVAIYAICVALS-MIPSSLVVVLTITMSVGAAVMVSRNVI----VRK 353

Query: 474 STIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLG-----TVSYTMDTMDIVTDYVRAMSD 528
               E LG +  + SDKTGTLTQ  M  +++ +      T+S + D  +          +
Sbjct: 354 LDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFN---------PN 404

Query: 529 NLNSSAVPSAS-----------------------KKDLPGRV-----RDLVLTLALCHQV 560
             N S +P  S                       +KDLP  +     +  + T  L +  
Sbjct: 405 EGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIA 464

Query: 561 TPTFEDGELTYQA-ASPDEIAIVKFTESVGL------------TLFRRDRHSITLLHDQS 607
           T   +D    ++A   P EIAI  F   + L                 D+ S++  +++ 
Sbjct: 465 TVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKP 524

Query: 608 GTNFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWFLQKGA-DVVMS-----------KIV 655
           G+  +++ +  FPF+S  KRM  V ++   + Y    KGA + ++S           KI 
Sbjct: 525 GSA-QFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKIT 583

Query: 656 QKNDW----LEEETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSN 711
              D     + +   +L+ EGLR L    K        +FTKD        +N +  + N
Sbjct: 584 PLTDCDVETIRKNVYSLSNEGLRVLGFASK--------SFTKD-------QVNDD-QLKN 627

Query: 712 VISKHL--EHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISA 769
           + S     E DL  LGL G+ D  + +   +++    AGI + MLTGD V TA+ ++   
Sbjct: 628 ITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEV 687

Query: 770 KLVSRGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVVN 829
            ++    Y ++   V+                 S ++   +  GL      ++  + +  
Sbjct: 688 GILPTNLYHYSQEIVD-----------------SMVMTGSQFDGL-----SEEEVDDLPV 725

Query: 830 LPAVIACRCTPQQKADVATFIREVTGKRVCCI-GDGGNDVSMIQSADVGVGIVGKEGKQA 888
           LP VIA RC+PQ K  +   +     K+ C + GDG ND   ++ A+VG+ + G  G   
Sbjct: 726 LPLVIA-RCSPQTKVRMIEALHR--RKKFCAMTGDGVNDSPSLKMANVGIAM-GINGSDV 781

Query: 889 SLAADFSITQFCHLSKLL--LWHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSI 940
           S  A   +    + + +L  +  GR   + +  + +FV+   L  +V QA+Y I
Sbjct: 782 SKEASDIVLSDDNFASILNAVEEGR---RMTDNIQKFVLQL-LAENVAQALYLI 831

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
           involved in Na+ and Li+ efflux, required for Na+
           tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 83.2 bits (204), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 176/763 (23%), Positives = 313/763 (41%), Gaps = 135/763 (17%)

Query: 246 SKSQLVPSKDLKVGDLIKIGKGARAPADLVLLQSSE-PSGEIFIKTDQLDGETDWKLRIA 304
            KS+ + SKD+  GD+  +  G   PADL L+++    + E  +  + L    D  L   
Sbjct: 136 GKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFG 195

Query: 305 CPLTQHLSQDDLLYRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAG 364
                 +  D L    S +A V  ++     G +    + S+   +  ++  ++   S  
Sbjct: 196 KEEETSVG-DRLNLAFSSSAVVKGRA----KGIVIKTALNSEIGKIAKSLQGDSGLISRD 250

Query: 365 TAIACVVYTGADTRQAMNTSMSSVKTGLLELEINSLSKILCACVFILSVALVAFAGFNNN 424
            + + +  T   T++     + +     L  +++ L+ +L     + ++ ++A   F+  
Sbjct: 251 PSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDV- 309

Query: 425 DWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPEDLGRIE 484
           D  V I    +  S +IP SL V L +  SV A  +   + I    VR     E LG + 
Sbjct: 310 DKRVAIYAICVALS-MIPSSLVVVLTITMSVGAAVMVSRNVI----VRKLDSLEALGAVN 364

Query: 485 YLLSDKTGTLTQNDMELKKLHLG-----TVSYTMDTMDIVTDYVRAMSDNLNSSAVPSAS 539
            + SDKTGTLTQ  M  +++ +      T+S + D  +          +  N S +P  S
Sbjct: 365 DICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFN---------PNEGNVSLIPRFS 415

Query: 540 -----------------------KKDLPGRV-----RDLVLTLALCHQVTPTFEDGELTY 571
                                  +KDLP  +     +  + T  L +  T   +D    +
Sbjct: 416 PYEYSHNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCW 475

Query: 572 QA-ASPDEIAIVKFTESVGL------------TLFRRDRHSITLLHDQSGTNFEYDILHV 618
           +A   P EIAI  F   + L                 D+ S++  +++ G+  +++ +  
Sbjct: 476 KAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSA-QFEHIAE 534

Query: 619 FPFNSDNKRMGIVIFDKQKDEYWFLQKGA-DVVMS-----------KIVQKNDW----LE 662
           FPF+S  KRM  V ++   + Y    KGA + ++S           KI    D     + 
Sbjct: 535 FPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIR 594

Query: 663 EETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHL--EHD 720
           +   +L+ EGLR L    K        +FTKD        +N +  + N+ S     E D
Sbjct: 595 KNVYSLSNEGLRVLGFASK--------SFTKD-------QVNDD-QLKNITSNRATAESD 638

Query: 721 LEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQYVHT 780
           L  LGL G+ D  + +   +++    AGI + MLTGD V TA+ ++    ++    Y ++
Sbjct: 639 LVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYS 698

Query: 781 VTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVVNLPAVIACRCTP 840
              V+                 S ++   +  GL      ++  + +  LP VIA RC+P
Sbjct: 699 QEIVD-----------------SMVMTGSQFDGL-----SEEEVDDLPVLPLVIA-RCSP 735

Query: 841 QQKADVATFIREVTGKRVCCI-GDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQF 899
           Q K  +   +     K+ C + GDG ND   ++ A+VG+ + G  G   S  A   +   
Sbjct: 736 QTKVRMIEALHR--RKKFCTMTGDGVNDSPSLKMANVGIAM-GINGSDVSKEASDIVLSD 792

Query: 900 CHLSKLL--LWHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSI 940
            + + +L  +  GR   + +  + +FV+   L  +V QA+Y I
Sbjct: 793 DNFASILNAVEEGR---RMTDNIQKFVLQL-LAENVAQALYLI 831

>Kwal_47.17547
          Length = 1240

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 119/530 (22%), Positives = 217/530 (40%), Gaps = 84/530 (15%)

Query: 470 IVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSY----TMDTMDIVTDYVRA 525
           +VR     E +G    + SDKTGTLT+N M + K  LG+  +    ++   D  TD   A
Sbjct: 412 LVRVLRACETMGSATAVCSDKTGTLTENRMTVVKGFLGSTFFDEAESVGPSDSETDVDLA 471

Query: 526 MSDN--------------LNSSAVPS-------ASKKDLPGRVRDLVLTLALCHQVTPTF 564
           +++               LNS+A  +        S ++   + R  +   +  ++     
Sbjct: 472 IANECSEELKKDVLTNITLNSTAFENKENEEDKVSNENPFHKPRKSLFPWSRNNKSKKPA 531

Query: 565 EDGELTYQAAS--PDEIAIVKFTESVGLTLFRRDRHSITLLH--DQSGTNFEYDILHVFP 620
              EL   AA+  P E  +   TE+  L   +++     L H  D+        I+ + P
Sbjct: 532 TAKELVENAAADQPKEPFLGSKTETALLAFAQKNLGMQNLHHYRDEPDCLGIEKIVQIIP 591

Query: 621 FNSDNKRMGIVIFDKQKDEYWFLQKGADVVMSKIVQK------------NDWLEEETG-- 666
           F S  K  GIV+  K     ++++  A++++ + +QK             D+ EE     
Sbjct: 592 FESSRKWGGIVVKYKNGLHRFYIKGAAELLLRRCMQKRASDSKLTLISQKDFDEESQTIT 651

Query: 667 NLAREGLRTLVIGRK------RLSKKLLQTFTKDYEDASLMMLNREVTMSNVIS---KHL 717
           NLA E LR + +  +            LQ   +    +  ++   EV+ S+ +S   + L
Sbjct: 652 NLAAEALRAISLAHRDYPNCPNWPPSELQDEVEPEAASPDLLFGDEVSRSDSVSEPAQEL 711

Query: 718 EHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQY 777
              + + G+ G++D L++ V+ S+E  + AG+ + M+TGD + TA  ++    ++S  Q 
Sbjct: 712 VSPMVLDGIVGIQDPLRKGVRKSVEQCQKAGVTVRMVTGDNILTATAIAKKCSILSEEQ- 770

Query: 778 VHTVTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVVNLPAVIACR 837
                    PE ++      K++                    ++   I+ NL   +  R
Sbjct: 771 ------AENPESSMEGPRFRKLSN-------------------KERVRILPNLR--VLAR 803

Query: 838 CTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVG--VGIVGKEGKQASLAADFS 895
            +P+ K  +   ++++ G  V   GDG ND   ++ ADVG  +GI G E  + +      
Sbjct: 804 SSPEDKRILVETLKKM-GDVVAVTGDGTNDAPALKLADVGFSMGIAGTEVAREASDIILM 862

Query: 896 ITQFCHLSKLLLWHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSISSKFE 945
              F  +   + W GR       K  QF +   +   V   V +++S  E
Sbjct: 863 TDDFSAIVNAIKW-GRCVSTSIKKFIQFQLTVNVTAVVLTFVSAVASSEE 911

>Kwal_14.1498
          Length = 939

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 174/779 (22%), Positives = 310/779 (39%), Gaps = 172/779 (22%)

Query: 153 RYKYAPNAISNAKYNPVTFIPKILYEQF-KFFFNLYFLLVALSQAIPALRIGYLSSYI-V 210
           R +Y  N IS+ +  P       L+ +F   F     +L+ +  A+ +  +G +   + +
Sbjct: 63  RAQYGKNEISSEEDEP-------LWWKFVTTFVGDPLILLLIGSAVISFIMGNIDDAVSI 115

Query: 211 PLAFVLTVTM-------SKEALDDIQRRRRDRESNNELYEVLSKSQLVPSKDLKVGDLIK 263
            LA V+ VT+       S+++L+ + R   D+     L     +S+L+ S  L  GD+++
Sbjct: 116 TLAIVIVVTVGFVQEYRSEKSLEALNRLVPDQ---CHLIRCGQESKLLASV-LVPGDVVR 171

Query: 264 IGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLTQHLSQDDLLYRISIT 323
              G R PADL ++++ + S    I+   L GE +   +    + +   +++L       
Sbjct: 172 FRVGDRIPADLRIIEAVDLS----IEESNLTGENEPVHKSTATVNKEFYKENL----GSI 223

Query: 324 ASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAIACVVYTGADTRQA--- 380
             V E+S   F+G L                         G     V+ T  +T      
Sbjct: 224 VPVSERSCIAFMGTLV----------------------REGHGRGIVIGTAKNTAFGKVF 261

Query: 381 -MNTSMSSVKTGLLELEINSLSKILCACVFILSVALVAFAGFNNNDWYVDIMRYLILFST 439
            M  ++   KT L +  ++ L K L    FI+ + ++   G      ++++ +  +  + 
Sbjct: 262 EMMNAIEKPKTPL-QTAMDKLGKDLSFMSFIV-IGIICLIGVIQGRSWLEMFQISVSLAV 319

Query: 440 I-----IPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPEDLGRIEYLLSDKTGTL 494
                 +P+ + V L LG    A +          I+R     E LG +  + SDKTGTL
Sbjct: 320 AAIPEGLPIIVTVTLALGVLRMAKR--------RAIIRRLPSVETLGSVNVICSDKTGTL 371

Query: 495 TQNDMELKKL-HLGTVSYTMDTMDIVTDYVRAMSDNLNSSAVPSASKKDLPGRVRDLVLT 553
           T N M + K+  LG++S   + + +               A   + KK+L   +R  + T
Sbjct: 372 TANHMSVNKVWCLGSMSNKSNILKL-------------DKATSGSFKKNLTEDLRATLRT 418

Query: 554 LALCHQVTPTFEDGELTYQAASPDEIAIVKFTESVGLTLFRRDRHSITLLHDQSGTNFEY 613
             LC+  T + E  +      +P +IA+++     GL     +R  +T   + S      
Sbjct: 419 GNLCNNSTYSHEHAKYL---GNPTDIALLEVLHKFGL---EDERPQVTRSDEIS------ 466

Query: 614 DILHVFPFNSDNKRMGIVIFDKQ-------KDEYW-FLQKGADVVMS--KIVQKNDWLEE 663
                  FNS  K M + + +         K  Y   L+K    + +  K+V+ +  L +
Sbjct: 467 -------FNSKRKFMAVKVKEANGKFVVHVKGAYEKILEKSTHFINAENKVVKLDSNLRQ 519

Query: 664 ETGN----LAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHLEH 719
              +    LA +GLRTL   +  LS    +  T+D  +                      
Sbjct: 520 AITDSADALASDGLRTLAFAQLELSNGNSKKLTEDDING--------------------- 558

Query: 720 DLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQYVH 779
            L   GL G+ D  +  VK+++E L    + I M+TGD   TA  VSI+ ++        
Sbjct: 559 -LTFAGLLGMNDPPRPSVKAAVERLSEGSVHIIMITGDAENTA--VSIARQI-------- 607

Query: 780 TVTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVVNLPAVIACRCT 839
            +  VN     LT                    G  L++  +     +++   + A R T
Sbjct: 608 GIPVVNPETAVLT--------------------GDKLDHMSEDQLASIIDHVNIFA-RAT 646

Query: 840 PQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQ-ASLAADFSIT 897
           P+ K ++   +++  G  V   GDG ND   ++ AD+GV + GK G   A  A+D  +T
Sbjct: 647 PEHKLNIVRALQK-RGDIVAMTGDGVNDAPALKLADIGVSM-GKMGTDVAKEASDMVLT 703

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
           (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 173/760 (22%), Positives = 299/760 (39%), Gaps = 144/760 (18%)

Query: 244 VLSKSQLVPSKDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQ--LDGETDWKL 301
           V++ +Q+VP      GD++++  G   PADL L+++      + ++TD+  L GE    L
Sbjct: 144 VMASAQVVP------GDIVQVRVGDTVPADLRLVEA------LNLETDEALLTGEA---L 188

Query: 302 RIACPLTQHLSQDDLLY-RISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVF 360
            +A        QD  +  R+++  +    S     G +    ++S+   +  ++      
Sbjct: 189 PVAKDPAAVFEQDTPVGDRLNLAFASSTVSKGRATGIVVRTGLRSEIGKIAESLQGKQSL 248

Query: 361 ASAGTAIACVVYTGADTRQAMNTSMSSVKTGLLELEINSLSKILCACVFILSVALVAFAG 420
            S     + +  T    + ++ + + +     L  ++  L+ IL A   + ++ ++A   
Sbjct: 249 ISRDENKSGLQNTVLTVKASVGSFLGTNVGTPLHRKLAKLALILFAIAVLFALIVMATQK 308

Query: 421 FNNNDWYVDIMRYLILFS-TIIPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPED 479
           F  N    ++  Y I  + ++IP SL V L +  S  A  +    +    IVR     E 
Sbjct: 309 FIVNR---EVAIYAICVALSMIPSSLVVVLTITMSAGAKVM----STRNVIVRRLDSLEA 361

Query: 480 LGRIEYLLSDKTGTLTQNDMELKKL---HLGTVSY---------TMDTMDIVTDY----- 522
           LG +  + SDKTGTLTQ  M LK+L     GTV           T+  + ++  +     
Sbjct: 362 LGAVNDICSDKTGTLTQGKMILKQLWVPEFGTVVVNRSNVPFDPTVGDVSLIPRFSPWEY 421

Query: 523 ----------VRAMSDNLNSSAVPSASKKDLPGRVRDLVLTLALCHQVTPTFEDGELTYQ 572
                     +        S+++P    K L  R  +  L  A    +   F+D +    
Sbjct: 422 QHDEEEDVGIIANFKQRWQSNSLP----KGLNPRKFESWLHTATLANIATVFKDSDSKEW 477

Query: 573 AA--SPDEIAIVKFTESVGLTLFRRDRHSITLLHDQSGTNFE--------YDILHVFPFN 622
            A   P EIAI  F      T      H++T   D+  ++          Y+    FPF+
Sbjct: 478 RAHGDPTEIAIQVFA-----TRMDHPHHALTTEQDEEDSDSSQQNDAARIYEHAAEFPFD 532

Query: 623 SDNKRMGIV-----------IFDKQKDEY-------WFLQKGADVVMSKIVQKNDWLEEE 664
           S  KRM  V           +F K   E        W L  G  V         + +++ 
Sbjct: 533 SSIKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKN 592

Query: 665 TGNLAREGLRTLVIGRKRL----SKKLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHD 720
              L+ EGLR L    K +    ++ L +  TKD +                    +E D
Sbjct: 593 VDTLSNEGLRVLAFATKTIPAEEAESLGERLTKDRD-------------------FVESD 633

Query: 721 LEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQYVHT 780
           L   GL G+ D  + +   +++    AGI + MLTGD   TA+ ++    ++    Y   
Sbjct: 634 LIFQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLY--- 690

Query: 781 VTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVVNLPAVIACRCTP 840
               + P+  +  + +     +S  L D E   L +             LP VIA RC P
Sbjct: 691 ----HYPKEVVDIMVMTATQFDS--LTDEELDQLPV-------------LPLVIA-RCAP 730

Query: 841 QQKADVATFIREVTGKRVCCI-GDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQF 899
           Q K  +   +     ++ C + GDG ND   ++ A+VG+ +       A  A+D  ++  
Sbjct: 731 QTKVRMIDALHR--REKFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDD 788

Query: 900 CHLSKL-LLWHGRNSYKRSAKLAQFVIHRGLLISVCQAVY 938
              S L  +  GR   + S  + +FV+   L  +V QA+Y
Sbjct: 789 NFASILNAVEEGR---RMSDNIQKFVLQL-LAANVAQAIY 824

>CAGL0J01870g 181666..184506 highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1, hypothetical
           start
          Length = 946

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 175/735 (23%), Positives = 280/735 (38%), Gaps = 170/735 (23%)

Query: 183 FFNLYFLLVALSQAIPALRIGYLSSYI-VPLAFVLTVTM----------SKEALDDI--- 228
           F     +L+ +  A+ +  IG +   + + LA ++ VT+          S EAL+ +   
Sbjct: 102 FVEDRLILLLIGSAVLSFAIGQIDDAVSISLAILIVVTVGFIQEYRSEKSLEALNKLVPT 161

Query: 229 --QRRRRDRESNNELYEVLSKSQLVPSKDLKVGDLIKIGKGARAPADLVLLQSSEPSGEI 286
                R  RESN         S+LVP      GDL++   G R PAD+ ++++ + S   
Sbjct: 162 KCHLIRYGRESNT------LASELVP------GDLVRFKIGDRIPADVRIIEAVDLS--- 206

Query: 287 FIKTDQLDGETDWKLRIACPLTQHLSQDDLLYRISITASVPEKSINNFLGKLTFGEIQSQ 346
            I    L GET+       PL +     D           PE+  N           ++ 
Sbjct: 207 -IDESNLTGETE-------PLHKDAQTID-----------PEEYDN-----------RNV 236

Query: 347 PLSVDNTMWANTVFASAGTAIACVVYTGADTRQA----MNTSMSSVKTGLLELEINSLSK 402
           P+S  + +         G     V+ TG +T       M  S+   KT L E  ++ L  
Sbjct: 237 PVSERSCIAYMGTLVKEGHGKGIVIGTGTNTSYGAIFEMVNSIEKPKTPLQE-TMDRLGT 295

Query: 403 ILCACVFILSVALVAFAGFNNND----WYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAH 458
            L    F +   +        N     + V +   +      +P+ + V L LG      
Sbjct: 296 ELSYISFFIIAIISIVGIIRGNSLLMMFQVSVSLAVAAIPEGLPIIVTVTLALGVLRMTK 355

Query: 459 QIEHDSTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDTMDI 518
           Q          IVR     E LG +  + +DKTGTLT N M + KL      + +D    
Sbjct: 356 Q--------NAIVRRLPSVETLGSVNVICTDKTGTLTTNHMTVSKL------FCLD---- 397

Query: 519 VTDYVRAMSDNLNSSAVPSASKKDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDE 578
                   S     +A+      +      D+  TL + +         E      +P +
Sbjct: 398 --------SSGTYENAISPEEDSEFDVHDNDVKETLTIANICNNAKYSEEHNLYIGNPTD 449

Query: 579 IAIVKFTESVGLTLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKD 638
           +A+++     G+   +RD H               + +    FNS  K M I    K+  
Sbjct: 450 VALIEVLTKFGIP-DQRDSH---------------EKMEELSFNSKRKYMAIK-SSKESG 492

Query: 639 EYWFLQKGADVVMSKIVQKNDWLEEETGNLAR--EGLRTLVI-GRKRLSKKLLQTFTKDY 695
           E+    KGA     +I+ K+ +  ++ G +    E  + +V+      +   L+T    +
Sbjct: 493 EHVLYIKGA---FERILDKSSYYLDKAGEVREFDEHSKVMVLEAAHSCASDGLRTIACAF 549

Query: 696 EDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLT 755
                    +     NVIS+   + L   GL G+ D  + +VK+SIE L   G+ I M+T
Sbjct: 550 ---------KPTDSDNVISEDDINGLTFTGLFGLADPPRPNVKASIEKLHRGGVHIIMIT 600

Query: 756 GDKVETARCVSISAKL----VSRGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGES 811
           GD V TA  VSI+ K+      R   V T  KV++    LT  EL K+       ID   
Sbjct: 601 GDSVNTA--VSIAEKIGLSVQDRESSVMTGDKVSE----LTEDELSKV-------IDK-- 645

Query: 812 LGLYLEYYRQQFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMI 871
                           VN+ A    R TP+ K ++   +R+  G  V   GDG ND   +
Sbjct: 646 ----------------VNIFA----RATPENKLNIVKALRK-RGDIVAMTGDGVNDAPAL 684

Query: 872 QSADVGV--GIVGKE 884
           + AD+G+  GI G +
Sbjct: 685 KLADIGIAMGISGTD 699

>CAGL0K12034g complement(1161299..1164562) highly similar to
           sp|P13587 Saccharomyces cerevisiae YDR040c ENA1 or
           sp|Q01896 Saccharomyces cerevisiae YDR039c ENA2 or
           sp|Q12691 Saccharomyces cerevisiae YDR038c ENA5,
           hypothetical start
          Length = 1087

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 173/769 (22%), Positives = 297/769 (38%), Gaps = 148/769 (19%)

Query: 246 SKSQLVPSKDLKVGDLIKIGKGARAPADLVLL-QSSEPSGEIFIKTDQL----------D 294
             S++V S D+  GDL+ +  G   PADL L+ Q +  + E  +  + L          D
Sbjct: 132 GNSEVVDSTDVVPGDLVVVKVGDTIPADLRLVSQQNFETDEALLTGESLPVSKDANEIFD 191

Query: 295 GETDWKLRIACPLTQHLSQDDLLYRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTM 354
            ET    RI    +           I+I     +  +N  +GK+      ++ L   N +
Sbjct: 192 DETPVGDRINLAFSSSTVVKGRAQGIAI-----KTGLNTEIGKI------AKSLRGGNEL 240

Query: 355 W----ANTVFASAGTAIACVVYTGADTRQAMNTSMSSVKTGLLELEINSLSKILCACVFI 410
                A T + +A  +          T++ +   + + +   L  +++ L+ +L     +
Sbjct: 241 ISRDPAKTWYQNAWIS----------TKRTVGAFLGTTQGTPLHRKLSKLAVLLFWIAVV 290

Query: 411 LSVALVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTIPETI 470
            ++ ++A   F+  D  V I    +  S +IP SL V L +  SV A  +   + I    
Sbjct: 291 FAIVVMASQKFDV-DRGVAIYAVCVALS-MIPSSLVVVLTITMSVGAAVMASRNVI---- 344

Query: 471 VRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDTMDIVTDYVRAMSDNL 530
           +R     E LG +  + SDKTGTLTQ  M  K++ +        T+ +V        +  
Sbjct: 345 IRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQIWVPKFG----TLQVVGSNEPLNPEKG 400

Query: 531 NSSAVPSASK-----------------------KDLPGRVR----DLVLTLALCHQVTPT 563
           + + +P+ S                        K +PG  +    D  L  A    +   
Sbjct: 401 DINFIPNLSPYEYSHNETEDVGIMQNFKDKYEGKSIPGNCQYQLFDKWLETASLANIASV 460

Query: 564 FEDGELTYQAA--SPDEIAIVKFTESVGL-----TLFRRDRHSITLL-------HDQSGT 609
           F D E     A   P EIAI  F   + L     T  R D     ++        D +  
Sbjct: 461 FTDPETKEWKAHGDPTEIAIQVFATRMDLPRHVLTGERDDMDEDEIMSSVSLSEKDATAA 520

Query: 610 NFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWFLQKGA--------------DVVMSKIV 655
           N ++     FPF+S  KRM  V   +    Y    KGA              D   + ++
Sbjct: 521 NAKFRHAAEFPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGRDPNTATVM 580

Query: 656 QKND--WLEEETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVI 713
              D   ++E   +++ EGLR L    K   K        D  +  L  + +E       
Sbjct: 581 TDADVDTIKENIDSMSSEGLRVLAFANKSYPKS-------DVNEEKLQKILKE------- 626

Query: 714 SKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVS 773
             + E  L  LGL G+ D  +E+   +++    AGI + MLTGD   TA+ ++    ++ 
Sbjct: 627 RDYAETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAIAQEVGILP 686

Query: 774 RGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVVNLPAV 833
              Y ++   V+                   +++ G+      +   +   + +  LP V
Sbjct: 687 TNLYHYSKEVVD------------------IMVMTGKQ----FDNLSEDEIDNLPVLPLV 724

Query: 834 IACRCTPQQKADVATFIREVTGKRVCCI-GDGGNDVSMIQSADVGVGIVGKEGKQASLAA 892
           IA RC+PQ K  +   +     ++ C + GDG ND   ++ A+VG+ +       A  A+
Sbjct: 725 IA-RCSPQTKVRMIEALHR--REKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAKDAS 781

Query: 893 DFSITQFCHLSKL-LLWHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSI 940
           D  ++     S L  +  GR   + S  + +FV+   L  +V QA+Y I
Sbjct: 782 DIVLSDDNFASILNAVEEGR---RMSDNIQKFVLQL-LAENVAQALYLI 826

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
            complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 200/932 (21%), Positives = 348/932 (37%), Gaps = 164/932 (17%)

Query: 230  RRRRDRESNNELYEVLSKSQLVPSKDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIK 289
            R  R +E    +        ++   DL VGDL+ +  G   P D +L++     G+    
Sbjct: 175  RLNRKKEDTEVVVVRNGDKHVISVHDLLVGDLLSLQTGDVVPVDCILVE-----GKCECD 229

Query: 290  TDQLDGETDWKLRIACPLTQHLSQDDLLYRISITASVPEKSINNFLGKLTFGE-IQSQPL 348
               + GE+D   +++  ++  +      YR ++ A  P   I    G    G  +   P+
Sbjct: 230  ESGITGESDTIKKVSLAMSLQV------YR-TVAADNPSADI----GSSDNGHSLVPDPM 278

Query: 349  SVDNTMWANTVFASAGTAIACVVYTGADTRQAMNTSMSSVKTGLLELEINSLSKIL---- 404
             +  +     + +  G A+   V   +   + M    S  +T  L+  +N+L+  +    
Sbjct: 279  LISGS----KLLSGIGHAVVTAVGPHSVHGKMMLALKSEPETTPLQERLNTLADDISIYG 334

Query: 405  -CACVFILSVALVAFAGF-NNNDWYVDI------MRYLILFSTII-------PVSLRVNL 449
              A   +  V  + F  +      Y D+       R++ +F T +       P  L + +
Sbjct: 335  SVAAFLLFVVLFLRFLSYLPKGRLYHDLPSARKGSRFMDIFITAVTVIVVAVPEGLPLAV 394

Query: 450  DLGKSVYAHQIEHDSTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTV 509
             L  +    ++  D  +    VR     E +G    + SDKTGTLTQN M + K  LG+ 
Sbjct: 395  TLALAFATTRMTKDGNL----VRVLRACETMGSATTVCSDKTGTLTQNKMVVVKGFLGSS 450

Query: 510  SY---TMDTMDIVTDYVR------AMSDNLNSSAVPSASKKDLPGRVRDLVLTLALCHQ- 559
             +   + D+    +D +R       ++D L + A+ S + ++   +V D V+T    H+ 
Sbjct: 451  HFDDISEDSNCAQSDALRQDMSQHTLNDILANIALNSTAFEN--KQVADPVITENPYHKP 508

Query: 560  ---VTPTFEDGELTYQAASPDEIAIVKF-----TESVGLTLFRRDR--HSITLLHDQSGT 609
               + P   + +  Y A     +   +F     TE+  L+L +      S+  L D    
Sbjct: 509  RRSLFPWSRNNKPKYPAPKDSSVQSAEFFIGSKTEAALLSLAKGSLGLESLQALRDDPHH 568

Query: 610  NFEYDILHVFPFNSDNKRMGIVI---------FDKQKDEYWF-----LQKGADVVMSKIV 655
                 I+ + PF S  K  G+V+         F K   E  F     ++   D V+    
Sbjct: 569  IGIASIVQMIPFESSRKWAGLVVRLVDGNYRFFIKGASETIFKSCHYMRSSNDDVIKLSP 628

Query: 656  QKNDWLEEETGNLAREGLRTLVIGRKRLS--KKLLQTFTKDYEDASL----MMLNRE--- 706
            QK+  +     NLA + LRT+ +  K  +          +D  D S     ++L  E   
Sbjct: 629  QKHGEIFGLINNLASDALRTISLAHKDFTDISSWPPAELRDASDPSTASPDLLLGDEYVP 688

Query: 707  -VTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCV 765
              T    I  +    L + G+ G+ D L+  VK S++  + +G+ + M+TGD + T R +
Sbjct: 689  TATDRPSIITNNNSGLILDGVVGIHDPLRPGVKESVKNCQQSGVTVRMITGDNITTGRAI 748

Query: 766  SISAKLVSRGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFE 825
            + +  ++S  +Y      +  P                          ++ +  R+Q  +
Sbjct: 749  ARACGILSESEYADHECAMEGP--------------------------VFRKLSRRQMMD 782

Query: 826  IVVNLPAVIACRCTPQQK---ADVATFIREVTGKRVCCIGDGGNDVSMIQSADVG--VGI 880
                L   +  R +P+ K    D+   + EV    V   GDG ND   +  ADVG  +GI
Sbjct: 783  AAPKLK--VLARSSPEDKRIFVDILKKMNEV----VAVTGDGTNDAPALTLADVGFSMGI 836

Query: 881  VG----KEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRSAKLAQFVIHRGLLISVCQA 936
             G    +E     L  D     F  +   + W GR       K  QF +   +       
Sbjct: 837  SGTGVAREASDIILMTD----DFTSIVNAIKW-GRCVSLSIKKFIQFQLTVNITAVTLTC 891

Query: 937  VYSISSKFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKTYPELYKELTAGKS 996
            V +++S  E   L    L+       T+A   +L L  D      K  P + + +  G+ 
Sbjct: 892  VTAVTSTEENPVLTAVQLLWVNLIMDTLA---ALALATD------KPDPHILERIPTGRD 942

Query: 997  ------LSYKTFFVWVVLSLFQGCVIQ-GLSQGF------------TSLDELDFKRLVAL 1037
                   ++K      VL L    V+  G  + F              LD L F   V L
Sbjct: 943  SPLIAVSTWKMILGQAVLQLIIAFVLHYGGRKLFYPHQVPFTGRDQKRLDTLTFNTFVWL 1002

Query: 1038 SFTVLILNELIMVAIEIYTWNKTMVVSEVVTF 1069
             F  LI+   +  A  I  W K +    +  F
Sbjct: 1003 QFFKLIVTRKLDEADGISDWRKRITARNLNFF 1034

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
           Ca2+-transporting P-type ATPase of Golgi membrane
           involved in Ca2+ and Mn2+ import into Golgi [2853 bp,
           950 aa]
          Length = 950

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 181/788 (22%), Positives = 300/788 (38%), Gaps = 197/788 (25%)

Query: 153 RYKYAPNAISNAKYNPVTFIPKILYEQF-KFFFNLYFLLVALSQAIPALRIGYLSSYI-V 210
           R  Y PN I+           + L+++F   F     +L+ +  A+ +L +G +   + +
Sbjct: 68  RSLYGPNEITVED-------DESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSI 120

Query: 211 PLAFVLTVTM----------SKEALDDIQRRRRDRESNNELYEVLSKSQLVPSKDLKVGD 260
            LA  + VT+          S EAL+ +           +   VL+ S LVP      GD
Sbjct: 121 TLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLA-STLVP------GD 173

Query: 261 LIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLTQHLSQDDLLYRI 320
           L+    G R PAD+ ++++ + S    I    L GE +   + +    Q + +     + 
Sbjct: 174 LVHFRIGDRIPADIRIIEAIDLS----IDESNLTGENEPVHKTS----QTIEKSSFNDQP 225

Query: 321 SITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAIACVVYTGADTRQA 380
           +    + E+S   ++G L                         G     VV TG +T   
Sbjct: 226 NSIVPISERSCIAYMGTL----------------------VKEGHGKGIVVGTGTNTSFG 263

Query: 381 ----MNTSMSSVKTGLLELEINSLSKILCACVFILSVALVAFAGFNNNDWYVDIMRYLIL 436
               M  ++   KT L +L ++ L K L    FI+ + ++   G      ++++ +  + 
Sbjct: 264 AVFEMMNNIEKPKTPL-QLTMDKLGKDLSLVSFIV-IGMICLVGIIQGRSWLEMFQISVS 321

Query: 437 FSTI-----IPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPEDLGRIEYLLSDKT 491
            +       +P+ + V L LG    A +        + IVR     E LG +  + SDKT
Sbjct: 322 LAVAAIPEGLPIIVTVTLALGVLRMAKR--------KAIVRRLPSVETLGSVNVICSDKT 373

Query: 492 GTLTQNDMELKKLHLGTVSYTMDTMDIVTDYVRAMSDNLNSSAVPSASK-KDLPGRVRDL 550
           GTLT N M + KL      + +D+M          S+ LN  ++    K K+  G +++ 
Sbjct: 374 GTLTSNHMTVSKL------WCLDSM----------SNKLNVLSLDKNKKTKNSNGNLKNY 417

Query: 551 VLTLALCHQVTPTFEDGELTYQAASPDEIAIVKFTESVGLTLFRRDRHSITLLHDQSGTN 610
                L   V  T   G L   A+   E AI           F  +   + LL   +  N
Sbjct: 418 -----LTEDVRETLTIGNLCNNASFSQEHAI-----------FLGNPTDVALLEQLA--N 459

Query: 611 FEY-DI------LHVFPFNSDNKRMGIVIFDKQKDEYWFLQKGADVVMSKIVQ------- 656
           FE  DI      +   PFNS  K M   I +   ++     KGA     +I++       
Sbjct: 460 FEMPDIRNTVQKVQELPFNSKRKLMATKILNPVDNKCTVYVKGA---FERILEYSTSYLK 516

Query: 657 ----KNDWLEE-------ETGN-LAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLN 704
               K + L E       E  N +A EGLR     +  LS                    
Sbjct: 517 SKGKKTEKLTEAQKATINECANSMASEGLRVFGFAKLTLSDS------------------ 558

Query: 705 REVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARC 764
                S  +++ L  DL   GL G+ D  + +VK +IE L   G+ I M+TGD   TA  
Sbjct: 559 -----STPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTA-- 611

Query: 765 VSISAKLVSRGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFF 824
                        V+   ++  P           +      ++ G+ L    E    Q  
Sbjct: 612 -------------VNIAKQIGIP-----------VIDPKLSVLSGDKLD---EMSDDQLA 644

Query: 825 EIVVNLPAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGV--GIVG 882
            ++ ++   I  R TP+ K ++   +R+  G  V   GDG ND   ++ +D+GV  G +G
Sbjct: 645 NVIDHVN--IFARATPEHKLNIVRALRK-RGDVVAMTGDGVNDAPALKLSDIGVSMGRIG 701

Query: 883 KE-GKQAS 889
            +  K+AS
Sbjct: 702 TDVAKEAS 709

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
           Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
           involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 177/743 (23%), Positives = 302/743 (40%), Gaps = 122/743 (16%)

Query: 251 VPSKDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQ--LDGETDWKLRIACPLT 308
           + SK+L  GD+  I  G   PADL L ++      I ++TD+  L GE+   L +A    
Sbjct: 143 IESKELVPGDICIIRVGDTVPADLRLFEA------INLETDEALLTGES---LPVAKSHG 193

Query: 309 QHLSQD-------DLLYRISI------TASVPEKSINNFLGKLTFGEIQSQPLSVDNTMW 355
           +   QD       +L +  S       T  V + ++N  +GK+      ++ L  + ++ 
Sbjct: 194 EVYEQDTPVGDRLNLAFAASTVTKGRATGIVIKTALNTEIGKI------AKSLKSEASLI 247

Query: 356 ANTVFASAGTAIACVVYTGADTRQAMNTSMSSVKTGLLELEINSLSKILCACVFILSVAL 415
           +     S G  +   +      R+++ T + +     L  +++ L+ +L     I ++ +
Sbjct: 248 SRDKSKSFGRNLWITL------RESIGTFLGTSVGTPLHRKLSQLAILLFVVAVIFAIVV 301

Query: 416 VAFAGFNNNDWYVDIMRYLILFS-TIIPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTS 474
           +    F  N     +  Y I  + ++IP SL V L +  S  A  +         I+R  
Sbjct: 302 MGTQKFKVNK---QVAIYAICVALSMIPSSLVVVLTITMSAGAKVM----ATRHVIIRKL 354

Query: 475 TIPEDLGRIEYLLSDKTGTLTQNDMELKKL---HLGTVSY---------TMDTMDIV--- 519
              E LG +  + SDKTGTLTQ  M  K++     GT++          T+  + ++   
Sbjct: 355 DSLEALGAVNDICSDKTGTLTQGKMIAKQVWIPQFGTINVQNSNEPFNPTIGEIQLIPKF 414

Query: 520 TDYVRAMSDNLNSSAVPSASKKDLPGRVRDLVLTL-------ALCHQVTPTFEDGELTYQ 572
           + Y     D  +   +     K     +  L ++L       A    +   F D E    
Sbjct: 415 SPYQYKHDDEEDVGMITDFKSKYYADELGPLNVSLFTQWLYTATLANIATVFRDPETQDW 474

Query: 573 AA--SPDEIAIVKFTESVGLTLFRRDRHSITLLHDQSGTNFEYDIL--HV--FPFNSDNK 626
            A   P EIAI  F   + L      R  +T   +    N   DI   HV  +PF+S  K
Sbjct: 475 KAHGDPTEIAIQVFATRMDLP-----RRVLTGEDNDDEKNIHNDITFEHVAEYPFDSSVK 529

Query: 627 RMGIVIFDKQKDE---YWFLQKGADVVMSKIVQ-KNDWLEEETGN---LAREGLRTLVIG 679
           RM  +  + ++ +   Y    KGA     +++Q  N W     G+   L  E L T+   
Sbjct: 530 RMSAIYKNVEEPKAPIYEVFTKGA---FERVLQCCNSWYTTPDGSPQPLTEEDLETVQKN 586

Query: 680 RKRLSKKLLQ--TFTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDV 737
              LS + L+   F K   + S   +N++  +       +E++L  LGL G+ D  + + 
Sbjct: 587 VDTLSSEGLRVLAFAKKTFNESQFTINKDKLLKE--RDFVENNLTFLGLVGIYDPPRRES 644

Query: 738 KSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQYVHTVTKVNKPEGALTHLELL 797
            ++++    AGI + MLTGD   TA+ ++    ++    Y +    VN      T  + L
Sbjct: 645 LAAVKKCHLAGINVHMLTGDFPGTAKSIAQEVGILPHNLYHYPKEVVNFMVMTATDFDAL 704

Query: 798 KINTNSCLLIDGESLGLYLEYYRQQFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKR 857
                                  ++  E+ V LP VIA RC PQ K  +   +      R
Sbjct: 705 S---------------------DKEIDELPV-LPLVIA-RCAPQTKVRMIEALHR--RNR 739

Query: 858 VCCI-GDGGNDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCHLSKL-LLWHGRNSYK 915
            C + GDG ND   ++ A+VG+ +       A  A+D  ++     S L  +  GR   +
Sbjct: 740 FCAMTGDGVNDSPSLKIANVGIAMGINGSDVAKDASDIVLSDDNFASILNAVEEGR---R 796

Query: 916 RSAKLAQFVIHRGLLISVCQAVY 938
            S  + +FV+   L  +V QA+Y
Sbjct: 797 MSDNIQKFVLQL-LAENVAQALY 818

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
           complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 70.5 bits (171), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 151/686 (22%), Positives = 258/686 (37%), Gaps = 173/686 (25%)

Query: 248 SQLVPSKDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPL 307
           S LVP      GDL+    G R PAD+ +++S++ S    +    L GET+   +   P+
Sbjct: 173 SCLVP------GDLVYFKVGDRIPADVRIIESTDLS----LDESTLTGETEPVHKSCTPV 222

Query: 308 TQHLSQDDLLYRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAI 367
                 D           VP   I               P+    ++         G   
Sbjct: 223 NSATYSD-----------VPGGII---------------PIGERTSIAYMGTLVREGHGK 256

Query: 368 ACVVYTGADTRQA----MNTSMSSVKTGLLELEINSLSKILCACVFILSVALVAFAGFNN 423
             VV TG  T       M  S+   KT L ++ +++L + L    F+LS  +        
Sbjct: 257 GIVVATGKHTMFGAVFEMMNSIEKPKTPL-QMAMDTLRRDLSYVRFVLSGIIFLLGVIQG 315

Query: 424 NDWY----VDIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPED 479
             W     + +   +      +P+ + V L LG    A++        + IVR     E 
Sbjct: 316 RSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANR--------KAIVRRLPSVET 367

Query: 480 LGRIEYLLSDKTGTLTQNDMELKKL-HLGTVSYTMDTMDIVTDYVRAMSDNLNSSAVPSA 538
           LG +  + SDKTGTLT N M   K+  LG+                 M++  N  ++ + 
Sbjct: 368 LGSVNVICSDKTGTLTANHMTASKIWCLGS-----------------MANKNNVLSLEAK 410

Query: 539 SKKDLPGRVRDLVLTL-----------ALCHQVTPTFEDGELTYQAASPDEIAIVKFTES 587
           S   LPG++ +L   L           ++C+  + + E G+      +P +IA+++  + 
Sbjct: 411 SSGGLPGKLPNLKNYLSDDVKATLRIGSICNNASFSHEHGKYL---GNPTDIALLEVLQK 467

Query: 588 VGLTLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGI-----------VIFDKQ 636
             L              D+  T    D L    FNS  K M +           +I+ K 
Sbjct: 468 FDLV-------------DERPTTTRVDEL---TFNSKRKYMAVKVDSPANSGKHIIYVKG 511

Query: 637 KDEYWFLQKGADVVMSKIVQK-----NDWLEEETGNLAREGLRTLVIGRKRLSKKLLQTF 691
             E    +  + +  +  V+K        + +   +LA EGLRTL   +   S       
Sbjct: 512 AFERILERSASFIGGAGKVEKLSDSHKSLINDCAKSLASEGLRTLAFAQLECSTN----- 566

Query: 692 TKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKI 751
            K   D+++                   +L  +GL G++D  +  V+ +IE L   G+ +
Sbjct: 567 -KPMNDSTI------------------QNLTFVGLIGMKDPPRSTVRPAIEELLQGGVHV 607

Query: 752 WMLTGDKVETARCVSISAKLVSRGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGES 811
            M+TGD   TA  V+I+ ++         +  +N     LT   L ++          + 
Sbjct: 608 IMITGDAENTA--VNIARQI--------GIPVINPEISVLTGDRLDQMTD--------DQ 649

Query: 812 LGLYLEYYRQQFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMI 871
           L   +++         VN+ A    R TP+ K ++   +++  G  V   GDG ND   +
Sbjct: 650 LAGVIDH---------VNIFA----RATPEHKLNIVRALQK-RGDIVAMTGDGVNDAPAL 695

Query: 872 QSADVGVGIVGKEGKQASLAADFSIT 897
           + AD+GV +       A  A+D  +T
Sbjct: 696 KLADIGVAMGHMGTDVAKEASDMVLT 721

>Scas_707.48*
          Length = 741

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 158/680 (23%), Positives = 265/680 (38%), Gaps = 169/680 (24%)

Query: 248 SQLVPSKDLKVGDLIKIGKGARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPL 307
           S LVP      GDL+    G R PADL ++++ + S    I    L GE +   + A   
Sbjct: 167 SGLVP------GDLVHFKIGDRIPADLRIIEAVDLS----IDESNLTGENEPVHKSA--- 213

Query: 308 TQHLSQDDLLYRISITASVPEKSINNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAI 367
            + +++D    + +    + +++   ++G L                         G   
Sbjct: 214 -KEVNKDSFNDQPNSIIPISDRTCVAYMGTLV----------------------KEGHGK 250

Query: 368 ACVVYTGADTRQA----MNTSMSSVKTGLLELEINSLSKILCACVFILSVALVAFAGFNN 423
             VV  G +T       M +++   KT L +  ++ L K L    FI+ + L+   G   
Sbjct: 251 GIVVGIGKNTSFGAIFEMLSNIEKPKTPL-QNAMDKLGKDLSLFSFIV-IGLICLVGILQ 308

Query: 424 NDWYVDIMRYLILFSTI-----IPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPE 478
              ++++ +  +  +       +P+ + V L LG    A +        + IVR     E
Sbjct: 309 GRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKR--------KAIVRRLPSVE 360

Query: 479 DLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDTMDIVTDYVRAMSDNLNSSAVPSA 538
            LG +  + SDKTGTLT N M   K+      + +D+M          ++ L+     S 
Sbjct: 361 TLGSVNVICSDKTGTLTSNHMTASKI------WCLDSM-------ANKANVLSLEKSKSG 407

Query: 539 SKKD-LPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDEIAIVKFTESVGLTLFRRDR 597
           S K+ L   V+  +    +C+  + + E G+      +P +IA+++      L+ F    
Sbjct: 408 SLKNYLTEDVKSTLTIGNICNNASFSQEHGKYL---GNPTDIALLE-----QLSKF---- 455

Query: 598 HSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWFLQKGA-DVVMS---- 652
                  D S     +  +   PFNS  K M + I + +  +Y    KGA + V+S    
Sbjct: 456 -------DLSDIRPTFKKVQEIPFNSKRKFMAVKIVNSE-GKYSLCVKGAFEKVLSQCSH 507

Query: 653 ---------KIVQ-KNDWLEEETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMM 702
                    K+ Q + D + E   +LA EGLR L   +  L             D+  ++
Sbjct: 508 YLNQKGKTEKLTQGQRDVIIETANSLASEGLRMLAFAKTTLP------------DSPTLL 555

Query: 703 LNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETA 762
               V            DL   GL G+ D  +  VK +IE L   G+ I M+TGD   TA
Sbjct: 556 TEESV-----------GDLIFTGLIGMNDPPRPTVKPAIEQLLQGGVHIIMITGDSENTA 604

Query: 763 RCVSISAKLVSRGQYVHTVTKVNKP--EGALTHLELLKINTNSCLLIDGESLGLYLEYYR 820
                          V+   ++  P  +  L+ L   K+N                E   
Sbjct: 605 ---------------VNIARQIGIPVLDPKLSVLSGDKLN----------------EMSD 633

Query: 821 QQFFEIV--VNLPAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGV 878
            Q   ++  VN+ A    R TP+ K ++   +R+  G  V   GDG ND   ++ AD+GV
Sbjct: 634 DQLANVIDHVNIFA----RATPEHKLNIVRALRK-RGDVVAMTGDGVNDAPALKLADIGV 688

Query: 879 GIVGKEGKQ-ASLAADFSIT 897
            + G+ G   A  A+D  +T
Sbjct: 689 SM-GRMGTDVAKEASDMVLT 707

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
           Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 63.5 bits (153), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 165/708 (23%), Positives = 270/708 (38%), Gaps = 172/708 (24%)

Query: 221 SKEALDDIQRRRRDRESNNELYEVLSKSQLVPSKDLKVGDLIKIGKGARAPADLVLLQSS 280
           S EAL+ +         + +L  VL+ S LVP      GDL++   G R PADL +++S 
Sbjct: 136 SLEALNKLVPAECHLTRSGQLSHVLA-SNLVP------GDLVRFKVGDRIPADLRIVESI 188

Query: 281 EPSGEIFIKTDQLDGETDWKLRIACPLTQHLSQDDLLYRISITASVPEKSINNFLGKLTF 340
           +    + +    L GE +       P+  H S          + +V  K+ ++  G +  
Sbjct: 189 D----LCVDESNLTGENE-------PV--HKS----------SGAVDPKNYSHIPGSII- 224

Query: 341 GEIQSQPLSVDNTMWANTVFASAGTAIACVVYTGADTRQA----MNTSMSSVKTGLLELE 396
                 P+   N +         G     V+ TG  T       M + +   KT L +  
Sbjct: 225 ------PVGDRNCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPL-QTA 277

Query: 397 INSLSKILCACVFILSVALVAFAGFNNNDWY----VDIMRYLILFSTIIPVSLRVNLDLG 452
           ++ L + L    F+L   +          W     + +   +      +P+ + V L LG
Sbjct: 278 MDKLGQDLSYMSFVLIGIICLIGIIQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTLALG 337

Query: 453 KSVYAHQIEHDSTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKL-HLGTVSY 511
               A +        + IVR     E LG +  + SDKTGTLT N M + K+  LG+   
Sbjct: 338 VLRMAKR--------KAIVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLGS--- 386

Query: 512 TMDTMDIVTDYVRAMSDNLNSSAVPSASKKDLPGRVRDLVLTLAL---CHQVTPTFEDGE 568
                         M +  N  A+    ++ +    +D+  TL +   C+    T+    
Sbjct: 387 --------------MENKTNCLALSKVKERPIKME-QDVATTLRIGNICNN--GTYSQEH 429

Query: 569 LTYQAASPDEIAIVKFTESVGLTLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRM 628
           L Y   +P +IAI++  +  G+   R   + I  +                PFNS  K M
Sbjct: 430 LKY-LGNPTDIAILESLQHFGINDCRNSVNKINEI----------------PFNSKRKFM 472

Query: 629 GIVIFDKQKDEYWFLQKGADVVMSKIVQK----------------ND--WLEEETGNLAR 670
            +   D   D+     KGA     KIV+K                ND   + +    LA 
Sbjct: 473 AVKTIDAN-DKVVVYVKGA---FEKIVEKSINYIGRDGKVHKLKPNDKAIINDAAVALAS 528

Query: 671 EGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVE 730
           EGLRTL      +S         D E                 ++ +   L   GL  + 
Sbjct: 529 EGLRTLAFAELEVSAT-----HGDKE----------------FNEDMVEGLTFTGLIAMN 567

Query: 731 DKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQYVHTVTKVNKPEGA 790
           D  +  V+S+IE L    + + M+TGD   TA  VSI+ ++         +  +N PE +
Sbjct: 568 DPPRPTVRSAIEELLQGSVHVIMITGDAENTA--VSIARQI--------GIPVIN-PEYS 616

Query: 791 LTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVVNLPAVIACRCTPQQKADVATFI 850
           +   + L   T+       + L   +++         VN+ A    R TP+ K ++   +
Sbjct: 617 VLSGDKLDQMTD-------DQLASVIDH---------VNVFA----RATPEHKLNIVRAL 656

Query: 851 REVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQ-ASLAADFSIT 897
           ++  G  V   GDG ND   ++ AD+GV + GK G   A  A+D  +T
Sbjct: 657 QK-RGDIVAMTGDGVNDAPALKLADIGVSM-GKMGTDVAKEASDMVLT 702

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
           Ca2+-transporting P-type ATPase, member of the cation
           transporting (E1-E2) P-type ATPase superfamily,
           functions to pump Ca2+ into the vacuole [3522 bp, 1173
           aa]
          Length = 1173

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 87/370 (23%), Positives = 148/370 (40%), Gaps = 68/370 (18%)

Query: 603 LHDQSGTNFEYD-ILHVFPFNSDNKRMGIVIFDKQ----KDEYWFLQKGADVVMSKIV-- 655
           L DQ    F  + ++   PF S  K  G+V+  K+    K  Y F  KGA  ++SK    
Sbjct: 596 LRDQPMEKFNIEKVVQTIPFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAEIVSKNCSY 655

Query: 656 --QKNDWLEE-----------ETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMM 702
               +D LEE           E  NLA + LR + +  K   +         +    L  
Sbjct: 656 KRNSDDTLEEINEDNKKETDDEIKNLASDALRAISVAHKDFCE------CDSWPPEQL-- 707

Query: 703 LNREVTMSNVISKHL----EHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDK 758
             R+    N+ +  L    +  L + GL G++D L+  V+ S++  + AG+ + M+TGD 
Sbjct: 708 --RDKDSPNIAALDLLFNSQKGLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDN 765

Query: 759 VETARCVSISAKLVSRGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEY 818
           +       ++AK ++R   + +    ++   A+   E  K+  N  + I           
Sbjct: 766 I-------LTAKAIARNCAILSTDISSEAYSAMEGTEFRKLTKNERIRI----------- 807

Query: 819 YRQQFFEIVVNLPAV-IACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVG 877
                      LP + +  R +P+ K  +   ++ + G  V   GDG ND   ++ ADVG
Sbjct: 808 -----------LPNLRVLARSSPEDKRLLVETLKGM-GDVVAVTGDGTNDAPALKLADVG 855

Query: 878 --VGIVGKEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRSAKLAQFVIHRGLLISVCQ 935
             +GI G E  + +         F  +   + W GR       K  QF +   +   +  
Sbjct: 856 FSMGISGTEVAREASDIILMTDDFSAIVNAIKW-GRCVSVSIKKFIQFQLIVNITAVILT 914

Query: 936 AVYSISSKFE 945
            V S++S  E
Sbjct: 915 FVSSVASSDE 924

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 64/323 (19%), Positives = 129/323 (39%), Gaps = 36/323 (11%)

Query: 209 IVPLAFVLTVTMSKEALDDIQRRRRDRESNNELYEVLSKSQ--LVPSKDLKVGDLIKIGK 266
           ++ +  V+ V+ + +   ++Q  + +++  N    V+   Q  L+    + VGD+I +  
Sbjct: 161 MIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVIRNDQEILISIHHVLVGDVISLQT 220

Query: 267 GARAPADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLTQHLSQDDLLYRISITASV 326
           G   PAD V++     SG+       + GE++          Q    D+ L       S+
Sbjct: 221 GDVVPADCVMI-----SGKCEADESSITGESN--------TIQKFPVDNSLRDFKKFNSI 267

Query: 327 PEKSINNFLGKLTFGEIQSQPLSVDNTMW--ANTVFASAGTAIACVVYTGADTRQAMNTS 384
                +N    L  G++      + + M    + + +  G  +   V   +   Q M + 
Sbjct: 268 DS---HNHSKPLDIGDVNEDGNKIADCMLISGSRILSGLGRGVITSVGINSVYGQTMTSL 324

Query: 385 MSSVKTGLLELEINSLSKILC--ACVFILSVALVAF-----------AGFNNNDWYVDIM 431
            +  ++  L+L ++ L+  +    CV  + + LV F             F++ D      
Sbjct: 325 NAEPESTPLQLHLSQLADNISVYGCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGS 384

Query: 432 RYLILFST---IIPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPEDLGRIEYLLS 488
           +++ +F T   +I V++   L L  ++         T    +VR     E +G    + S
Sbjct: 385 KFMNIFITSITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCS 444

Query: 489 DKTGTLTQNDMELKKLHLGTVSY 511
           DKTGTLT+N M + +   G   +
Sbjct: 445 DKTGTLTENVMTVVRGFPGNSKF 467

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 129/549 (23%), Positives = 215/549 (39%), Gaps = 108/549 (19%)

Query: 364 GTAIACVVYTGADTRQAMNTSM---SSVKTGLLELEINSLSKILCACVFILSVALVAFAG 420
           G AIA V  TG +T Q     +   SS + G+   E       L   +F+L  A+VA   
Sbjct: 361 GGAIAIVTKTGFETSQGSLVRVMIYSSERVGVDNKEA------LYFILFLLIFAVVA--- 411

Query: 421 FNNNDWYV-------------DIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTIP 467
                WYV              I+  +++ ++++P  L + L +  +     +   S   
Sbjct: 412 ----SWYVWVEGTKMGRVQSKLILDCILIITSVVPPELPMELTMAVN---SSLSALSKFY 464

Query: 468 ETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDTMDIVTDYVRAMS 527
                   IP   GRI+    DKTGTLT  D+  +    G    + D  DI   ++ + +
Sbjct: 465 VYCTEPFRIPF-AGRIDVCCFDKTGTLTGEDLVFE----GLAGLSSDPKDI--RHLYSAT 517

Query: 528 DNLNSSAVPSASKKDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDEIAIVKFTES 587
           D  NS++                 L +   H +    EDGE+         +  +K+T  
Sbjct: 518 DCPNSTS-----------------LVVGAAHALV-RLEDGEIVGDPMEKATLKALKWTVE 559

Query: 588 VGLTLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWFLQKGA 647
            G  +F      +T             IL  F F+S  KR   V     K  Y  ++   
Sbjct: 560 KGDKVFNEKNGQVT-------------ILRRFQFSSALKRSSSVATHDGK-LYSAVKGAP 605

Query: 648 DVVMSKIVQKNDWLEEETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREV 707
           + +  ++       +E   +  R G R L +  K+L +K+ Q+     EDA     +RE 
Sbjct: 606 ETIRERLFTIPANYDEIYKSFTRSGSRVLALASKKL-EKMSQS---QIEDA-----DRE- 655

Query: 708 TMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSI 767
                   H E DLE  G       L+ D   +I++L  +  +  M+TGD   TA  V+ 
Sbjct: 656 --------HFERDLEFNGFLIFHCPLKHDAIETIQMLNESAHRCVMITGDNPLTAVHVAK 707

Query: 768 SAKLVSRGQ--YVHTVTKVNKPEGALTHLE--------LLKINTNSCLLIDGESL---GL 814
              +V +G+   V  V   N  +    ++E        + K +     + D   L   G 
Sbjct: 708 EVGIV-KGETLIVDMVDNGNDDKLVFRNVEETLSFEFVVSKDSFEKYGIFDKYDLAVTGH 766

Query: 815 YLEYYR--QQFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQ 872
            LE  +   Q  +++ +  A I  R +P QK  +   ++++  + + C GDG NDV  ++
Sbjct: 767 ALEALKGHHQLQDLIRH--AWIYARVSPAQKEFILNNLKDMGYQTLMC-GDGTNDVGALK 823

Query: 873 SADVGVGIV 881
            A VGV ++
Sbjct: 824 QAHVGVALL 832

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 123/548 (22%), Positives = 195/548 (35%), Gaps = 155/548 (28%)

Query: 355 WANTVFASA----GTAIACVVYTGADT---RQAMNTSMSSVKTGLLELEINSLSKILCAC 407
           + + VF+S+    G A   V  TG +T   R A     +S   G     +N +  IL   
Sbjct: 270 YGDEVFSSSTVKTGEAFMVVTATGDNTFVGRAAALVGQASGVEGHFTEVLNGIGIILLVL 329

Query: 408 VFILSVALVAFAGFNNNDWYVDIMRYLILFSTI-IPVSLRVNLDLGKSVYAHQIEHDSTI 466
           V I ++ LV  A F      V I+RY +  + I +PV L   +    +V A  +      
Sbjct: 330 V-IATLLLVWTACFYRTVGIVSILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKK--- 385

Query: 467 PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDTMDIVTDYVRAM 526
            + IV+  +  E L  +E L SDKTGTLT+N + L +       YT++ +          
Sbjct: 386 -QAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHE------PYTVEGVS--------- 429

Query: 527 SDNLNSSAVPSASKKDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDEIAIVKFTE 586
            D+L  +A  +AS+K       D     +L     P  +D    Y+              
Sbjct: 430 PDDLMLTACLAASRKKKGLDAIDKAFLKSLIEY--PKAKDALTKYK-------------- 473

Query: 587 SVGLTLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWFLQKG 646
                                       +L   PF+  +K++  V+ +  + E     KG
Sbjct: 474 ----------------------------VLEFHPFDPVSKKVTAVV-ESPEGERIVCVKG 504

Query: 647 ADVVMSKIVQKNDWL--------EEETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDA 698
           A + + K V+++  +        E +   LA  G R L + RKR                
Sbjct: 505 APLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALGVARKR---------------- 548

Query: 699 SLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDK 758
                              E   EILG+    D  ++D   +I   RN G++I MLTGD 
Sbjct: 549 ------------------GEGHWEILGVMPCMDPPRDDTAQTINEARNLGLRIKMLTGDA 590

Query: 759 V----ETARCVSISAKLVSRGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGESLGL 814
           V    ET R + +   + +  + +      + P                     G  L  
Sbjct: 591 VGIAKETCRQLGLGTNIYN-AERLGLGGGGDMP---------------------GSELAD 628

Query: 815 YLEYYRQQFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSA 874
           ++E     F E+             PQ K  V   ++   G  V   GDG ND   ++ A
Sbjct: 629 FVE-NADGFAEVF------------PQHKYRVVEILQN-RGYLVAMTGDGVNDAPSLKKA 674

Query: 875 DVGVGIVG 882
           D G+ + G
Sbjct: 675 DTGIAVEG 682

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 118/552 (21%), Positives = 208/552 (37%), Gaps = 140/552 (25%)

Query: 343 IQSQPLSVDNTMWANTVFASA----GTAIACVVYTGADT---RQAMNTSMSSVKTGLLEL 395
           I  + L+VD   + +  F+S+    G     V  TG +T   R A   + ++   G    
Sbjct: 230 ITGESLAVDK-HYGDQTFSSSTVKRGEGFMVVTATGDNTFVGRAAALVNKAAGGQGHFTE 288

Query: 396 EINSLSKILCACVFILSVALVAFAGFNNNDWYVDIMRYLILFSTI-IPVSLRVNLDLGKS 454
            +N +  IL   V I ++ LV  A F   +  V I+RY +  + I +PV L   +    +
Sbjct: 289 VLNGIGIILLVLV-IATLLLVWTACFYRTNGIVRILRYTLGITIIGVPVGLPAVVTTTMA 347

Query: 455 VYAHQIEHDSTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMD 514
           V A  +       + IV+  +  E L  +E L SDKTGTLT+N + L +       YT++
Sbjct: 348 VGAAYLAKK----QAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHE------PYTVE 397

Query: 515 TMDIVTDYVRAMSDNLNSSAVPSASKKDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAA 574
            +           D+L  +A  +AS+K                              +  
Sbjct: 398 GVS---------PDDLMLTACLAASRKK-----------------------------KGL 419

Query: 575 SPDEIAIVKFTESVGLTLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFD 634
              + A +K      L  + + + ++T          +Y +L   PF+  +K++  V+ +
Sbjct: 420 DAIDKAFLK-----SLKQYPKAKDALT----------KYKVLEFHPFDPVSKKVTAVV-E 463

Query: 635 KQKDEYWFLQKGADVVMSKIVQKNDWLEEETGNLAREGLRTLVIGRKRLSKKLLQTFTKD 694
             + E     KGA + + K V+++  + E+                            ++
Sbjct: 464 SPEGERIVCVKGAPLFVLKTVEEDHPIPEDV--------------------------HEN 497

Query: 695 YEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWML 754
           YE+    + +R      V  K  E   EILG+    D  ++D   ++   R+ G+++ ML
Sbjct: 498 YENKVAELASRGFRALGVARKRGEGHWEILGVMPCMDPPRDDTAQTVSEARHLGLRVKML 557

Query: 755 TGDKV----ETARCVSISAKLVSRGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGE 810
           TGD V    ET R + +   + +  + +      + P                     G 
Sbjct: 558 TGDAVGIAKETCRQLGLGTNIYN-AERLGLGGGGDMP---------------------GS 595

Query: 811 SLGLYLEYYRQQFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSM 870
            L  ++E     F E+             PQ K  V   ++   G  V   GDG ND   
Sbjct: 596 ELADFVE-NADGFAEVF------------PQHKYRVVEILQN-RGYLVAMTGDGVNDAPS 641

Query: 871 IQSADVGVGIVG 882
           ++ AD G+ + G
Sbjct: 642 LKKADTGIAVEG 653

>Scas_688.1
          Length = 913

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 102/466 (21%), Positives = 174/466 (37%), Gaps = 125/466 (26%)

Query: 419 AGFNNNDWYVDIMRYLILFSTI-IPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIP 477
           A F   D  V I+RY +  + + +PV L   +    +V A  +       + IV+  +  
Sbjct: 306 ASFYRTDGIVRILRYTLGITIVGVPVGLPAVVTTTMAVGAAYLAKK----QAIVQKLSAI 361

Query: 478 EDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDTMDIVTDYVRAMSDNLNSSAVPS 537
           E L  +E L SDKTGTLT+N + L +       YT++ +          +D+L  +A  +
Sbjct: 362 ESLAGVEILCSDKTGTLTKNKLSLHE------PYTVEGVS---------ADDLMLTACLA 406

Query: 538 ASKKDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDEIAIVKFTESVGLTLFRRDR 597
           AS+K       D     +L              Y AA                      +
Sbjct: 407 ASRKKKGLDAIDKAFLKSLAQ------------YPAA----------------------K 432

Query: 598 HSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWFLQKGADVVMSKIVQK 657
           +++T          +Y +L   PF+  +K++  V+ +  + E     KGA + + K V++
Sbjct: 433 NALT----------KYKVLEFHPFDPVSKKVTAVV-ESPEGERIICVKGAPLFVLKTVEE 481

Query: 658 NDWLEEETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHL 717
           +  + E+                            ++YE+    + +R      V  K  
Sbjct: 482 DHPIPED--------------------------IHENYENKVAELASRGFRALGVARKRG 515

Query: 718 EHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQY 777
           E   EILG+    D  ++D   ++   R  G+++ MLTGD V  A+    + + +  G  
Sbjct: 516 EGHWEILGVMPCMDPPRDDTGETVAEARRLGLRVKMLTGDAVGIAKE---TCRQLGLGTN 572

Query: 778 VHTVTKVNKPEGA-LTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVVNLPAVIAC 836
           V+   ++    G  +   EL     N+    DG             F E+          
Sbjct: 573 VYNAERLGLSGGGDMPGSELADFVENA----DG-------------FAEVF--------- 606

Query: 837 RCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVG 882
              PQ K  V   I +  G  V   GDG ND   ++ AD G+ + G
Sbjct: 607 ---PQDKYRVVE-ILQTRGYLVAMTGDGVNDAPSLKKADTGIAVEG 648

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 95/460 (20%), Positives = 171/460 (37%), Gaps = 131/460 (28%)

Query: 428 VDIMRYLILFSTI-IPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPEDLGRIEYL 486
           V I+RY +  + + +PV L   +    +V A  +       + IV+  +  E L  +E L
Sbjct: 301 VTILRYTLAITVVGVPVGLPAVVTTTMAVGAAYLAKK----KAIVQKLSAIESLAGVEIL 356

Query: 487 LSDKTGTLTQNDMELKKLHLGTVSYTMDTMDIVTDYVRAMSDNLNSSAVPSASKKDLPGR 546
            SDKTGTLT+N + L +       YT++ ++         +D+L  +A  +AS+K     
Sbjct: 357 CSDKTGTLTKNKLSLHE------PYTVEGVE---------ADDLMLTACLAASRKKKGLD 401

Query: 547 VRDLVLTLALCHQVTPTFEDGELTYQAASPDEIAIVKFTESVGLTLFRRDRHSITLLHDQ 606
             D     +L +                                  + R + ++T     
Sbjct: 402 AIDKAFLKSLIN----------------------------------YPRAKAALT----- 422

Query: 607 SGTNFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWFLQKGADVVMSKIVQKNDWLEEETG 666
                +Y +L   PF+  +K++   I +  + E     KGA + + K V++N  + E+  
Sbjct: 423 -----KYKVLEFHPFDPVSKKV-TAIVESPEGERIVCVKGAPLFVLKTVEENHLIPEDV- 475

Query: 667 NLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGL 726
                                     ++YE+    + +R      V  K  E   EILG+
Sbjct: 476 -------------------------KENYENKVAELASRGYRALGVARKRGEGHWEILGV 510

Query: 727 TGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKV----ETARCVSISAKLVSRGQYVHTVT 782
               D  ++D   ++   R+ G+++ MLTGD V    ET R + +   + +  + +    
Sbjct: 511 MPCMDPPRDDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLGLGTNIYN-AERLGLGG 569

Query: 783 KVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVVNLPAVIACRCTPQQ 842
             + P                     G  L  ++E     F E+             PQ 
Sbjct: 570 GGDMP---------------------GSELADFVE-NADGFAEVF------------PQH 595

Query: 843 KADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVG 882
           K +V   +++  G  V   GDG ND   ++ AD G+ + G
Sbjct: 596 KYNVVEILQQ-RGYLVAMTGDGVNDAPSLKKADTGIAVEG 634

>Kwal_47.17522
          Length = 899

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 99/469 (21%), Positives = 175/469 (37%), Gaps = 131/469 (27%)

Query: 419 AGFNNNDWYVDIMRYLILFSTI-IPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIP 477
           A F   D  V I+RY +  + I +PV L   +    +V A  +       + IV+  +  
Sbjct: 292 ACFYRTDRIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKK----QAIVQKLSAI 347

Query: 478 EDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDTMDIVTDYVRAMSDNLNSSAVPS 537
           E L  +E L SDKTGTLT+N + L +       YT++ ++          D+L  +A  +
Sbjct: 348 ESLAGVEILCSDKTGTLTKNKLSLHE------PYTVEGVE---------PDDLMLTACLA 392

Query: 538 ASKKDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDEIAIVKFTESVGLTLFRRDR 597
           AS+K                              +     + A +K      L  + R +
Sbjct: 393 ASRKK-----------------------------KGLDAIDKAFLK-----SLIQYPRAK 418

Query: 598 HSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWFLQKGADVVMSKIVQK 657
           +++T          +Y +L   PF+  +K++  V+ +  + E     KGA + + K V++
Sbjct: 419 NALT----------KYKVLDFHPFDPVSKKVTAVV-ESPEGERIICVKGAPLFVLKTVEE 467

Query: 658 NDWLEEETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHL 717
           +  + E+                            ++YE+    + +R      V  K  
Sbjct: 468 DHPIPEDV--------------------------HENYENKVAELASRGFRALGVARKRG 501

Query: 718 EHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKV----ETARCVSISAKLVS 773
           E   EILG+    D  ++D   ++   R  G+++ MLTGD V    ET R + +   + +
Sbjct: 502 EGHWEILGVMPCMDPPRDDTAQTVHEARRLGLRVKMLTGDAVGIAKETCRQLGLGTNIYN 561

Query: 774 RGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVVNLPAV 833
             + +      + P                     G  L  ++E     F E+       
Sbjct: 562 -AERLGLGGGGDMP---------------------GSELADFVE-NADGFAEVF------ 592

Query: 834 IACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVG 882
                 PQ K  V   +++  G  V   GDG ND   ++ AD G+ + G
Sbjct: 593 ------PQHKYSVVEILQQ-RGYLVAMTGDGVNDAPSLKKADTGIAVEG 634

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 100/469 (21%), Positives = 175/469 (37%), Gaps = 131/469 (27%)

Query: 419 AGFNNNDWYVDIMRYLILFSTI-IPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIP 477
           A F   +  V I+RY +  + + +PV L   +    +V A  +       + IV+  +  
Sbjct: 292 ASFYRTNKIVRILRYTLAITIVGVPVGLPAVVTTTMAVGAAYLAKK----QAIVQKLSAI 347

Query: 478 EDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDTMDIVTDYVRAMSDNLNSSAVPS 537
           E L  +E L SDKTGTLT+N + L +       YT++ +D          D+L  +A  +
Sbjct: 348 ESLAGVEILCSDKTGTLTKNKLSLHE------PYTVEGVD---------PDDLMLTACLA 392

Query: 538 ASKKDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDEIAIVKFTESVGLTLFRRDR 597
           AS+K                              +     + A +K      L  + R +
Sbjct: 393 ASRKK-----------------------------KGLDAIDKAFLK-----SLISYPRAK 418

Query: 598 HSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWFLQKGADVVMSKIVQK 657
            ++T          +Y +L   PF+  +K++   I +  + E     KGA + + K V++
Sbjct: 419 AALT----------KYKLLEFHPFDPVSKKV-TAIVESPEGERIICVKGAPLFVLKTVEE 467

Query: 658 NDWLEEETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHL 717
              + E+     RE                      +YE+    + +R      V  K  
Sbjct: 468 EHPIPEDV----RE----------------------NYENKVAELASRGFRALGVARKRG 501

Query: 718 EHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKV----ETARCVSISAKLVS 773
           E   EILG+    D  ++D   ++   R+ G+++ MLTGD V    ET R + +   + +
Sbjct: 502 EGHWEILGVMPCMDPPRDDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLGLGTNIYN 561

Query: 774 RGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVVNLPAV 833
             + +      + P                     G  L  ++E     F E+       
Sbjct: 562 -AERLGLGGGGDMP---------------------GSELADFVE-NADGFAEVF------ 592

Query: 834 IACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVG 882
                 PQ K +V   +++  G  V   GDG ND   ++ AD G+ + G
Sbjct: 593 ------PQHKYNVVEILQQ-RGYLVAMTGDGVNDAPSLKKADTGIAVEG 634

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 65/284 (22%), Positives = 116/284 (40%), Gaps = 42/284 (14%)

Query: 615 ILHVFPFNSDNKRMG-IVIFDKQKDEYWFLQKGADVVMSKIVQKNDWLEEETGNLAREGL 673
           IL  F F+S  KR   I + +KQ   Y  ++   + +  ++ Q     ++   +  R G 
Sbjct: 577 ILRRFQFSSALKRSSTIAVHNKQ--HYSAVKGAPETIRERLSQVPTDYDQVYKSFTRAGS 634

Query: 674 RTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKL 733
           R L +  K+L    ++   K         L RE          +E DLE  G       L
Sbjct: 635 RVLALASKKLPSMSIKQIEK---------LEREA---------VESDLEFKGFLVFHCPL 676

Query: 734 QEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQYV---------HTV--- 781
           ++D   +I++L  +  +  M+TGD   TA  V+    +V R   +         H +   
Sbjct: 677 KDDAIETIKMLNESSHRCIMITGDNPLTAVHVAKEVAIVERETLILDEPIDGSSHALVFR 736

Query: 782 ----TKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVVNLPAVIACR 837
               T VN         E  K+     + + G +L L   +   Q  E++ +    +  R
Sbjct: 737 NIEETIVNPFNPEKDTFEHSKLFAKYDIAVTGHALQLLSGH--SQLNELIRH--TWVYAR 792

Query: 838 CTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIV 881
            +P QK  +   ++++  + + C GDG NDV  ++ A VG+ ++
Sbjct: 793 VSPAQKEFIMNSLKDMGYQTLMC-GDGTNDVGALKQAHVGIALL 835

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative
           Ca2+-transporting ATPase, member of the P-type ATPase
           superfamily of membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 123/561 (21%), Positives = 217/561 (38%), Gaps = 132/561 (23%)

Query: 364 GTAIACVVYTGADTRQAMNTSMSSVKTGLLELEINSL--SKILCACVFILSVALVAFAGF 421
           G A+A V  TG +T Q      S V+  +   E  S+   + L   +F+L  A++A    
Sbjct: 363 GGALAIVTKTGFETSQG-----SLVRVMIYSAERVSVDNKEALMFILFLLIFAVIA---- 413

Query: 422 NNNDWYV-------------DIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTIPE 468
               WYV              I+  +++ ++++P  L + L +  +     +        
Sbjct: 414 ---SWYVWVEGTKMGRIQSKLILDCILIITSVVPPELPMELTMAVNSSLAALAKFYVYCT 470

Query: 469 TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDTMDIVTDYVRAMSD 528
              R   IP   GRI+    DKTGTLT  D+  +    G    + D+ +I   Y      
Sbjct: 471 EPFR---IPF-AGRIDVCCFDKTGTLTGEDLVFE----GLAGISADSENIRHLY------ 516

Query: 529 NLNSSAVPSASKKDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDEIAIVKFTESV 588
             +++  P ++           +L +   H +    EDG++      P E A +K   +V
Sbjct: 517 --SAAEAPEST-----------ILVIGAAHALV-KLEDGDIV---GDPMEKATLK---AV 556

Query: 589 GLTLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWFLQKGA- 647
           G  + R++ +       + GT  + DI+  F F+S  KR   +      D  +   KGA 
Sbjct: 557 GWAVERKNSNY------REGTG-KLDIIRRFQFSSALKRSASIA--SHNDALFAAVKGAP 607

Query: 648 DVVMSKIVQKNDWLEEETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREV 707
           + +  ++       +E   +  R G R L +  K L  K+ Q+   D        LNR+ 
Sbjct: 608 ETIRERLSDIPKNYDEIYKSFTRSGSRVLALASKSLP-KMSQSKIDD--------LNRD- 657

Query: 708 TMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSI 767
                    +E +L   G       L++D   +I++L  +  +  M+TGD   TA     
Sbjct: 658 --------DVESELTFNGFLIFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTA----- 704

Query: 768 SAKLVSRGQYVHTVTKVNKPEGALTHLELL-KINTNSCLLID-GESLGLYLEYYRQQF-- 823
                     VH   +V    G    L+   K + N  L  D  E++ +  +  +  F  
Sbjct: 705 ----------VHVAKEVGIVFGETLILDRAGKSDDNQLLFRDVEETVSIPFDPSKDTFDH 754

Query: 824 ------FEIVVNLPAVIA-----------------CRCTPQQKADVATFIREVTGKRVCC 860
                 ++I V   A+ A                  R +P QK  +   ++++  + + C
Sbjct: 755 SKLFDRYDIAVTGYALNALEGHSQLRDLLRHTWVYARVSPSQKEFLLNTLKDMGYQTLMC 814

Query: 861 IGDGGNDVSMIQSADVGVGIV 881
            GDG NDV  ++ A VG+ ++
Sbjct: 815 -GDGTNDVGALKQAHVGIALL 834

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 99/477 (20%), Positives = 167/477 (35%), Gaps = 147/477 (30%)

Query: 419 AGFNNNDWYVDIMRYLILFSTI-IPVSLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIP 477
           A F   D  V I+R+ +  + I +PV L   +    +V A  +       + IV+  +  
Sbjct: 295 ACFYRTDNIVKILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKK----QAIVQKLSAI 350

Query: 478 EDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDTMDIVTDYVRAMSDNLNSSAVPS 537
           E L  +E L SDKTGTLT+N + L +       YT++ +          +D+L  +A  +
Sbjct: 351 ESLAGVEILCSDKTGTLTKNKLSLHE------PYTVEGVS---------ADDLMLTACLA 395

Query: 538 ASKKDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDEIAIVKFTESVGLTLFRRDR 597
           AS+K       D     +L +   P  +D    Y+                         
Sbjct: 396 ASRKKKGLDAIDKAFLKSLINY--PKAKDALTKYK------------------------- 428

Query: 598 HSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWFLQKGADVVMSKIVQK 657
                            ++   PF+  +K++  V+ +  + E     KGA + + K V++
Sbjct: 429 -----------------VIEFHPFDPVSKKVTAVV-ESPEGERIVCVKGAPLFVLKTVEE 470

Query: 658 NDWL--------EEETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTM 709
           +  +        E +   LA  G R L + RKR                           
Sbjct: 471 DHPIPEDVHENYENKVAELASRGFRALGVARKR--------------------------- 503

Query: 710 SNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKV----ETARCV 765
                   E   EILG+    D  ++D   ++   R  G+++ MLTGD V    ET R +
Sbjct: 504 -------GEGHWEILGVMPCMDPPRDDTAETVNEARRLGLRVKMLTGDAVGIAKETCRQL 556

Query: 766 SISAKLVSRGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFE 825
            +   + +  + +      + P                     G  L  ++E     F E
Sbjct: 557 GLGTNIYN-AERLGLGGGGDMP---------------------GSELADFVE-NADGFAE 593

Query: 826 IVVNLPAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVG 882
           +             PQ K  V   ++   G  V   GDG ND   ++ AD G+ + G
Sbjct: 594 VF------------PQHKYKVVEILQN-RGYLVAMTGDGVNDAPSLKKADTGIAVEG 637

>Scas_583.14*
          Length = 875

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 102/432 (23%), Positives = 176/432 (40%), Gaps = 87/432 (20%)

Query: 481 GRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDTMDIVTDYVRAMSDNLNSSAVPSASK 540
           GRI+    DKTGTLT  D+  + L  G    + D        VR +  + ++S       
Sbjct: 133 GRIDVCCFDKTGTLTGEDLVFEGLA-GLSDKSED--------VRHLFSSEDAS------- 176

Query: 541 KDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDEIAIVKFTESVGLTLFRRDRHSI 600
                  ++ +L +   H +    +DGE+      P E A +K   ++G  +   D  S 
Sbjct: 177 -------QETILVVGAAHALV-KLDDGEIV---GDPMEKATLK---ALGWKVEGNDFTS- 221

Query: 601 TLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWFLQKGADVVMSK---IVQK 657
                ++G   +  IL  F F+S  KR   V     KD+ +   KGA   + +   +V K
Sbjct: 222 ---RPKTG---KLQILRRFQFSSALKRSSSVA--SHKDKLFTAVKGAPETIRERLAVVPK 273

Query: 658 NDWLEEETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHL 717
           N   +E   +  R G R L +     SK L    +K  +D     L+R+          +
Sbjct: 274 N--YDEIYKSFTRSGSRVLALA----SKSLPNLSSKQLDD-----LDRD---------EI 313

Query: 718 EHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQY 777
           E  L   G       L+ D   +I++L  +  +  M+TGD   TA  V+    +V+ G+ 
Sbjct: 314 ETGLTFNGFLVFHCPLKPDAVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAIVT-GET 372

Query: 778 VHTVTKVNKPEGALTHL---ELLKINTNSC--------------LLIDGESLGLYLEYYR 820
           +         +G L      E +KI  +                + + G +L L  ++  
Sbjct: 373 LILDKSETVGDGKLLFFNVEETIKIPFDPASDKFDHRELFDKYDIAVTGYALNLLEDH-- 430

Query: 821 QQFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGI 880
            Q  +++ +    +  R +P QK  +   ++E+  + + C GDG NDV  ++ A VGV +
Sbjct: 431 SQLKDLIRH--TWVYARVSPSQKEFILNNLKEMGYQTLMC-GDGTNDVGALKQAHVGVAL 487

Query: 881 VGKEGKQASLAA 892
           +   G + S+ A
Sbjct: 488 L--NGTEESMTA 497

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 123/561 (21%), Positives = 214/561 (38%), Gaps = 117/561 (20%)

Query: 364 GTAIACVVYTGADTRQAMNTSMSSVKTGLLELEINSLS--KILCACVFILSVALVAFAGF 421
           G A+A V  TG +T Q      S V+  +   E   +   + L   +F+L  A+VA    
Sbjct: 362 GGALAVVTKTGFETSQG-----SLVRVMIFSAERVDVGNKEALYFILFLLIFAIVA---- 412

Query: 422 NNNDWYV-------------DIMRYLILFSTIIPVSLRVNLDLGKSVYAHQIEHDSTIPE 468
               WYV              I+  +++ ++++P  L + L +  +     +   S    
Sbjct: 413 ---SWYVWKEGTRMGRIQSKLILDCILIITSVVPPELPMELTMAVN---SSLAALSKFYV 466

Query: 469 TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVSYTMDTMDIVTDYVRAMSD 528
                  IP   GRI+    DKTGTLT  D+  + L     +   D  DI T      S 
Sbjct: 467 YCTEPFRIPY-AGRIDVCCFDKTGTLTAEDLVFEGL-----AGLHDGSDIRT----LKSA 516

Query: 529 NLNSSAVPSASKKDLPGRVRDLVLTLALCHQVTPTFEDGELTYQAASPDEIAIVKFTESV 588
           N  S  V SA               +   H +    +DGE+      P E A +K   + 
Sbjct: 517 NDASQEVLSA---------------IGAAHALV-KLDDGEIV---GDPMEKATLK---AS 554

Query: 589 GLTLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDNKRMGIVIFDKQKDEYWFLQKGA- 647
             T+  +D      +  ++G +    IL  F F+S  KR   +    Q + ++   KGA 
Sbjct: 555 SWTVDFKD------VVKRAGAD-NIRILRRFQFSSSLKRSASIA--SQSNRFFAAVKGAP 605

Query: 648 DVVMSKIVQKNDWLEEETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREV 707
           + +  ++       ++   +  R G R L +  K L K                M N ++
Sbjct: 606 ETIRERLNSVPSDYDDIYKSFTRSGSRVLALAYKDLPK----------------MSNSQI 649

Query: 708 TMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSI 767
              N+    +E  L           L++D   +I++L  +  +  M+TGD   TA  V+ 
Sbjct: 650 --DNIDRDEIETGLTFGAFLVFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAK 707

Query: 768 SAKLVSRGQYV------------------HTVTKVNKPEGALTHLELLKINTNSCLLIDG 809
              +V R   +                   T+ K   P+      +  +I     L + G
Sbjct: 708 EVGIVDRETLILDEPIDGSSHALVMRDVNETIVKPFNPDA--DTFDEKEIFQKYDLAVTG 765

Query: 810 ESLGLYLEYYRQQFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVS 869
            +L L   +  +Q  +++ +    I  R +P QK  +   ++++  + + C GDG NDV 
Sbjct: 766 HALKLLQGH--KQLRDVIRH--TWIYARVSPSQKEFILITLKDMGYQTLMC-GDGTNDVG 820

Query: 870 MIQSADVGVGIVGKEGKQASL 890
            ++ A VG+ ++   G + SL
Sbjct: 821 ALKQAHVGIALL--NGTEDSL 839

>Scas_710.41
          Length = 904

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 62/279 (22%), Positives = 101/279 (36%), Gaps = 75/279 (26%)

Query: 612 EYDILHVFPFNSDNKRMGIVIFDKQKDEYWFLQKGADVVMSKIVQKN--------DWLEE 663
           +Y IL   PF+  +K++  V+    + E     KGA + + K V+++        +  E 
Sbjct: 429 KYKILEFHPFDPVSKKVTAVV-KSPEGETITCVKGAPLFVLKTVEEDHPVPEDVHENYEN 487

Query: 664 ETGNLAREGLRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHDLEI 723
           +   LA  G R+L + RKR                                   E   EI
Sbjct: 488 KVAELASRGFRSLGVARKRG----------------------------------EGYWEI 513

Query: 724 LGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQYVHTVTK 783
           LG+    D  ++D   +I   R  G+++ MLTGD V  A+  S   + +  G  ++   K
Sbjct: 514 LGVMPCMDPPRDDTARTIAEARTLGLRVKMLTGDAVGIAKETS---RQLGLGVNIYNAEK 570

Query: 784 VNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVVNLPAVIACRCTPQQK 843
           +                      + G  L  ++E     F E+             PQ K
Sbjct: 571 L---------------GLGGGGDMPGSELADFVE-NADGFAEVF------------PQHK 602

Query: 844 ADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVG 882
             V   ++   G  V   GDG ND   ++ AD G+ + G
Sbjct: 603 YKVVEILQN-RGYLVAMTGDGVNDAPSLKKADTGIAVEG 640

 Score = 37.4 bits (85), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 83/180 (46%), Gaps = 15/180 (8%)

Query: 332 NNFLGKLTFGEIQSQPLSVDNTMWANTVFASA----GTAIACVVYTGADT---RQAMNTS 384
           N FL ++    I  + L+VD   + +  F+S+    GT++  V  TG +T   R A    
Sbjct: 207 NRFL-QVDQSAITGESLAVDKN-YGDVTFSSSTVKTGTSVMVVTATGDNTFVGRAAALVG 264

Query: 385 MSSVKTGLLELEINSLSKILCACVFILSVALVAFAGFNNNDWYVDIMRYLILFSTI-IPV 443
            +S   G     +N +  IL   V I  + +   A F   D  V I+R+ +  + I +PV
Sbjct: 265 EASGGQGHFTDILNDIGTILLVLVIITLLLVWT-ACFYRTDGIVMILRFTLGITIIGVPV 323

Query: 444 SLRVNLDLGKSVYAHQIEHDSTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKK 503
            L   +    +V A  +       + IV+  +  E L  +E L SDKTGTLT+N + L +
Sbjct: 324 GLPAVVTTTMAVGAAYLAKK----QAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHE 379

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 45/90 (50%), Gaps = 15/90 (16%)

Query: 673 LRTLVIGRKRLSKKLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDK 732
           + T+ IG K+L           + D SL     ++  S +   ++  D  ++G   + D+
Sbjct: 706 IHTITIGNKKL-----------FPDESL----SDIASSTLTESYVSIDGSLVGKFEISDR 750

Query: 733 LQEDVKSSIELLRNAGIKIWMLTGDKVETA 762
           ++ED    +E L+N GIK  M+TGD  ++A
Sbjct: 751 VKEDAHFVVEYLQNLGIKCCMVTGDAHQSA 780

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score = 37.7 bits (86), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 840  PQQKADVATFIREVTGKRVCC--IGDGGNDVSMIQSADVGVGIVGKEGKQASLAADF 894
            P+ KA+   +IRE +G+ V    +GDG ND   I +ADVG+ +       A ++ DF
Sbjct: 1067 PEGKAEKIQWIRETSGQGVAIAMVGDGMNDAPAIAAADVGISLASGS-DLAMISCDF 1122

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 34/71 (47%), Gaps = 7/71 (9%)

Query: 728  GVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRGQYVHTVTKVNKP 787
             V D+L+ + K  ++ L   GI+ WM++GD    A  V++   +       H +  V  P
Sbjct: 1015 AVRDELRPEAKEVVQALHERGIECWMISGDNSLAANAVALEVGI------KHVIADV-LP 1067

Query: 788  EGALTHLELLK 798
            EG    ++ ++
Sbjct: 1068 EGKAEKIQWIR 1078

>Scas_227.0d
          Length = 307

 Score = 36.6 bits (83), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 51/114 (44%), Gaps = 17/114 (14%)

Query: 585 TESVGLTLFRRDRH----SITLLHDQSGTNFEY-DILHVFPFNSDNKRMGIVIFDKQKDE 639
           TE+  LTL ++  +    S+  L +     FE  +I  + PF S  K  GI++  K+ + 
Sbjct: 150 TETALLTLAKKSMNLRFGSLRALRENPVDRFEVSEIAQIIPFESTRKWGGIIVKYKESNL 209

Query: 640 YWFLQKGADVVMSK------------IVQKNDWLEEETGNLAREGLRTLVIGRK 681
           Y F  KGA  ++S             +    D + +E  NLA + LR L +  +
Sbjct: 210 YRFFIKGAAEIVSNNCHSKRNSDDSIVTLNKDQINKEIENLANDALRALSLAHR 263

>KLLA0D04092g complement(344666..348124) some similarities with
           sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
           copper-transporting ATPase P16.2.f2.1, hypothetical
           start
          Length = 1152

 Score = 37.4 bits (85), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 27/41 (65%)

Query: 726 LTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVS 766
           +   +D+++ + K  I+ LR +GI+ WM++GD   TAR V+
Sbjct: 924 MCAAKDEIRPEAKDVIKELRRSGIECWMISGDNEVTARAVA 964

>Scas_297.1
          Length = 800

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 41/192 (21%), Positives = 75/192 (39%), Gaps = 32/192 (16%)

Query: 756 GDKVETARCVSISAKLVSRGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGESLGLY 815
           GD + TAR ++ +  ++S   Y+     +  P+                          +
Sbjct: 1   GDNILTARAIARNCNILSEETYLIPECAIEGPK--------------------------F 34

Query: 816 LEYYRQQFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSAD 875
               +Q+  +++ NL   +  R +P+ K  +   ++ + G  V   GDG ND   ++ AD
Sbjct: 35  RTLTKQERIKMLPNL--RVMARSSPEDKRLLVETLKGM-GDVVAVTGDGTNDAPALKLAD 91

Query: 876 VG--VGIVGKEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRSAKLAQFVIHRGLLISV 933
           VG  +GI G E  + +         F  +   + W GR       K  QF +   +   +
Sbjct: 92  VGFSMGISGTEVAREASDIILMTDDFAAIVDAIKW-GRCVSISIKKFIQFQLIVNITAVI 150

Query: 934 CQAVYSISSKFE 945
              V SI+S+ E
Sbjct: 151 LAFVSSIASEDE 162

>Scas_678.19
          Length = 298

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 2/45 (4%)

Query: 977  DESLTKTYPELYKELTAGKSLSYKTFFVWV--VLSLFQGCVIQGL 1019
            D  L KT  E+YKE   GK++S+ T F+ +  +L    G  ++GL
Sbjct: 43   DAKLKKTLAEMYKEENVGKTISFNTMFIEINKILGDVYGYELKGL 87

>Scas_569.0d
          Length = 468

 Score = 33.9 bits (76), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 54/210 (25%), Positives = 91/210 (43%), Gaps = 33/210 (15%)

Query: 830  LPAVIACRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGIVGKEGKQAS 889
            LP VIA RC+PQ K  +   +     K     GDG ND   ++ A+VG+ +       A 
Sbjct: 101  LPLVIA-RCSPQTKVRMIEALHR-RDKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVAK 158

Query: 890  LAADFSITQFCHLSKL-LLWHGRNSYKRSAKLAQFVIHRGLLISVCQAVYSISS-KFE-- 945
             A+D  ++     S L  +  GR   + S  + +FV+   L  +V QA+Y I    F+  
Sbjct: 159  DASDIVLSDDNFASILNAIEEGR---RMSDNIQKFVLQL-LAENVAQALYLICGLAFQDK 214

Query: 946  ------PIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKTYPELYKELTAGKSLSY 999
                  P+A  +   ++   +C+   P   L L+        K  P+L   +    + S 
Sbjct: 215  EGKSVFPLAPVEVLWIIVVTSCF---PAMGLGLE--------KAAPDL---MDRPPNDSK 260

Query: 1000 KTFFVW-VVLSLF-QGCVIQGLSQG-FTSL 1026
               F W +++ +F  G ++ G   G FT++
Sbjct: 261  SGIFTWEIIVDMFVYGIIMAGCCMGSFTTV 290

>Kwal_26.7055
          Length = 1555

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 35/64 (54%), Gaps = 11/64 (17%)

Query: 782 TKVNKPEGALTHLELLKINT--NSCLLIDGESLGLYLEYYRQQFFEI---VVNLPAVIA- 835
           TK+    G L +LE L+     NSC+LI  +  G+   YYR+Q+  I   + N+ AVIA 
Sbjct: 759 TKIFFKAGMLAYLEKLRSTKMHNSCVLIQKKIKGV---YYRKQYLAIKNAIHNVQAVIAG 815

Query: 836 --CR 837
             CR
Sbjct: 816 NYCR 819

>YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transporting
            ATPase, involved in resistance to cadmium [3651 bp, 1216
            aa]
          Length = 1216

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 723  ILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKL 771
            +  +  +ED L+ D  S+I LLR  GI + +L+GD     R  S++A+L
Sbjct: 1016 VTAVYALEDSLRADAVSTINLLRQRGISLHILSGDDDGAVR--SMAARL 1062

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
           P-type ATPase, member of the heavy-metal transporting
           P-type ATPases in the superfamily of P-type ATPases
           [3015 bp, 1004 aa]
          Length = 1004

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 702 MLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVET 761
            +N  V   N +S ++  +  + GL  + D+++ D  ++++ L+  G + +M+TGD    
Sbjct: 735 FINSNVDQGNTVS-YVSVNGHVFGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSA 793

Query: 762 ARCVS 766
           A+ V+
Sbjct: 794 AKRVA 798

>Kwal_55.21575
          Length = 989

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 37/74 (50%), Gaps = 12/74 (16%)

Query: 232 RRDRESNNELYEVLS------------KSQLVPSKDLKVGDLIKIGKGARAPADLVLLQS 279
           +   ++NN L +++S            K++ +P + L+VGD ++I  GA+ P D V+++ 
Sbjct: 391 KAKSKTNNSLSKLMSLAPSTCTIIENGKAREIPVEFLQVGDTVEIKPGAKIPTDGVIIEG 450

Query: 280 SEPSGEIFIKTDQL 293
                E  I  + L
Sbjct: 451 ESEVDESLITGESL 464

>Scas_675.36
          Length = 557

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 51/115 (44%), Gaps = 9/115 (7%)

Query: 769 AKLVSRGQYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVV 828
             L++  + +H V   +K   A      L+I     L++  E +  ++EY  +   +I  
Sbjct: 206 GDLLTGSEIIHLVLDGDKKCAAQQEKHGLRIGYMGHLMLIAEEIAKFIEYIEE--MKISF 263

Query: 829 NLPAVIACRCTPQQKADVATFIREVTGKRVCCIG-----DGGNDVSMIQSADVGV 878
           + PA+  C   PQ +  +AT + +   K    +G     DG  D  +I +AD+ +
Sbjct: 264 SNPAIQECLNEPQWREYMATILADTRVKYNTVLGDFVSEDGSGD--LIHNADLDI 316

>YKL139W (CTK1) [3128] chr11 (182963..184549) C-terminal domain
           (CTD) kinase alpha subunit, cyclin-dependent protein
           kinase that phosphorylates C-terminal domain of RNA
           polymerase II large subunit Rpo21p [1587 bp, 528 aa]
          Length = 528

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 697 DASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDK--LQEDVKSSIELLRNAG 748
           D S ++LN+EV +S+   KHL   L +LG+  + D   L  DVK S  L+ N G
Sbjct: 266 DLSGLLLNKEVQISHSQCKHLFKQL-LLGMEYLHDNKILHRDVKGSNILIDNQG 318

>ADL122C [1619] [Homologous to ScYIL019W - SH] (475029..475973) [945
           bp, 314 aa]
          Length = 314

 Score = 30.8 bits (68), Expect = 5.5,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 43/82 (52%), Gaps = 10/82 (12%)

Query: 60  RSNESQKNARQSDTEPLINNGATAPNSWSHDPRHDSDRSTASGSPFWSRITKFMRSSHSP 119
           +SN++  +A +SD++P     A +  S S D + + D ++AS             ++H+P
Sbjct: 38  QSNDTSTSASESDSDPESEGDARSGQSES-DEQSEMDGASASSDD---------EAAHTP 87

Query: 120 KVSTYKATSNSIQLKDDQQLDR 141
           +V +++A S++      ++L R
Sbjct: 88  RVISFRAPSDAYSGPSPRELRR 109

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
           Saccharomyces cerevisiae YDR270w CCC2, start by
           similarity
          Length = 1012

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 60/165 (36%), Gaps = 59/165 (35%)

Query: 716 HLEHDLEILGLTGVEDKLQEDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLVSRG 775
           +L  D ++ G   + D+++ D K  I  LRN   +++M+TGD                  
Sbjct: 748 YLAIDDKVCGRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGD------------------ 789

Query: 776 QYVHTVTKVNKPEGALTHLELLKINTNSCLLIDGESLGLYLEYYRQQFFEIVVNLPAVIA 835
                           TH   +K+                         E+V   P  + 
Sbjct: 790 ----------------THKSAMKVA------------------------EMVDIPPNNVY 809

Query: 836 CRCTPQQKADVATFIREVTGKRVCCIGDGGNDVSMIQSADVGVGI 880
              TP  K+    ++RE  G+ +  IGDG ND   + ++D+G+ I
Sbjct: 810 SEVTPDGKSQTVEYLRE-EGRVIAFIGDGINDSLALVTSDLGIAI 853

>Sklu_1951.5 YMR033W, Contig c1951 5929-6912 reverse complement
          Length = 327

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 34/71 (47%), Gaps = 3/71 (4%)

Query: 12  ESIPHNNRHNSF---DLLDPQLEDSLDAALESLQIHTGGSPAREDFEMTSLRSNESQKNA 68
           E +  +++ NSF   D  +P+ +   + AL+   I T G   RE  E    + NE+  N 
Sbjct: 80  EVLSEDDKKNSFFGADAFEPEQDPDAEGALDVAAIVTSGRDTREILEERERKKNETNVNN 139

Query: 69  RQSDTEPLINN 79
            + +T   +++
Sbjct: 140 TELETNSFVDS 150

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 36,068,741
Number of extensions: 1595436
Number of successful extensions: 5294
Number of sequences better than 10.0: 109
Number of HSP's gapped: 5233
Number of HSP's successfully gapped: 194
Length of query: 1117
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 1005
Effective length of database: 12,718,893
Effective search space: 12782487465
Effective search space used: 12782487465
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)