Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.578585684444620.0
YIL047C (SYG1)90289221340.0
Scas_700.25*93193519380.0
Scas_704.3991690418820.0
ADL080W86384518740.0
CAGL0L00737g91192218710.0
KLLA0F27467g84486915540.0
YNR013C (PHO91)8943011704e-12
Kwal_47.187213832301542e-10
Scas_625.169322731553e-10
Kwal_23.61298162581544e-10
ADR289C8072661501e-09
Sklu_2440.133812321408e-09
CAGL0I05632g8862771411e-08
AAR127C3812311372e-08
KLLA0A02057g3842281321e-07
KLLA0F06160g8592921312e-07
YDR414C (ERD1)3621851212e-06
CAGL0F02871g3681811141e-05
Kwal_27.122922172551074e-05
KLLA0F00660g13742651124e-05
YPL110C12232631081e-04
KLLA0E15774g11481511026e-04
Kwal_27.1275110931191018e-04
AGR223W13211151018e-04
Scas_570.8353228980.001
AFR628C86966980.002
YCR037C (PHO87)923131940.005
Kwal_33.1361889156920.008
Sklu_2202.81367111900.016
ADL143W1102116900.017
YJL012C (VTC4)721121880.026
Scas_480.672384850.052
Scas_595.91148140850.055
CAGL0J07040g1245256850.059
CAGL0G06952g71784850.061
KLLA0C03454g90033850.064
Kwal_33.15385713126830.095
CAGL0E03157g501261810.14
CAGL0F02387g95266800.21
CAGL0F02145g81692780.33
KLLA0F22627g729106770.54
CAGL0L06622g113747760.66
Scas_634.1591666731.5
CAGL0I08415g130877712.4
YJL198W (PHO90)88145703.4
Kwal_56.2341082531703.6
YPL019C (VTC3)835136685.2
Kwal_23.506083548685.6
CAGL0K09086g45150685.7
Scas_689.169142685.8
Sklu_2390.5710120677.5
Sklu_2390.4710120677.5
AGL020W844137677.7
YGR233C (PHO81)117853678.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.5785
         (844 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.5785                                                         1723   0.0  
YIL047C (SYG1) [2620] chr9 complement(265114..267822) Protein fo...   826   0.0  
Scas_700.25*                                                          751   0.0  
Scas_704.39                                                           729   0.0  
ADL080W [1661] [Homologous to ScYIL047C (SYG1) - SH] complement(...   726   0.0  
CAGL0L00737g complement(90349..93084) similar to sp|P40528 Sacch...   725   0.0  
KLLA0F27467g complement(2541110..2543644) similar to sp|P40528 S...   603   0.0  
YNR013C (PHO91) [4596] chr14 complement(649027..651711) Member o...    70   4e-12
Kwal_47.18721                                                          64   2e-10
Scas_625.16                                                            64   3e-10
Kwal_23.6129                                                           64   4e-10
ADR289C [2030] [Homologous to ScYNR013C (PHO91) - SH] (1193040.....    62   1e-09
Sklu_2440.13 YDR414C, Contig c2440 19959-21104 reverse complement      59   8e-09
CAGL0I05632g 531308..533968 similar to sp|P27514 Saccharomyces c...    59   1e-08
AAR127C [314] [Homologous to ScYDR414C (ERD1) - SH] (568957..570...    57   2e-08
KLLA0A02057g 186220..187374 gi|1169545|sp|P41771|ERD1_KLULA Kluy...    55   1e-07
KLLA0F06160g 598549..601128 similar to sp|P27514 Saccharomyces c...    55   2e-07
YDR414C (ERD1) [1239] chr4 complement(1295586..1296674) Protein ...    51   2e-06
CAGL0F02871g complement(278122..279228) similar to sp|P16151 Sac...    49   1e-05
Kwal_27.12292                                                          46   4e-05
KLLA0F00660g 54232..58356 similar to sgd|S0006031 Saccharomyces ...    48   4e-05
YPL110C (YPL110C) [5334] chr16 complement(341067..344738) Member...    46   1e-04
KLLA0E15774g 1402940..1406386 similar to sp|P17442 Saccharomyces...    44   6e-04
Kwal_27.12751                                                          44   8e-04
AGR223W [4534] [Homologous to ScYPL110C - SH] complement(1167870...    44   8e-04
Scas_570.8                                                             42   0.001
AFR628C [3820] [Homologous to ScYJL198W (PHO90) - SH; ScYCR037C ...    42   0.002
YCR037C (PHO87) [571] chr3 complement(194409..197180) Member of ...    41   0.005
Kwal_33.13618                                                          40   0.008
Sklu_2202.8 YPL110C, Contig c2202 8829-12932                           39   0.016
ADL143W [1598] [Homologous to ScYGR233C (PHO81) - SH] complement...    39   0.017
YJL012C (VTC4) [2892] chr10 complement(411149..413314) Subunit o...    39   0.026
Scas_480.6                                                             37   0.052
Scas_595.9                                                             37   0.055
CAGL0J07040g 675389..679126 similar to tr|Q02979 Saccharomyces c...    37   0.059
CAGL0G06952g complement(663828..665981) similar to sp|P47075 Sac...    37   0.061
KLLA0C03454g 311611..314313 similar to sp|P25360 Saccharomyces c...    37   0.064
Kwal_33.15385                                                          37   0.095
CAGL0E03157g 291000..292505 highly similar to sp|P32582 Saccharo...    36   0.14 
CAGL0F02387g complement(229207..232065) similar to sp|P25360 Sac...    35   0.21 
CAGL0F02145g 213561..216011 similar to sp|P43585 Saccharomyces c...    35   0.33 
KLLA0F22627g complement(2112336..2114525) similar to sp|P47075 S...    34   0.54 
CAGL0L06622g complement(743602..747015) similar to sp|P17442 Sac...    34   0.66 
Scas_634.15                                                            33   1.5  
CAGL0I08415g 820503..824429 some similarities with tr|Q06211 Sac...    32   2.4  
YJL198W (PHO90) [2728] chr10 (60843..63488) Phosphate transporte...    32   3.4  
Kwal_56.23410                                                          32   3.6  
YPL019C (VTC3) [5418] chr16 complement(514507..517014) Subunit o...    31   5.2  
Kwal_23.5060                                                           31   5.6  
CAGL0K09086g 902244..903599 similar to tr|Q08685 Saccharomyces c...    31   5.7  
Scas_689.1                                                             31   5.8  
Sklu_2390.5 , Contig c2390 12646-14778                                 30   7.5  
Sklu_2390.4 YJL012C, Contig c2390 12646-14778                          30   7.5  
AGL020W [4291] [Homologous to ScYFL004W (VTC2) - SH; ScYPL019C (...    30   7.7  
YGR233C (PHO81) [2181] chr7 complement(954675..958211) Cyclin-de...    30   8.7  

>Kwal_23.5785
          Length = 856

 Score = 1723 bits (4462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 830/844 (98%), Positives = 830/844 (98%)

Query: 1   MKFAEHLRESAVPEWIDKYIDYKAGKKKLKSCRNTIAASEVLINNVSSFASVPPSRESSM 60
           MKFAEHLRESAVPEWIDKYIDYKAGKKKLKSCRNTIAASEVLINNVSSFASVPPSRESSM
Sbjct: 1   MKFAEHLRESAVPEWIDKYIDYKAGKKKLKSCRNTIAASEVLINNVSSFASVPPSRESSM 60

Query: 61  SRYLSQNRSYTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCGRRFAVLQEQIEKFE 120
           SRYLSQNRSYTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCGRRFAVLQEQIEKFE
Sbjct: 61  SRYLSQNRSYTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCGRRFAVLQEQIEKFE 120

Query: 121 ADQAQQSIADTDSKYYGAVDRDETIQPITAGKDSTLRSRFFRVVQDLELVPSFPRMAPFK 180
           ADQAQQSIADTDSKYYGAVDRDETIQPITAGKDSTLRSRFFRVVQDLELVPSFPRMAPFK
Sbjct: 121 ADQAQQSIADTDSKYYGAVDRDETIQPITAGKDSTLRSRFFRVVQDLELVPSFPRMAPFK 180

Query: 181 RLLDQSPEDNNLSVSHGETFAPTTLSTNQIQHRLSDALIEFYLLLQLMKGYREVNVTGFR 240
           RLLDQSPEDNNLSVSHGETFAPTTLSTNQIQHRLSDALIEFYLLLQLMKGYREVNVTGFR
Sbjct: 181 RLLDQSPEDNNLSVSHGETFAPTTLSTNQIQHRLSDALIEFYLLLQLMKGYREVNVTGFR 240

Query: 241 KIVKKFDKTCGTRELVPFIEYAKSTYPIFQHAEANARVVAHQMHDSALLGERSSFATELN 300
           KIVKKFDKTCGTRELVPFIEYAKSTYPIFQHAEANARVVAHQMHDSALLGERSSFATELN
Sbjct: 241 KIVKKFDKTCGTRELVPFIEYAKSTYPIFQHAEANARVVAHQMHDSALLGERSSFATELN 300

Query: 301 VEDPLLSWEQQTTKWYTDVLSSSSKDRKRKTARLKNLSLEYSLNEQKVHRFNRSILQMFX 360
           VEDPLLSWEQQTTKWYTDVLSSSSKDRKRKTARLKNLSLEYSLNEQKVHRFNRSILQMF 
Sbjct: 301 VEDPLLSWEQQTTKWYTDVLSSSSKDRKRKTARLKNLSLEYSLNEQKVHRFNRSILQMFV 360

Query: 361 XXXXXXXXXXXXXYTLYRGFVASNSSEIHSLLLPLWGGWYMVFLITFLFLLNCFIWHRSN 420
                        YTLYRGFVASNSSEIHSLLLPLWGGWYMVFLITFLFLLNCFIWHRSN
Sbjct: 361 SGVLLGGSLALVGYTLYRGFVASNSSEIHSLLLPLWGGWYMVFLITFLFLLNCFIWHRSN 420

Query: 421 INYRFIMFGEMHSRRGAVLFNNDFSTTKIPILFYFASVLAFPMALLSSISFNEVNLNPWA 480
           INYRFIMFGEMHSRRGAVLFNNDFSTTKIPILFYFASVLAFPMALLSSISFNEVNLNPWA
Sbjct: 421 INYRFIMFGEMHSRRGAVLFNNDFSTTKIPILFYFASVLAFPMALLSSISFNEVNLNPWA 480

Query: 481 IIWIALVVVLFFSPVLGELPLLSIPYWNKLTKSVRWILVSFVRLIFSGFYPVQFGDFFLG 540
           IIWIALVVVLFFSPVLGELPLLSIPYWNKLTKSVRWILVSFVRLIFSGFYPVQFGDFFLG
Sbjct: 481 IIWIALVVVLFFSPVLGELPLLSIPYWNKLTKSVRWILVSFVRLIFSGFYPVQFGDFFLG 540

Query: 541 DIFCSLTYSLADIAMFFCIYSPTPNGRCGSSHSKAMGAMTCLPNFWRFMQCLRRFSDSGD 600
           DIFCSLTYSLADIAMFFCIYSPTPNGRCGSSHSKAMGAMTCLPNFWRFMQCLRRFSDSGD
Sbjct: 541 DIFCSLTYSLADIAMFFCIYSPTPNGRCGSSHSKAMGAMTCLPNFWRFMQCLRRFSDSGD 600

Query: 601 WFPHLLNGLKYSLSVVYYASLCAYRISHTRSRRNVFIIFATLNGVCTSIWDIIMDWSLLQ 660
           WFPHLLNGLKYSLSVVYYASLCAYRISHTRSRRNVFIIFATLNGVCTSIWDIIMDWSLLQ
Sbjct: 601 WFPHLLNGLKYSLSVVYYASLCAYRISHTRSRRNVFIIFATLNGVCTSIWDIIMDWSLLQ 660

Query: 661 SGSRNWLLRDDLYLAGRKNWKTGAYSKRRKSVYYLAMIWDVAMRFQWVVYAIAPATIQQS 720
           SGSRNWLLRDDLYLAGRKNWKTGAYSKRRKSVYYLAMIWDVAMRFQWVVYAIAPATIQQS
Sbjct: 661 SGSRNWLLRDDLYLAGRKNWKTGAYSKRRKSVYYLAMIWDVAMRFQWVVYAIAPATIQQS 720

Query: 721 AITSFILAALEVTRRFVWIIFRVENEHVANVHLFKVSGEISLPYPTTVNEESETEASVSS 780
           AITSFILAALEVTRRFVWIIFRVENEHVANVHLFKVSGEISLPYPTTVNEESETEASVSS
Sbjct: 721 AITSFILAALEVTRRFVWIIFRVENEHVANVHLFKVSGEISLPYPTTVNEESETEASVSS 780

Query: 781 NHYAMSEMSFPTMAAPTPMYRGESTQKSTGSNGLLRTLSSSIPWAHAQDFQRPTGCAGGD 840
           NHYAMSEMSFPTMAAPTPMYRGESTQKSTGSNGLLRTLSSSIPWAHAQDFQRPTGCAGGD
Sbjct: 781 NHYAMSEMSFPTMAAPTPMYRGESTQKSTGSNGLLRTLSSSIPWAHAQDFQRPTGCAGGD 840

Query: 841 NARD 844
           NARD
Sbjct: 841 NARD 844

>YIL047C (SYG1) [2620] chr9 complement(265114..267822) Protein for
           which truncation and overexpression can suppress
           lethality of Gpa1p deficiency, member of the divalent
           anion:Na+ (DASS) family of membrane transporters [2709
           bp, 902 aa]
          Length = 902

 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/892 (47%), Positives = 574/892 (64%), Gaps = 69/892 (7%)

Query: 1   MKFAEHLRESAVPEWIDKYIDYKAGKKKLKSCRNTIAASE-------VLINNVSSFASVP 53
           MKFA+HL ESA+PEW DKYIDYK GKKKL+  +  + A E         + +VS + +  
Sbjct: 1   MKFADHLTESAIPEWRDKYIDYKVGKKKLRRYKEKLDAEEEQSSSYRSWMPSVSVYQTAF 60

Query: 54  PSRESSMSRYLSQNRS-------YTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCG 106
             RE   SR     RS       Y+ +Q+ FV  F+E W+I  +L KCN+FYLW LK C 
Sbjct: 61  QQREPGKSRSDGDYRSGPAFKKDYSALQREFVADFIEDWLISFQLSKCNEFYLWLLKECD 120

Query: 107 RRFAVLQEQI------EKFEADQAQQSIADTD--SKYYGA------------VDRDE--- 143
           ++F VLQ Q+      + +E D   +S ++ D  +  Y A            +D D    
Sbjct: 121 KKFEVLQSQLHYYSLQKNYERDNLNRSSSNVDMSTSLYAAGLAGRSDSRVNSIDSDSRSV 180

Query: 144 --TIQPITAGKDS---TLRSRFFRVVQDLELVPSFPR--MAPFKRLLDQSPEDNNLSVSH 196
                P T        +L +   +V++D  L+PS+P+   +  + L   +      + + 
Sbjct: 181 MYGSMPCTKEAKKPRLSLLAYCQKVLKDNRLLPSWPKRGFSLLQDLRQDASSRGRETFAF 240

Query: 197 GETFAPTTLSTNQIQHRLSDALIEFYLLLQLMKGYREVNVTGFRKIVKKFDKTCGTRELV 256
           G +F   T++T Q ++ LS+A+IE+YL LQL+K +R++NVTGFRK+VKKFDKTC TREL 
Sbjct: 241 GASFL-ETMTTTQARNLLSNAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDKTCHTRELT 299

Query: 257 PFIEYAKSTYPIFQHAEANARVVAHQMHD--SALLGERSSFATELNVEDPLLSWEQQTTK 314
            F+ YA++ Y +F+HA+AN ++VA +M    S+     S  ++    ++P+   E Q T+
Sbjct: 300 TFMSYARTHYTLFKHADANVQLVAQKMQQITSSQPTPTSELSSAQRDKEPITWLETQITE 359

Query: 315 WYTDVLSSSSKDRKRKTARLKNLSLEYSLNEQKVHRFNRSILQMFXXXXXXXXXXXXXXY 374
           W+T  L++S KDRK  T +LK L+++YS++EQ VHR NRSI+QM               Y
Sbjct: 360 WFTTALTNSPKDRKHNTHKLKKLTIQYSISEQMVHRNNRSIVQMLVVGLGIGVSMTLITY 419

Query: 375 TLYRGFVASNSSEIHSLLLPLWGGWYMVFLITFLFLLNCFIWHRSNINYRFIMFGEMHSR 434
           TLY G  +  +S  H +L PLWGGWYMV LI FLFL+NCFIWHR+ INYRFIM GE+ S+
Sbjct: 420 TLYLGISSEETSFTHKILFPLWGGWYMVLLIAFLFLVNCFIWHRTGINYRFIMLGEIQSK 479

Query: 435 RGAVLFNNDFSTTKIPILFYFASVLAFPMALLSSISFNEVNLNPWAIIWIALVVVLFFSP 494
            G   FNNDF+T+KIP+  YF +    P A+ S +SF    L P   ++I +V  LF  P
Sbjct: 480 NGTQFFNNDFATSKIPLKLYFLTFFIVPCAVCSMLSFALEKLTPLGFLYIGIVSFLFLCP 539

Query: 495 VLGELPLLSIPYWNKLTKSVRWILVSFVRLIFSGFYPVQFGDFFLGDIFCSLTYSLADIA 554
                    IPYW+K+  + +W++V+ +RL+ SGF+PV+FGDFFLGDI CSLTYS+ADIA
Sbjct: 540 SG------LIPYWDKVVHTRKWLVVTLIRLMMSGFFPVEFGDFFLGDIICSLTYSIADIA 593

Query: 555 MFFCIYSPTPNGRCGSSHSKAMGAMTCLPNFWRFMQCLRRFSDSGDWFPHLLNGLKYSLS 614
           MFFC+YS TPN  CGSSHS+AMG ++CLP++WRFMQCLRRF+DSGDWFPHLLN  KY+L 
Sbjct: 594 MFFCVYSHTPNNLCGSSHSRAMGVLSCLPSYWRFMQCLRRFADSGDWFPHLLNAAKYTLG 653

Query: 615 VVYYASLCAYRIS-HTRSRRNVFIIFATLNGVCTSIWDIIMDWSLLQ-SGSRNWLLRDDL 672
           + Y A+LCAYR+S  +  RR  FI+ ATLN + TS WD++MDWS    + S NWLLRDDL
Sbjct: 654 IAYNATLCAYRLSDRSEQRRTPFIVCATLNSILTSAWDLVMDWSFAHNTTSYNWLLRDDL 713

Query: 673 YLAGRKNWKTGAYSKRRKSVYYLAMIWDVAMRFQWVVYAIAPATIQQSAITSFILAALEV 732
           YLAG+KNW+ G+YS  RK VYY AMIWD+ +RF+W+VYAIAP TIQQSA+TSFILA LEV
Sbjct: 714 YLAGKKNWENGSYSFSRKLVYYFAMIWDILIRFEWIVYAIAPQTIQQSAVTSFILALLEV 773

Query: 733 TRRFVWIIFRVENEHVANVHLFKVSGEISLPYPTT-VNEESETEASVSSNHYAM------ 785
            RRFVWIIFRVENEHVANVHLF+V+G+  LPYP   V ++S   + + S  ++       
Sbjct: 774 LRRFVWIIFRVENEHVANVHLFRVTGDAPLPYPIAQVGDDSMDSSDLGSKAFSSLNDIPI 833

Query: 786 --SEMSFP-TMAAPTPMYRGESTQKSTGSNGLLRTLSSSIPWAHAQDFQRPT 834
             S  + P + A P P YRG   ++S+    +   +S SIPWAHA DFQRPT
Sbjct: 834 TPSHDNNPHSFAEPMPAYRGTFRRRSS----VFENISRSIPWAHATDFQRPT 881

>Scas_700.25*
          Length = 931

 Score =  751 bits (1938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/935 (43%), Positives = 552/935 (59%), Gaps = 108/935 (11%)

Query: 1   MKFAEHLRESAVPEWIDKYIDYKAGKKKLKS----CRNTI--AASEVLINNVSSFASVPP 54
           MKF +HL ES +PEW DKY++YK GKKKLK+     +N I    ++ L+N     ASV  
Sbjct: 1   MKFGDHLNESMIPEWKDKYVEYKVGKKKLKTFKQKLQNDIDETTTDSLLN-----ASVSD 55

Query: 55  SRESSM-----------SRYLSQNRSYTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELK 103
           S ES+            S   S  + Y+PV+++ VQ FV+ W+I ++L KCNDFY   + 
Sbjct: 56  SIESTYIDQENSTPVTPSHVYSIQKDYSPVKKKIVQEFVKDWLIGEQLNKCNDFYEELIN 115

Query: 104 RCGRRFAVLQEQIEKF---------------------EADQAQQSIADTDSKYYGAVDRD 142
            C +++ +L+ QI  +                     E+   + +  D+  ++  A +R 
Sbjct: 116 DCRKKYNILENQIRFYNIQRHSIDNKKTRNLLIVSSSESVDVENTPIDSTIQHPYAPNRG 175

Query: 143 ETI----QPITAGKDSTLRSRFF------RVVQDLELVPSFPR---MAPFKRLLDQSPED 189
             I    Q   A  +    S F        ++++  ++PS P     + F +    S  +
Sbjct: 176 RVITLNGQQNVANANKNFASHFLYFQKLKTILKNNNVLPSLPAKGITSYFHQNGRGSQGE 235

Query: 190 NNLSVSHGETFAPTTLSTNQIQHRLSDALIEFYLLLQLMKGYREVNVTGFRKIVKKFDKT 249
            N++ S  +  +  T+   + Q  L++A++EFYL LQL+K YR++N+TGFRKI KKFDKT
Sbjct: 236 GNINASENDMLSEITVE--KAQKLLTEAILEFYLFLQLVKTYRDLNLTGFRKIAKKFDKT 293

Query: 250 CGTRELVPFIEYAKSTYPIFQHAEANARVVAHQMHDSALLGER--SSFATELNVEDPLLS 307
           C T+E + F+ YAK  Y IF H + N  ++  +M  ++            E   +DPLL 
Sbjct: 294 CETKECLKFMNYAKENYTIFSHIDPNIALMTDRMKKTSTYQPLVFEDITPENESDDPLLW 353

Query: 308 WEQQTTKWYTDVLSSSSKDRKRKTARLKNLSLEYSLNEQKVHRFNRSILQMFXXXXXXXX 367
           WE +   WY   L++S  + KR   +L+   ++YSLNE+ +HR N SILQM         
Sbjct: 354 WESKVRGWYIKDLTNSLTEMKRNNDKLRKFGIQYSLNERIIHRINISILQMTISGFFIGA 413

Query: 368 XXXXXXYTLYRGFVASNSSEIHSLLLPLWGGWYMVFLITFLFLLNCFIWHRSNINYRFIM 427
                 YTLY  F + + + IH +L PLWGGWYMV LI+FLF+ NCFIWHRS INYRFIM
Sbjct: 414 AFSLIIYTLYLIFTSDDKAYIHRILFPLWGGWYMVLLISFLFIGNCFIWHRSGINYRFIM 473

Query: 428 FGEMHSRRGAVLFNNDFSTTKIPILFYFASVLAFPMALLSSISFNEVNLNPWAIIWIALV 487
           FGE+ +R G   FNNDF+TTKI + +YF S+     ++L+ ISF    L P   I+  +V
Sbjct: 474 FGEIQARSGTQFFNNDFATTKISLKYYFISLFILACSILAIISFQLEKLTPLGFIFPGIV 533

Query: 488 VVLFFSPVLGELPLLSIPYWNKLTKSVRWILVSFVRLIFSGFYPVQFGDFFLGDIFCSLT 547
           + LF +P         IP+W+KL ++ +W+  S +RLIFSGFYPV+FGDFFLGDI CSLT
Sbjct: 534 ITLFLAPSW------MIPFWDKLVETRKWLFCSGIRLIFSGFYPVEFGDFFLGDIVCSLT 587

Query: 548 YSLADIAMFFCIYSPTPNGRCGSSHSKAMGAMTCLPNFWRFMQCLRRFSDSGDWFPHLLN 607
           YS++D+AMFFC+Y  + N  C SSH ++MG + CLP+FWRFMQCLRRF+DSGDWFPHLLN
Sbjct: 588 YSISDLAMFFCVYVRSDNATCSSSHLRSMGVLGCLPSFWRFMQCLRRFADSGDWFPHLLN 647

Query: 608 GLKYSLSVVYYASLCAYRIS-HTRSRRNVFIIFATLNGVCTSIWDIIMDWSLLQSGSRNW 666
             KY+L V Y A+LC YRIS  +   R +FI+FATLN   TSIWD++MDWSLLQ    N 
Sbjct: 648 AAKYTLGVAYNATLCVYRISPKSFHSRQIFIVFATLNATYTSIWDLVMDWSLLQPSQNNT 707

Query: 667 LLRDDLYLAGRKNWKTGAYSKRRKSVYYLAMIWDVAMRFQWVVYAIAPATIQQSAITSFI 726
            LRDDLYLAG+KNWKTG YS +RKS+YY AMIW+V +RF+W+VYAIAP TIQQSA TSFI
Sbjct: 708 FLRDDLYLAGKKNWKTGKYSNKRKSIYYFAMIWNVIVRFEWIVYAIAPQTIQQSADTSFI 767

Query: 727 LAALEVTRRFVWIIFRVENEHVANVHLFKVSGEISLPYP---TTVNEESETEASVSSNHY 783
           LA  EV RRFVWIIFRVENEHVANV+LF+VSG   LPYP   T++     +++  ++N  
Sbjct: 768 LATAEVLRRFVWIIFRVENEHVANVNLFRVSGTAPLPYPINITSITPLGSSDSDEATNII 827

Query: 784 AMSEMS--------------------FPTMAA--------------PTPMYRGESTQKST 809
            +   S                    F T+ A              P P Y     +++T
Sbjct: 828 VLESNSGNDNLSVTNEPQQTSNRINRFDTVGAVPNVDITRETRIEEPMPAYHPPLERRTT 887

Query: 810 GSNGLLRTLSSSIPWAHAQDFQRPTGCAGGDNARD 844
                  ++S SIPWAH  DFQRP+  A     RD
Sbjct: 888 ----TFGSISKSIPWAHTSDFQRPSIVATTLPGRD 918

>Scas_704.39
          Length = 916

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/904 (43%), Positives = 541/904 (59%), Gaps = 70/904 (7%)

Query: 1   MKFAEHLRESAVPEWIDKYIDYKAGKKKLKSCR----NTIAASEVLINNVSSFASV---- 52
           MKF +HLRES +PEW DKYIDYK+ KK++K  R    N    ++ +    S++++     
Sbjct: 1   MKFGDHLRESIIPEWKDKYIDYKSSKKRIKHFRAKWENQSIYNDPVFQKKSTYSTTRDLR 60

Query: 53  ---------PPSRESSMSRYLSQN-----------RSYTPVQQRFVQSFVEKWVIDQELE 92
                      +R++S    +              R Y+P+    +  F+E W+I  +L 
Sbjct: 61  SNNNSQSNLNLNRQASNGNIIRSTNSSSSSLASSLRVYSPLLIEIIHEFMENWIISIQLT 120

Query: 93  KCNDFYLWELKRCGRRFAVLQEQIEKFEADQAQ-QSIADTDSKYYGAVDRDETIQPITAG 151
           KCN+FY W L    ++F +LQ Q+  F   +      A++ S  YG++    T   +T  
Sbjct: 121 KCNEFYNWLLNDSRKKFKILQNQVHLFNIQKRLFNDAANSISSSYGSLMTSATSDSVTTS 180

Query: 152 KDSTLRSRFFRVVQDLELVPSFPRMAPFKRLLDQSPEDN-NLSVSHGETFAP-------- 202
              +++      +    L+PS+P+ +  + + + +  D  +  +   ETF P        
Sbjct: 181 LIQSIKD----TLHAHRLLPSYPQYSLKQLIFNNTTSDTESQPLMERETFNPEDQLLNNL 236

Query: 203 ------TTLSTNQIQHRLSDALIEFYLLLQLMKGYREVNVTGFRKIVKKFDKTCGTRELV 256
                    S ++    LSDA++EFYL LQL+K YR++NVTGFRKIVKKFDKT  T EL 
Sbjct: 237 NNNTSSAKSSLDKSAKLLSDAILEFYLFLQLIKSYRDLNVTGFRKIVKKFDKTFQTNELN 296

Query: 257 PFIEYAKSTYPIFQHAEANARVVAHQMHDSALLGERSSFATEL----NVEDPLLSWEQQT 312
            F+ +AK  + IF+H + N +++ ++M    +   +     EL     ++DP+L WE + 
Sbjct: 297 KFMAFAKQNFTIFKHIDPNIKLMTNKMKQ--ISSYQPIIFDELIPSNEIDDPILWWESKV 354

Query: 313 TKWYTDVLSSSSKDRKRKTARLKNLSLEYSLNEQKVHRFNRSILQMFXXXXXXXXXXXXX 372
             WY + L++S K  K+   +LK L ++YSLNEQ VHR NR+I+QM              
Sbjct: 355 KDWYVNQLTNSPKSMKKNNKKLKKLIIQYSLNEQMVHRNNRAIIQMTIAAWILGISSTSI 414

Query: 373 XYTLYRGFVASNSSEIHSLLLPLWGGWYMVFLITFLFLLNCFIWHRSNINYRFIMFGEMH 432
             T+Y  F++  +S  H +L P+WGGWYMV LI+ L + NCFIWH+S INYRFIMFGE+ 
Sbjct: 415 ANTIYLSFMSGYTSYTHKILFPIWGGWYMVLLISLLIISNCFIWHKSEINYRFIMFGEIK 474

Query: 433 SRRGAVLFNNDFSTTKIPILFYFASVLAFPMALLSSISFNEVNLNPWAIIWIALVVVLFF 492
           +R G   +NNDF+TT+I +  YF S    P+++ + +SF+  NL P+AII+  +   LF 
Sbjct: 475 ARSGTQFYNNDFATTRISLNLYFLSFFILPLSICALLSFHNENLFPYAIIYPLIATSLFI 534

Query: 493 SPVLGELPLLSIPYWNKLTKSVRWILVSFVRLIFSGFYPVQFGDFFLGDIFCSLTYSLAD 552
           +P    +    +PYWNKL +   WIL +F+RL  SG YPV+FGDFFLGDI CSLTYS++D
Sbjct: 535 AP--KAISKYILPYWNKLKEIRVWILTTFIRLSLSGLYPVEFGDFFLGDIICSLTYSMSD 592

Query: 553 IAMFFCIY-SPTPNGRCGSSHSKAMGAMTCLPNFWRFMQCLRRFSDSGDWFPHLLNGLKY 611
           IAMFFCIY S  P+  CGSSHS  MG ++CLPN+WR MQC RR++DS DWFPHLLN +KY
Sbjct: 593 IAMFFCIYFSDKPSTTCGSSHSITMGILSCLPNYWRMMQCFRRWADSADWFPHLLNAIKY 652

Query: 612 SLSVVYYASLCAYRIS-HTR-SRRNVFIIFATLNGVCTSIWDIIMDWSLLQSGSRNWLLR 669
            L V Y  +LCAYR+S H R + RN FII A LN + TS+WD+ +DWSLLQ  S NWLLR
Sbjct: 653 GLGVAYNGTLCAYRLSNHERGTTRNTFIIVAALNALITSVWDLTVDWSLLQPDSNNWLLR 712

Query: 670 DDLYLAGRKNWKTGAYSKRRKSVYYLAMIWDVAMRFQWVVYAIAPATIQQSAITSFILAA 729
           +DLYLAG+K+W+TG YS+ RKS YY+AM+WDV +RFQW+VYAIAP TIQQ+AITSFILA 
Sbjct: 713 NDLYLAGKKDWETGQYSRARKSFYYIAMVWDVLIRFQWIVYAIAPQTIQQNAITSFILAT 772

Query: 730 LEVTRRFVWIIFRVENEHVANVHLFKVSGEISLPYPTTVNEESET--------EASVSSN 781
            E+ RR +W+I RVENEHVANVHLF+V+G   LPYP  V   + T        E  ++ N
Sbjct: 773 TEIIRRCIWVIIRVENEHVANVHLFRVTGNAPLPYPVNVQTIALTKPTFQIGEEERMAEN 832

Query: 782 --HYAMSEMSFPTMAAPTPMYRGESTQKSTGSNGLLRTLSSSIPWAHAQDFQRPTGCAGG 839
               A+  +SF        M+    T     +      +S SIPW HA DFQRPT     
Sbjct: 833 LDQQALGNLSFNVSYDENAMWPPYRTLARRRTTTFAE-ISKSIPWVHATDFQRPTTLLSS 891

Query: 840 DNAR 843
           + ++
Sbjct: 892 NESK 895

>ADL080W [1661] [Homologous to ScYIL047C (SYG1) - SH]
           complement(542124..544715) [2592 bp, 863 aa]
          Length = 863

 Score =  726 bits (1874), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/845 (45%), Positives = 528/845 (62%), Gaps = 39/845 (4%)

Query: 1   MKFAEHLRESAVPEWIDKYIDYKAGKKKLKSCRNTIAASEVLINNVSSFASVPPSRESSM 60
           MKFAE LRES++PEW DKY+DYK GKKKLKS +  + AS  L        SV P++ S  
Sbjct: 1   MKFAERLRESSIPEWRDKYLDYKLGKKKLKSYKEKLKASRAL--------SVRPTQRSR- 51

Query: 61  SRYLSQNRSYTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCGRRFAVLQEQIEKFE 120
               +++  YT  Q+  V  FV  WVI  EL KC++FY W+L +C R++ +L++QIE + 
Sbjct: 52  ----ARDEPYTMQQEDAVYEFVMGWVIGTELAKCDEFYQWQLDQCERKYQLLKQQIEMYC 107

Query: 121 ADQAQQSIA-DTDSKYYGAVDRDETIQ--------PITAGKDSTLRSRFFRVVQDLELVP 171
             + +        + Y G  +     Q        P  AG+    +    R +Q+ +L+P
Sbjct: 108 LQKDENGAGLSYGATYEGQEETGLAAQLSAGRSPSPSRAGRLDRAQEGVKRWLQERDLMP 167

Query: 172 SFPRMAPFKRLLDQSPEDNNLSVSHGETFAPTTLSTNQIQHRLSDALIEFYLLLQLMKGY 231
           S P  A + R  +Q P       ++ ETF     S  Q Q +L  AL+E+YL LQL+K Y
Sbjct: 168 SLP--ARWSR--EQGPARVKKYSANTETFMHICPSKRQAQLQLGHALLEYYLTLQLLKNY 223

Query: 232 REVNVTGFRKIVKKFDKTCGTRELVPFIEYAKSTYPIFQHAEANARVVAHQMHDSALLGE 291
           R++NVTGFRKIVKKFDKTC T EL  F+ YA    P+F+H   N R+ A+    S  L +
Sbjct: 224 RDLNVTGFRKIVKKFDKTCDTEELSKFMSYANEHSPLFEHMGQNLRLYANSFKASNSLCQ 283

Query: 292 RSSFATELNVEDPLLSWEQQTTKWYTDVLSSSSKDRKRKTARLKNLSLEYSLNEQKVHRF 351
            ++       +DP+  WE Q  +WYT+ L+ S++ RK    +L++LSL+YS+NEQ VHR 
Sbjct: 284 PAARMNSSPEKDPVTYWEDQVFQWYTEALTESTQARKHHVQKLRSLSLQYSMNEQIVHRN 343

Query: 352 NRSILQMFXXXXXXXXXXXXXXYTLYRGFVASNSSEIHSLLLPLWGGWYMVFLITFLFLL 411
           N  ++QMF                L  G  A  SS  H +L P+WGGWY+V L++ LF L
Sbjct: 344 NTCVVQMFTAGSLLGVAVVLVIIALMLGIRADISSYRHLILFPVWGGWYLVLLMSLLFCL 403

Query: 412 NCFIWHRSNINYRFIMFGEMHSRRGAVLFNNDFSTTKIPILFYFASVLAFPMALLSSISF 471
           +C+IW R  +NY+FIMFGE+HSR+G  +FNNDFSTTKI    Y  S+    +  +S  S 
Sbjct: 404 DCYIWFRGKVNYQFIMFGEIHSRKGNTVFNNDFSTTKISGHLYMVSLAFITVGAVSLCSM 463

Query: 472 NEVNLNPWAIIWI-ALVVVLFFSPVLGELPLLSIPYWNKLTKSVRWILVSFVRLIFSGFY 530
               L PW  +W+ AL+  L FS     +    +PYW +L K+ +W++V+ +RL+FSG Y
Sbjct: 464 VRATLAPW--LWLCALLFALGFS-----MSSFILPYWRELRKTRQWLIVTAIRLVFSGAY 516

Query: 531 PVQFGDFFLGDIFCSLTYSLADIAMFFCIYSPTPNGRCGSSHSKAMGAMTCLPNFWRFMQ 590
           PVQFGDFFLGDI CSLTYS+AD+A  FC++S      CGSS+  +MG ++C+P++WR MQ
Sbjct: 517 PVQFGDFFLGDIVCSLTYSMADVASVFCVFSGQKYNMCGSSNLISMGVLSCIPSYWRLMQ 576

Query: 591 CLRRFSDSGDWFPHLLNGLKYSLSVVYYASLCAYRISHTR-SRRNVFIIFATLNGVCTSI 649
           CLRR+ DS D FPHLLNG KY+++++Y A LCAYRI+    S R+ FI    +N V +SI
Sbjct: 577 CLRRYLDSNDRFPHLLNGAKYAVAILYNACLCAYRINKLHHSYRSWFIAAGIINSVFSSI 636

Query: 650 WDIIMDWSLLQSGSRNWLLRDDLYLAGRKNWKTGAYSKRRKSVYYLAMIWDVAMRFQWVV 709
           WD++MDWSL Q  S N+LLRDDLYLAG++NW+TG YSKRRK++YY++MI DVA+RFQW+V
Sbjct: 637 WDLVMDWSLFQFQSTNFLLRDDLYLAGKRNWQTGQYSKRRKAMYYVSMISDVAIRFQWIV 696

Query: 710 YAIAPATIQQSAITSFILAALEVTRRFVWIIFRVENEHVANVHLFKVSGEISLPYPTTVN 769
           YAIAP  IQQSA+TSFIL  LEV RRF+WIIFRVENEHVANVHLFK++GE  LPYP + +
Sbjct: 697 YAIAPRVIQQSAVTSFILGILEVVRRFIWIIFRVENEHVANVHLFKITGETPLPYPISPS 756

Query: 770 EESETEASVSSNHYAMSEMSFPTMAAPTPMYRGESTQKSTGSNGLLRTLSSSIPWAHAQD 829
               T      +    ++ S   +     +   E       +  +L    S+IPWAHA+D
Sbjct: 757 RALSTSTVHDKHALPSTKNSHEDLVLYASVRHPEVLHMRHRAPSIL----SNIPWAHAKD 812

Query: 830 FQRPT 834
           FQRP+
Sbjct: 813 FQRPS 817

>CAGL0L00737g complement(90349..93084) similar to sp|P40528
           Saccharomyces cerevisiae YIL047c SYG1, start by
           similarity
          Length = 911

 Score =  725 bits (1871), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/922 (42%), Positives = 550/922 (59%), Gaps = 104/922 (11%)

Query: 1   MKFAEHLRESAVPEWIDKYIDYKAGKKKLKSCRNTIAASEVLINNVSSFASVPPSRESSM 60
           MKFA+HLRES + EW  KYIDYK GKKKLK  +   A   +      S    P       
Sbjct: 1   MKFADHLRESTISEWKGKYIDYKYGKKKLKKYKANTAKLNIPAVGYVSGRGTP------- 53

Query: 61  SRYLSQNRSYTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCGRRFAVLQEQIEKFE 120
                  + Y   Q   +  F+E W+I  +L KCN+FYLW L +C  ++ +L +Q++ + 
Sbjct: 54  ------KKKYNDFQVECINDFIEDWLIPNQLYKCNEFYLWLLSQCQEKYLILSQQLDCYR 107

Query: 121 ADQAQ----------QSIADTDSKYYGAVDRDETIQPIT------AGKDSTLRSRFFRVV 164
             + +          Q+ + +  + YG++                   D+  +      +
Sbjct: 108 EHKKEFREISSRVTYQTSSTSVLQAYGSISNAPEEDIEEDPELSFKKHDNMFQMTLKHFL 167

Query: 165 QDLELVPSFPRMAPFKRLLDQSPEDNNLSVSHGETFAPTTLST-------NQIQHR---- 213
            + +L+PS+P+M  F   + ++ +  +++    ETFA +           N+ +H     
Sbjct: 168 NEHDLMPSWPKM--FIETIPEALKPKSINTKLKETFAYSNKLNLNLNLMRNKDEHGNKIL 225

Query: 214 -------------LSDALIEFYLLLQLMKGYREVNVTGFRKIVKKFDKTCGTRELVPFIE 260
                        LSDAL+EFYL LQL+K YR+VNV GFRKIVKKFDKTC T+EL  F+ 
Sbjct: 226 KNPHKELKHARALLSDALLEFYLFLQLVKSYRDVNVVGFRKIVKKFDKTCKTQELAGFMR 285

Query: 261 YAKSTYPIFQH----AEANARVVAHQMHDSALLGERSSFATELNVE------DPLLSWEQ 310
           + ++ Y IF+H     EA  +    +      +GE SS  T+ NV       DPL +WE 
Sbjct: 286 FVRANYTIFKHDAVSTEATIKASKAKTLTDDDIGEDSSTITDTNVSLTSTTIDPLRAWEA 345

Query: 311 QTTKWYTDVLSSSSKDRKRKTARLKNLSLEYSLNEQKVHRFNRSILQMFXXXXXXXXXXX 370
           + TKWYT  + +S  ++KR   +LK +S++YSLNEQ +HR NR+ILQM            
Sbjct: 346 KLTKWYTVDVVNSLSEKKRHLEKLKKVSIQYSLNEQMIHRNNRAILQMTVFGVFTGIAVT 405

Query: 371 XXXYTLYRGFVASNSSEIHSLLLPLWGGWYMVFLITFLFLLNCFIWHRSNINYRFIMFGE 430
              YTLY  F++  +++ H +L P+WGGWYM+ LI+  FL++CFIWHR+ INYRFIMFGE
Sbjct: 406 LIAYTLYLAFLSPLNTKRHKILFPIWGGWYMILLISLFFLIDCFIWHRTGINYRFIMFGE 465

Query: 431 MHSRRGAVLFNNDFSTTKIPILFYFASVLAFPMALLSSISFNEVNLNPWAIIWIALVVVL 490
           + ++ G   FNNDF+TT IP+  YF +      A++S++SF+  +L P+  I+  +V +L
Sbjct: 466 VQAKSGTQFFNNDFATTGIPLRLYFLAFFIISCAIISALSFHFDHLTPYGYIYFIVVGLL 525

Query: 491 FFSPVLGELPLLSIPYWNKLTKSVRWILVSFVRLIFSGFYPVQFGDFFLGDIFCSLTYSL 550
           F +P   +L    IPYW+KL ++ ++++ + +RL+ SG YPV+F DFFLGDI CSLTY+L
Sbjct: 526 FITPY--DL----IPYWDKLVETRKFLVTTTIRLVLSGLYPVEFKDFFLGDIICSLTYTL 579

Query: 551 ADIAMFFCIYSPT----PNGRCGSSHSKAMGAMTCLPNFWRFMQCLRRFSDSGDWFPHLL 606
           +D+A+F C Y+P     P G CGSSHSKAMG ++CLP+FWRFMQC+RRF DS DWFPHL 
Sbjct: 580 SDLAIFACYYAPKTRKDPLGMCGSSHSKAMGVLSCLPSFWRFMQCVRRFFDSNDWFPHLP 639

Query: 607 NGLKYSLSVVYYASLCAYRIS-HTRSRRNVFIIFATLNGVCTSIWDIIMDWSLLQS--GS 663
           N  KY L V Y A+LCAYR+S H+ ++RN FIIFATLN + TSIWD++MDWS+LQS  G+
Sbjct: 640 NAAKYLLGVAYNATLCAYRLSNHSPAKRNPFIIFATLNSISTSIWDLVMDWSVLQSSIGN 699

Query: 664 RNWLLRDDLYLAGRKNWKTGAYSKRRKSVYYLAMIWDVAMRFQWVVYAIAPATIQQSAIT 723
            N  LR DLYLAG++NW+TG Y   RK+VYY+AM+ DV +RFQW+VYA+AP TIQQSA+T
Sbjct: 700 ENLFLRKDLYLAGKRNWETGKYDWSRKAVYYIAMVLDVVIRFQWIVYAVAPQTIQQSAVT 759

Query: 724 SFILAALEVTRRFVWIIFRVENEHVANVHLFKVSGEISLPYPTTVNEESETEASV---SS 780
           SF LA  EV RRF+W+IFRVENEHVANVHLF+V+GE  LPYP     +   +A+      
Sbjct: 760 SFALAVTEVCRRFIWVIFRVENEHVANVHLFRVTGEALLPYPNQDVVDFSGKATTDLYDD 819

Query: 781 NHYAMS----EMSFPT---------------MAAPTPMYRGESTQKSTGSNGLLRTLSSS 821
            H+       E S P+                  PT  Y     +++     +   +S S
Sbjct: 820 QHFQQGRDSIESSRPSHLHDLDLSLSDINNKFEEPTATYHSIVRRRT----AIFDNISRS 875

Query: 822 IPWAHAQDFQRPTGCAGGDNAR 843
           IPWAHA+DFQRP     G++++
Sbjct: 876 IPWAHAKDFQRPLTQHNGESSK 897

>KLLA0F27467g complement(2541110..2543644) similar to sp|P40528
           Saccharomyces cerevisiae YIL047c SYG1 member of the
           major facilitator superfamily singleton, start by
           similarity
          Length = 844

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/869 (39%), Positives = 501/869 (57%), Gaps = 65/869 (7%)

Query: 1   MKFAEHLRESAVPEWIDKYIDYKAGKKKLKSCRNTIAASEVLINNVSSFASVPPSRESSM 60
           MKFAEHLRES VPEW DKY++YK GKKK+K  +      +V                 SM
Sbjct: 1   MKFAEHLRESVVPEWSDKYVNYKLGKKKIKQFQKLKKVQDV----------------GSM 44

Query: 61  SRYLSQNRSYTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCGRRFAVLQEQIEKFE 120
            R +             V+ F++ W++  +L+ C++FY W+L +   ++  LQ QI  + 
Sbjct: 45  DRTI-------------VREFIDDWLVRDQLKNCDEFYEWQLSKYRAKYHKLQRQIHLYV 91

Query: 121 ADQAQQSIADTDSKY-----------YGAVDRDETIQPITAGKDSTLRSRFFRVVQDL-- 167
            +  ++S  D+  +Y           YG++  +    PI A KD+  +  ++ + + L  
Sbjct: 92  LEADKRSRLDSLDEYRIASLSRAPDSYGSIFPN--FSPI-ALKDTVKKKIWYDLKRWLVT 148

Query: 168 -ELVPSFPRMAPFKRLLDQSPEDNNLSVSHGETFAPTT--LSTNQIQHRLSDALIEFYLL 224
             L PS P     +  L  + +D   +    ETF   T  LS +QI+ +LSDA+++FYL 
Sbjct: 149 HNLCPSMPVSWKNRDPL-LAKKDRKRASRGQETFQTETSPLSLSQIRQQLSDAILDFYLY 207

Query: 225 LQLMKGYREVNVTGFRKIVKKFDKTCGTRELVPFIEYAKSTYPIFQHAEANARVVAHQMH 284
           LQL+K YR++NV GFRKIVKKFDK     +L  F+ YAK    +F   +   +++   + 
Sbjct: 208 LQLLKNYRDLNVNGFRKIVKKFDKVLHQDQLKTFMPYAKKYSIMFSQYDEYLKLIKDNVE 267

Query: 285 DSALLGERSSFATELNVE----DPLLSWEQQTTKWYTDVLSSSSKDRKRKTARLKNLSLE 340
            + ++       ++ +V+    DPL  WEQ   KWYT  L+SSSKD+K    R+KNLSL+
Sbjct: 268 HAEVINVNLFLGSDNDVDRLKKDPLTFWEQTAIKWYTMTLTSSSKDKKHNLERIKNLSLQ 327

Query: 341 YSLNEQKVHRFNRSILQMFXXXXXXXXXXXXXXYTLYRGFVASNSS-EIHSLLLPLWGGW 399
           YS+NEQ +HR N S+ QMF                L    +A NSS E+ S LLP+W  +
Sbjct: 328 YSVNEQTIHRNNASMFQMFLGSAQLGISVTLV--ILMTIILAKNSSDEVRSALLPIWSSF 385

Query: 400 YMVFLITFLFLLNCFIWHRSNINYRFIMFGEMHSRRGAVLFNNDFSTTKIPILFYFASVL 459
           + +  +  LF+++CFIW++  INYRFIMFGE+HSR G VLFNNDF  T IP+ F+ A+  
Sbjct: 386 HYLTFMGLLFIIDCFIWYKVKINYRFIMFGEIHSRNGPVLFNNDFGMTHIPLQFFHATTF 445

Query: 460 AFPMALLSSISFNEVNLNPWAIIWIALVVVLFFSPVLGELPLLSIPYWNKLTKSVRWILV 519
               ++L+  S     L PW I W+ + V LFF       P    PYW +  +S ++I  
Sbjct: 446 LCICSILAFCSLMLEKLEPWMITWLCIAVALFFWKFQVIQPW---PYWYETFQSRKYIFT 502

Query: 520 SFVRLIFSGFYPVQFGDFFLGDIFCSLTYSLADIAMFFCI-YSPTPNGRCGSSHSKAMGA 578
           SF+RL+FSGF+PVQFGDFFLGDI CSLTYS++  A   C+ ++ +   +C       +G 
Sbjct: 503 SFIRLVFSGFFPVQFGDFFLGDIVCSLTYSMSQFATLGCLTFNDSKEDKCRYEKLMWIGI 562

Query: 579 MTCLPNFWRFMQCLRRFSDSGDWFPHLLNGLKYSLSVVYYASLCAYRI-SHTRSRRNVFI 637
           ++CLP++WRF+QC+RR+ DS DWFPHLLN  KY L + + ASL  Y+     +  + + I
Sbjct: 563 LSCLPSYWRFVQCVRRYFDSYDWFPHLLNAFKYLLGISFNASLYWYKSWPQMQKFKVLLI 622

Query: 638 IFATLNGVCTSIWDIIMDWSLLQSGSRNWLLRDDLYLAGRKNWKTGAYSKRRKSVYYLAM 697
           +F  LN   TSIWD+IMDWSLLQ+ S+N+LLRDDLYL G+KNWK+G YS ++K +YY  M
Sbjct: 623 VFGCLNSTLTSIWDLIMDWSLLQTKSKNFLLRDDLYLCGKKNWKSGKYSSKKKCIYYFIM 682

Query: 698 IWDVAMRFQWVVYAIAPAT-IQQSAITSFILAALEVTRRFVWIIFRVENEHVANVHLFKV 756
           ++DV +R++WV Y +   T   +  + +  +A LE+ RRFVW+I RVENEHVANVHLFKV
Sbjct: 683 VFDVVVRYEWVFYMVKNNTDYVRHPLIALAMATLEILRRFVWVILRVENEHVANVHLFKV 742

Query: 757 SGE-ISLPYPTTVNEESETEASVSSNHYAMSEMSFPTMAAPTPMYRGESTQKSTGSNGLL 815
           + +   LP+PT  + E   E   S+    M  ++  ++       + +  + ++    L 
Sbjct: 743 TDDNWQLPFPTIEDSELHMEEDYSAAAENMDNIAMLSVMKSDLESQQQRPRSTSAVPKLN 802

Query: 816 RTLS--SSIPWAHAQDFQRPTGCAGGDNA 842
           R  S    IPWAHA DFQRP   A  ++A
Sbjct: 803 RKASVFEIIPWAHATDFQRPIETASVNSA 831

>YNR013C (PHO91) [4596] chr14 complement(649027..651711) Member of
           the phosphate permease family of membrane transporters,
           has similarity to Pho87p and Pho90p [2685 bp, 894 aa]
          Length = 894

 Score = 70.1 bits (170), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 79/301 (26%), Positives = 130/301 (43%), Gaps = 32/301 (10%)

Query: 1   MKFAEHLRESAVPEWIDKYIDYKAGKKKLKSCRNTIAASEVLINNVSSFASVPPSRESSM 60
           MKF+  L+ ++VPEW  KY+ Y   KK + S +      ++  NN      V P   +  
Sbjct: 1   MKFSHSLQFNSVPEWSTKYLAYSQLKKLIYSLQK----DKLYSNN--KHHVVEPHDANDE 54

Query: 61  SRYLSQNRSYTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCGRRFAVLQEQIEKFE 120
           +  L  + S  P  Q ++  FV    ++QEL+K + FY+ +       +  L++ + + E
Sbjct: 55  NLPLLADAS--PDDQFYISKFVA--ALNQELKKIDKFYISQETGLIANYNELKDDVMELE 110

Query: 121 -ADQAQQSIADTDSKYYGAVDRDETIQPITAGKDSTLRSRFFRVVQDLELVPSFPRM--- 176
             ++A Q           +V R+           S  R R F  V   +  PS   M   
Sbjct: 111 NTNKATQLFNQQQQHQLQSVARNRK-------SKSQQRQRRFSSVSSTDSNPSLTDMSID 163

Query: 177 -APFKRLLDQSPEDNNLSVSHGETFAPTTLSTNQI------QHRLS--DALIEFYLLLQL 227
            AP       +  +N  S+ +  + + +  ++N +      QHRLS    LI  Y  L  
Sbjct: 164 SAPVIHTQVSNTTNNGNSMQNLASASVSLSNSNPVYLSPFTQHRLSLKKRLISIYTQLSE 223

Query: 228 MKGYREVNVTGFRKIVKKFDKTCGTRELVPFIEYAKSTYPIFQHAEANARVVAHQMHDSA 287
           +K + E+N TGF KI KKFDK+  T     ++ Y K    +F  A  N   + H + ++ 
Sbjct: 224 LKDFIELNQTGFSKICKKFDKSLNTNLKQNYLNYIKFHSHVFNPATINR--IQHHITETI 281

Query: 288 L 288
           L
Sbjct: 282 L 282

>Kwal_47.18721
          Length = 383

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 98/230 (42%), Gaps = 20/230 (8%)

Query: 531 PVQFGDFFLGDIFCSLTYSLADIAMFFCIYSPTPNGRCGSSHSKAMGAMTCL-------P 583
           P++     + D   S +  L D   + C     P          AMG+   L       P
Sbjct: 154 PLRNNYILISDSLTSYSKPLIDFGFYLCHLVVDPISENCIISRTAMGSAINLDLMIGTAP 213

Query: 584 NFWRFMQCLRRFSDS---GDWFPHLLNGLKYSLSVVYYASLCAYRISHTRSRRNVFIIFA 640
              R +QCLR +  S   GD    + N LKYSL +         R        N    F 
Sbjct: 214 VIIRLLQCLREWRRSRTLGDARSSIFNALKYSLHLPIVMCAVYSRSFPDVKPGNYVYWFM 273

Query: 641 TLNGVCTSIWDIIMDWSL-LQSGSRNWLLRDDLYLAGRKNWKTGAYSKRRKSVYYLAMIW 699
            LN   +  WD+ MDW+L + +  R+ + R+++ L  R+++ +         +Y+LAM  
Sbjct: 274 LLNSFYSFWWDLTMDWNLGVFNFGRSGMGRNEV-LRARRHFPS--------YMYFLAMSA 324

Query: 700 DVAMRFQWVVYAIAPATIQQSAITSFILAALEVTRRFVWIIFRVENEHVA 749
           D  +RF W+   +A  +  +     F L  LE+ RR++WI  +++ E ++
Sbjct: 325 DFTLRFMWLWELLAGRSAFEGEANIFFLQILEILRRWIWIFVKLDAEAIS 374

>Scas_625.16
          Length = 932

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 71/273 (26%), Positives = 122/273 (44%), Gaps = 24/273 (8%)

Query: 1   MKFAEHLRESAVPEWIDKYIDYKAGKKKLKSCRNTIAASEVLINNVSSFASVPPSRESSM 60
           MKF+  L+ +AVPEW  KYI Y   KK + S +      E L ++ SS   +       +
Sbjct: 82  MKFSHSLQFNAVPEWSSKYIAYSHLKKLIYSLQK-----EKLYSSSSSHLQLDEECRPLV 136

Query: 61  SRYLSQNRSYTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCGRRFAVLQEQIEKFE 120
           +   +    YT     +V  FVE   +D EL+K + FY+ +       +  L++ +++FE
Sbjct: 137 AS--TDGNLYT--NDIYVSRFVEA--LDHELKKIDKFYISQETGLVANYNELKDDVKEFE 190

Query: 121 ADQAQQSIAD-TDSKYYGAVDRDETIQPITAGKDSTLRSRFFRVVQDLELVPSFPRMAPF 179
            D     +   +D+    A+ R       +A  +++  ++F      +E  P+       
Sbjct: 191 TDLLNNRLPSISDALPRQAMRRRRFSSISSADSNAS-DAQF-----SIESAPAMEDTLN- 243

Query: 180 KRLLDQSPEDNNLSVSHGETFAPTTLSTNQIQHR--LSDALIEFYLLLQLMKGYREVNVT 237
             +LD    +N +  S   T   +   +  +QH+  L   L+  Y  L  +K + E+N T
Sbjct: 244 SGVLDS---ENEIYASQSRTTGVSQYISPLLQHKVTLKKRLVAIYTQLSELKEFIELNQT 300

Query: 238 GFRKIVKKFDKTCGTRELVPFIEYAKSTYPIFQ 270
           GF KI KKFDK+  T     ++E  K    +F+
Sbjct: 301 GFSKICKKFDKSLNTSIKSSYLETIKKKSSVFK 333

>Kwal_23.6129
          Length = 816

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 68/258 (26%), Positives = 105/258 (40%), Gaps = 58/258 (22%)

Query: 1   MKFAEHLRESAVPEWIDKYIDYKAGKKKLKSCRNTIAASEVLINNVSSFASVPPSRESSM 60
           MKF+  L+ +AVPEW  +Y+ Y     +LK    T+   ++  N+V+             
Sbjct: 1   MKFSHSLQFNAVPEWSSRYLAYS----QLKRLIYTLQKEKLYQNSVT------------- 43

Query: 61  SRYLSQNRSYTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCGRRFAVLQEQIEKFE 120
                 +    P+Q  +VQ FVE   +D+EL K + FY  +  R    +  L+E + +F+
Sbjct: 44  ------DPELAPLQNSYVQKFVE--ALDKELYKIDKFYAQQEARIFDTYHELKEDVTEFK 95

Query: 121 ADQAQQSIADTDSKYYGAVDRDETIQPITAGKDSTLRSRFFRVVQDLELVPSFPRMAPFK 180
             Q  Q      S               + G D +  SR           P     A F 
Sbjct: 96  TQQPLQEFVSRRSSA-------------SMGTDVSGSSR-----------PPLRAAASFS 131

Query: 181 RLLDQSPEDNN-LSVSHGETFAPTTLSTNQ------IQHR--LSDALIEFYLLLQLMKGY 231
              D   E ++ L  S G+     + ST+       ++ R  L   L+  Y  L  +K +
Sbjct: 132 DDDDAEIEASHRLGTSTGDMIPLVSRSTHYAGLDPLVEDRINLKKRLVVAYTQLSELKSF 191

Query: 232 REVNVTGFRKIVKKFDKT 249
            E+N TGF KI KKFDK+
Sbjct: 192 IELNQTGFSKICKKFDKS 209

>ADR289C [2030] [Homologous to ScYNR013C (PHO91) - SH]
           (1193040..1195463) [2424 bp, 807 aa]
          Length = 807

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/266 (21%), Positives = 101/266 (37%), Gaps = 70/266 (26%)

Query: 1   MKFAEHLRESAVPEWIDKYIDYKAGKKKLKSCRNTIAASEVLINNVSSFASVPPSRESSM 60
           MKF+  L+ +AVPEW  KYI Y   KK + + +                       +   
Sbjct: 1   MKFSHSLQFNAVPEWSSKYIAYSQLKKLVYTLQK---------------------DKLYQ 39

Query: 61  SRYLSQNRSYTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCGRRFAVLQEQIEKFE 120
               +Q+    P+ Q +++ F+    +D+EL + + FY+ +       F  L++ +E  +
Sbjct: 40  HETFAQDPERVPLAQSYIERFIAA--LDKELRRIDKFYVSQETGILANFQELKDDVEDLQ 97

Query: 121 ADQAQQSIADTDSKYYGAVDRDETIQPITAGKDSTLRSRFFRVVQDLELVPSFPRMAPFK 180
            +   +   + +    G ++R +++   +                               
Sbjct: 98  REGLTKPRHEGEEYGAGGLNRRQSLSSASVA----------------------------- 128

Query: 181 RLLDQSPEDNNLSVSHGETFAPTTLSTNQIQHRLSDA--------------LIEFYLLLQ 226
              +  PE+ +LS+SHG    P       +  R S A              L+  Y  L 
Sbjct: 129 ---NSEPEEEDLSMSHGLAGTPD-YDVEPLLRRSSGADDRFLQQGILLKKRLVMAYTRLA 184

Query: 227 LMKGYREVNVTGFRKIVKKFDKTCGT 252
            +K Y E+N TGF KI KKFDK+  T
Sbjct: 185 ELKSYFELNHTGFSKICKKFDKSLET 210

>Sklu_2440.13 YDR414C, Contig c2440 19959-21104 reverse complement
          Length = 381

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 57/232 (24%), Positives = 92/232 (39%), Gaps = 24/232 (10%)

Query: 531 PVQFGDFFLGDIFCSLTYSLADIAMFFCIYSPTPNGRCGSSHSKAMGAMTCL-------P 583
           P++     + D   S    + D  ++ C     P G         +G    L       P
Sbjct: 150 PLRTNYILISDTLTSYGKPMIDYGLYLCQLLTNPVGTDCIIRKDPLGISLNLDLMIGITP 209

Query: 584 NFWRFMQCLRRF---SDSGDWFPHLLNGLKYS--LSVVYYASLCAYRISHTRSRRNVFII 638
              R +QCLR +   + S D    L N LKYS    ++ Y  +       T S    +++
Sbjct: 210 ATIRLIQCLREYKRSTSSADARAALFNALKYSCQFPILVYTVVTRAYPGETPSANIYWLL 269

Query: 639 FATLNGVCTSIWDIIMDWSLLQSGSRNWLLRDDLYLAGRK-NWKTGAYSKRRKSVYYLAM 697
              LN + T  WD+ MDW        N         +G K N  + A         Y A+
Sbjct: 270 L--LNSMYTFWWDLTMDWKFGFFNFTN---------SGMKLNEVSRAQRHFSIKTCYCAI 318

Query: 698 IWDVAMRFQWVVYAIAPATIQQSAITSFILAALEVTRRFVWIIFRVENEHVA 749
             D  +RF W+   ++  ++ +  +  F L  LE+ RR++WI F+VE E ++
Sbjct: 319 FVDFILRFAWLWELVSGVSVFKGEMNVFWLQFLEIVRRWIWIFFKVEAEFLS 370

>CAGL0I05632g 531308..533968 similar to sp|P27514 Saccharomyces
           cerevisiae YNR013c, start by similarity
          Length = 886

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 71/277 (25%), Positives = 118/277 (42%), Gaps = 39/277 (14%)

Query: 1   MKFAEHLRESAVPEWIDKYIDYKAGKKKLKSCRNTIAASEVLINNVSSFASVPPSRESSM 60
           MKF+  L+ ++VPEW  KYI Y   KK + S +     S     ++S+ AS     +  +
Sbjct: 1   MKFSHSLQFNSVPEWSSKYIAYSQLKKLIYSLQKEKLYSST--PDLSTAASESSELQPLL 58

Query: 61  SRYLSQNRSYTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCGRRFAVLQEQIEKFE 120
                +N SY    +RFVQ+      +D E++K   FYL +       +  L++ + ++E
Sbjct: 59  DVPEDENSSYV---RRFVQA------LDHEVKKIEKFYLSQETGLIANYNELKDDVHEYE 109

Query: 121 ADQAQQSIADTDSKYYGAVDRDETIQPITAGKDSTLRSRFFRVVQDLEL----VPSFPRM 176
            +    +         GAV         T G    LR R       +E     +P     
Sbjct: 110 QELTSANFLYPSQSLTGAVP--------TGGNAKKLRRRRLSSTSSMESNNSGLPLSVDS 161

Query: 177 APFKRLLDQSPEDNNLSVSHGETFAPTTLSTN-----------QIQHR--LSDALIEFYL 223
           AP   +    PE +  S+   ++ + T  + +           Q+QH+  L   L+  Y 
Sbjct: 162 APGAIV---PPEHHRPSIEAQKSRSSTVNNNSLNLSNFEPLNPQLQHKVTLKKRLVMVYT 218

Query: 224 LLQLMKGYREVNVTGFRKIVKKFDKTCGTRELVPFIE 260
            L  +K + ++N TGF KI KKFDK+  T    P+++
Sbjct: 219 QLSELKDFIDLNKTGFTKICKKFDKSLDTAIKKPYLK 255

>AAR127C [314] [Homologous to ScYDR414C (ERD1) - SH]
           (568957..570102) [1146 bp, 381 aa]
          Length = 381

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 97/231 (41%), Gaps = 25/231 (10%)

Query: 531 PVQFGDFFLGDIFCSLTYSLADIAMFFCIYSPTPNGRCGSSHSKAMGA-------MTCLP 583
           P++     L D   S    L D   +  +   TP     +       A       +  +P
Sbjct: 155 PLRTNYILLADTLTSYGKPLMDFTAYLVLLFRTPLADPLAVRDLPSNAALHIDLVVGAIP 214

Query: 584 NFWRFMQCLRRFSDSGD-WFPH---LLNGLKYS--LSVVYYASLCAYRISHTRSRRNVFI 637
           +  R +QCLR +    D W      L N LKYS  L ++ +A L     +H   R   + 
Sbjct: 215 SVIRLVQCLREYRRKEDAWAARRASLFNALKYSSQLPILVHALLSRSGAAHGGQRWVRWA 274

Query: 638 IFATLNGVCTSIWDIIMDWSL-LQSGSRNWLLRDDLYLAGRKNWKTGAYSKRRKSVYYLA 696
           +   LN V +  WD+ MDW L L + S   + RD++    R       YS +    YY A
Sbjct: 275 ML--LNSVYSFWWDVTMDWKLGLFNFSSAGMERDEVLRHRR------LYSVK---YYYGA 323

Query: 697 MIWDVAMRFQWVVYAIAPATIQQSAITSFILAALEVTRRFVWIIFRVENEH 747
           +++D  M+F W+        + +  +    L  LEV RR++W  F++E E+
Sbjct: 324 VLYDFVMKFMWLWELHVGRALFRRDLNPVWLHLLEVIRRWIWTFFKIEAEY 374

>KLLA0A02057g 186220..187374 gi|1169545|sp|P41771|ERD1_KLULA
           Kluyveromyces lactis ERD1 PROTEIN, start by similarity
          Length = 384

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 93/228 (40%), Gaps = 23/228 (10%)

Query: 539 LGDIFCSLTYSLADIAMF--FCIYSPTPNGRCGSSHSKAMGAMT------CLPNFWRFMQ 590
           + D   S +  L D+A++  F  + PT N +C     +   ++        LP+  R +Q
Sbjct: 154 ISDTLTSYSKPLVDLAIYATFLFHDPT-NVKCQVERYENAISLNIDVLVGVLPSLVRMIQ 212

Query: 591 CLRRF----SDSGDWFPHLLNGLKYSLSVVYYASLCAYRISHTRSRRNVFIIFATLNGVC 646
            LR F    S   D    L N  KY+ ++     +  Y   +      +   F   N   
Sbjct: 213 SLREFTRGRSQKKD-GSQLFNAFKYAGNIPI-MLVTVYTRYYNLGPLGMMYWFMFWNSAY 270

Query: 647 TSIWDIIMDWSLLQSGSRNWLLRDDLYLAGRKNWKTGAYSK-----RRKSVYYLAMIWDV 701
           +  WD+ MDW L      N    D        + K     +     R+ + YY AM  D 
Sbjct: 271 SFWWDVTMDWKLELFDFVN---GDTSVNNNNSSNKADGLLRSILLYRKNAWYYSAMALDF 327

Query: 702 AMRFQWVVYAIAPATIQQSAITSFILAALEVTRRFVWIIFRVENEHVA 749
            +RF W    I+  ++    +  F L  LE+ RR++W+ F+VE E++A
Sbjct: 328 ILRFVWFWEYISGHSVFYGELNIFWLQILEIIRRWIWLFFKVEVEYIA 375

>KLLA0F06160g 598549..601128 similar to sp|P27514 Saccharomyces
           cerevisiae YNR013c, start by similarity
          Length = 859

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/292 (23%), Positives = 115/292 (39%), Gaps = 89/292 (30%)

Query: 1   MKFAEHLRESAVPEWIDKYIDYKAGKK------KLKSCRNTIAASEVLINNVSSFASVPP 54
           MKF+  L+ +AVPEW  KYI Y   KK      K K  R+T  +S+          S P 
Sbjct: 1   MKFSHSLQFNAVPEWTTKYIGYSQLKKLIYTLQKEKLYRSTSESSD--------LESTPL 52

Query: 55  SRESSMSRYLSQNRSYTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCGRRFAVLQE 114
           +   +   Y          +QRF+ +      +D+EL+K + FY  +       ++ + E
Sbjct: 53  TTAVTRDSY----------EQRFIDA------LDKELDKIDSFYTMQETSILANYSEVYE 96

Query: 115 QIEKFEADQAQQSIADTD---------------SKY--------YGAVDRDETI-----Q 146
            +  F+ +   +SI +T                S+Y        Y   D DE       Q
Sbjct: 97  DVTTFQNELMNRSIHNTSTGDLNRQGTRRSSSISEYNSQPEMDLYSEEDDDEDGFSIGNQ 156

Query: 147 PITAGKDSTLRSR-------FFRVVQDL--ELVPSFPRMAPFKRLLDQSPEDNNLSVSHG 197
             + G++  +++R         R++  +  E++P+  R+  F                  
Sbjct: 157 EQSDGQNKQIQARRARTGSVGSRLMHSITSEILPTLSRVTDFT----------------- 199

Query: 198 ETFAPTTLSTNQIQHRLSDALIEFYLLLQLMKGYREVNVTGFRKIVKKFDKT 249
                TT    + Q  L   ++  +  L  +K + E+N TGF KI KKFDK+
Sbjct: 200 -----TTDPIMEQQITLKKRIVACFTQLSELKSFIELNQTGFAKICKKFDKS 246

>YDR414C (ERD1) [1239] chr4 complement(1295586..1296674) Protein
           required for retention of luminal ER proteins [1089 bp,
           362 aa]
          Length = 362

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 81/185 (43%), Gaps = 36/185 (19%)

Query: 578 AMTCLPNFWRFMQCLRRFSDSGDWFPHLLNGLKYSLSV----------VYYASLCAYRIS 627
           ++  LP   R +QCLR +    +    L N LKYS ++          VY  S+   R+ 
Sbjct: 192 SVALLPVLVRLLQCLREYRLLHE-ATLLFNALKYSCNLPILFCTWRSRVYEGSINEERLH 250

Query: 628 HTRSRRNVFIIFATLNGVCTSIWDIIMDWSLLQSGSRNWLLRDDLYLAGRKNWKTGAYSK 687
           H +        F  +N   T  WD+ MDWSL            D   + R   K+    K
Sbjct: 251 HVQRW------FMLINSSYTLFWDVRMDWSL------------DSLTSLRSRSKSAVTLK 292

Query: 688 RRKSVYYLAMIWDVAMRFQWVVYAIAPATIQQSAITSFI-----LAALEVTRRFVWIIFR 742
             K +Y+ A++ D  +RF W+   ++      +A + +I     +   EV RR +W++F+
Sbjct: 293 --KKMYHSAILVDFLLRFWWLWVYLSQNLKLVAADSDYIFFQGEMQYFEVIRRGIWVVFK 350

Query: 743 VENEH 747
           ++ E+
Sbjct: 351 LDAEY 355

>CAGL0F02871g complement(278122..279228) similar to sp|P16151
           Saccharomyces cerevisiae YDR414c ERD1 required for
           retention of luminal ER proteins, hypothetical start
          Length = 368

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 75/181 (41%), Gaps = 32/181 (17%)

Query: 579 MTCLPNFWRFMQCLRRFSDSGDWFPHLLNGLKYSLSVVYYASLCAYRI----SHTRSRRN 634
           +  +P   R  QCL+ +  + + F  L N LKYS  +     L   R+    S T    N
Sbjct: 193 LAVIPPLIRLCQCLKEYKTTKE-FTLLANALKYSCHLPVVLCLWYSRVYGDDSLTIRDYN 251

Query: 635 VFIIFATLNGVCTSIWDIIMDWSLLQSGSRNWLLRDDLYLAGRKNWKTGAYSKRR----K 690
           +  +   +    + IWD+  DW++    S                     Y K R    K
Sbjct: 252 ILKVMMFIQSTYSYIWDVRKDWTITSISSIR-------------------YQKSRVLFPK 292

Query: 691 SVYYLAMIWDVAMRFQWV-VYAIAPATIQQSAITSFILAA---LEVTRRFVWIIFRVENE 746
             Y++A++ D  MR+ W+ +  +AP  +       F       +E+ RR  W++F++E+E
Sbjct: 293 FYYHIAIVMDGIMRYWWLWIIILAPYDVSGKPTALFFEKEAQFIELIRRAGWVVFKLESE 352

Query: 747 H 747
           +
Sbjct: 353 Y 353

>Kwal_27.12292
          Length = 217

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 58/255 (22%), Positives = 97/255 (38%), Gaps = 68/255 (26%)

Query: 1   MKFAEHLRESAVPEWIDKYIDYKAGKKKLKSCRNTIAASEVLINNVSSFASVPPSRESSM 60
           MKF +      VPEW  +Y++YK  KK +K    T+  S        +     P +  + 
Sbjct: 1   MKFGKTFPNHQVPEWSHEYVNYKNLKKLIKEI-TTVQESYHKARQTRTNGDEAPLKARNS 59

Query: 61  SRYLSQNRSYTP-VQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCGRRFAVLQEQIEKF 119
           ++ L +N    P V++R    F   + +D+E+EK ++FY  +  +  RR   L    +  
Sbjct: 60  AK-LEENFFEEPEVKKRLATFF---FALDREIEKVSEFYNDQFLKYDRRLRRLLSSAQLA 115

Query: 120 EADQAQQSIADTDSKYYGAVDRDETIQPITAGKDSTLRSRFFRVVQDLELVPSFPRMAPF 179
           + + A  + A+           DE+I+P +A                             
Sbjct: 116 DLNAATCTEAN-----------DESIRPQSA----------------------------- 135

Query: 180 KRLLDQSPEDNNLSVSHGETFAPTTLSTNQIQHRLSDALIEFYLLLQLMKGYREVNVTGF 239
                  P   +L+  + E                   LIE    L+ +K Y E+N   F
Sbjct: 136 -------PIAPDLTADYSEILG---------------VLIELRSDLRNLKWYAELNKRAF 173

Query: 240 RKIVKKFDKTCGTRE 254
            KI+KK DK  GT++
Sbjct: 174 TKILKKLDKKVGTKQ 188

>KLLA0F00660g 54232..58356 similar to sgd|S0006031 Saccharomyces
           cerevisiae YPL110c, start by similarity
          Length = 1374

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 62/265 (23%), Positives = 109/265 (41%), Gaps = 38/265 (14%)

Query: 1   MKFAEHLRESAVPEWIDKYIDYKAGKKKLK---SCRNTIAASEVLIN--NVSSFASVPPS 55
           MKF +      VPEW  +Y++YK+ KK +K   + ++ +   E  ++  +  + +  PPS
Sbjct: 1   MKFGKTFPNHQVPEWSHEYVNYKSLKKLIKEIVAVQDQLYKQEHRVDGKDRENTSVSPPS 60

Query: 56  RESSMSRYLSQNRSYTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCGRRFAVLQEQ 115
           +   +S       ++  V+    + F   + +D +++K + FY  +     RR   L   
Sbjct: 61  KPMDVSTRTKDYLNHPEVKTLLAKFF---FALDADIQKVDSFYNQQFLEYDRRLRKLLSS 117

Query: 116 IEKFEADQAQQSIADTDSKYYGAVDRDETIQPITAGKDSTLRSRFFRVVQDLELVPSFPR 175
            +  E ++A           YGA + +  +   TAG  +   S+         +   + R
Sbjct: 118 AQFTEFNRAL---------MYGAANGNSGLNH-TAGNGNGCLSQ--------PMPTRYNR 159

Query: 176 MAPFKRLLDQSPEDNNLSVSHGETFAPTTLSTNQIQHRLSD------ALIEFYLLLQLMK 229
                +        N  SV+H        LS+N+      D       LIE     + +K
Sbjct: 160 HQSLTQNGHPGFHVNPDSVNH------LMLSSNKATEEAEDWSEVLAILIELRSHFRNLK 213

Query: 230 GYREVNVTGFRKIVKKFDKTCGTRE 254
            Y E+N   FRKI+KK DK  GT +
Sbjct: 214 WYGELNKRAFRKILKKLDKKVGTSQ 238

>YPL110C (YPL110C) [5334] chr16 complement(341067..344738) Member of
           the glycerophosphoryl diester phosphodiesterase family,
           contains six ankyrin (Ank) repeats and a SYG1, Pho81 and
           XPR1 (SPX) N-terminal domain, has weak similarity to S.
           cerevisiae Pho81p, which is a cyclin-dependent kinase
           (CDK) inhibitor [3672 bp, 1223 aa]
          Length = 1223

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 63/263 (23%), Positives = 101/263 (38%), Gaps = 65/263 (24%)

Query: 1   MKFAEHLRESAVPEWIDKYIDYKAGKKKLKSCRNTIAASEVLINNVSSFASVPPS--RES 58
           MKF +      +PEW  +Y+ YK+ KK +K             N  S     PP+  R+S
Sbjct: 1   MKFGKTFANHRIPEWSSQYVGYKSLKKMIKEITRLQEDIYRAHNKNSYDEGRPPTKMRDS 60

Query: 59  SMSRYLSQNRSYTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCGRRFAVLQEQIEK 118
           S S   +QN   +P  Q+ + SF   + +D+++EK + FY  +     +RF  L      
Sbjct: 61  SNS---AQNYLDSPKIQKLLASFF--FAVDRDIEKVDTFYNSQYAEYKKRFERL------ 109

Query: 119 FEADQAQQSIADTDSKYYGAVDRDETIQPITAGKDSTLRSRFFRVVQDLELVPSFPRMAP 178
                                                L S  F  ++   +V +    A 
Sbjct: 110 -------------------------------------LSSNQFNEIKSTLVVDANKEDAV 132

Query: 179 FKRLLDQSPEDNNLSVSHGETFAPTTLSTNQIQHRLSDALIEFY-LLLQLMKGYR----- 232
            + LL +   + N+          T+ ++    H+  D LIE   +L +L K +R     
Sbjct: 133 AQTLLTKDTREMNM------LLKGTSQASRLSYHK--DDLIEIQSILAELRKQFRNLKWY 184

Query: 233 -EVNVTGFRKIVKKFDKTCGTRE 254
            E+N   F KI+KK DK  GT +
Sbjct: 185 AELNKRAFGKILKKLDKKVGTNQ 207

>KLLA0E15774g 1402940..1406386 similar to sp|P17442 Saccharomyces
           cerevisiae YGR233c PHO81 cyclin-dependent kinase
           inhibitor singleton, start by similarity
          Length = 1148

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 70/151 (46%), Gaps = 41/151 (27%)

Query: 1   MKFAEHL--RESAVPEWIDKYIDYKAGKKKLKSCRNTIAASEVLINNVSSFASVPPSRES 58
           MKF +HL  R+  +PE+   +I+YKA KK +K       +S     N + + ++  + ES
Sbjct: 1   MKFGKHLEGRQLELPEYNGHFINYKALKKLIKQLSVPAVSS---YTNSNDYMTLDETDES 57

Query: 59  SMSRYLSQNRSYTPVQQRFVQSFVEKWVIDQELEKCNDFYL-----------------WE 101
              + L +N++          SF  K  +++ELEK N+FYL                 +E
Sbjct: 58  IRYQSLQENKA----------SFFFK--LERELEKVNEFYLEKEADLRMKFDLLNSRYYE 105

Query: 102 LKRCGR-------RFAVLQEQIEKFEADQAQ 125
            K  G+        +  +++ I+KFE D AQ
Sbjct: 106 YKSKGKLTSKKSIAYRTIRDGIKKFERDLAQ 136

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 1/70 (1%)

Query: 206 STNQIQHR-LSDALIEFYLLLQLMKGYREVNVTGFRKIVKKFDKTCGTRELVPFIEYAKS 264
           S   I +R + D + +F   L  ++ + E+N TGF K++KK+DK   +     ++    S
Sbjct: 114 SKKSIAYRTIRDGIKKFERDLAQLEQFVELNRTGFSKVLKKWDKRSHSHAKDFYLATVVS 173

Query: 265 TYPIFQHAEA 274
             P+F   E 
Sbjct: 174 VQPVFTRNEV 183

>Kwal_27.12751
          Length = 1093

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 63/119 (52%), Gaps = 20/119 (16%)

Query: 1   MKFAEHL--RESAVPEWIDKYIDYKAGKKKLKSCRNTIAASEVLINNVSSFASVPPSRES 58
           MKF +HL  R+ A+PE+   +IDYK+ KK +K    + AA       V + A++  + ES
Sbjct: 1   MKFGKHLETRQLALPEYNGHFIDYKSLKKLIKQLSVSGAAV------VGTSAALDSADES 54

Query: 59  SMSRYLSQNRSYTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCGRRFAVLQEQIE 117
            + + L ++++          SF   + +++ELEK N +YL +      +F +LQ + +
Sbjct: 55  LVHQTLQEHKA----------SFF--FRLERELEKVNAYYLEKEADLRIKFDILQSRFQ 101

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 37/70 (52%), Gaps = 1/70 (1%)

Query: 206 STNQIQHR-LSDALIEFYLLLQLMKGYREVNVTGFRKIVKKFDKTCGTRELVPFIEYAKS 264
           S N + +R L D + +F   L  ++ + E+N TGF K++KK+DK   +     ++    +
Sbjct: 111 SKNTVAYRPLRDGIKKFERDLAHLEQFVELNRTGFSKVLKKWDKRSHSHTKDFYLATVVA 170

Query: 265 TYPIFQHAEA 274
             P+F   EA
Sbjct: 171 VQPVFTRNEA 180

>AGR223W [4534] [Homologous to ScYPL110C - SH]
           complement(1167870..1171835) [3966 bp, 1321 aa]
          Length = 1321

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 52/115 (45%), Gaps = 12/115 (10%)

Query: 1   MKFAEHLRESAVPEWIDKYIDYKAGKKKLKSCRNTIAASEVLINNVSSFASVPPSR---E 57
           MKF +      VPEW  KY++YK  KK++K    T+    +      + +   P+R    
Sbjct: 1   MKFGKTFPNHQVPEWAHKYVNYKGLKKQIKEI--TLVQDALFRQEQGAASQDGPARRRGR 58

Query: 58  SSMSRYLSQNRSYTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCGRRFAVL 112
            S  +YL       P  ++ + +F   + +D+++EK + FY  +     RR   L
Sbjct: 59  ESKEQYLGH-----PEVKKLLAAFF--FALDRDIEKVDGFYNMQFMEYDRRLRKL 106

 Score = 30.4 bits (67), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%)

Query: 218 LIEFYLLLQLMKGYREVNVTGFRKIVKKFDKTCGTRE 254
           L+E     + +K Y E+N   F KI+KK DK  GT +
Sbjct: 167 LLELRSHFRNLKWYGELNKRAFTKIMKKLDKKVGTNQ 203

>Scas_570.8
          Length = 353

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 91/228 (39%), Gaps = 35/228 (15%)

Query: 531 PVQFGDFFLGDIFCSLTYSLADIAMFFCIYSPTPNGRCGSSHSKAMGAMTCLPNFWRFMQ 590
           P++     L D   S    L D  ++  +    P       H     A   LP   R  Q
Sbjct: 151 PLRNTYILLSDSLTSFAKPLIDFTLYTSLVIAIP-----MDHFDLFVA--SLPVLIRIFQ 203

Query: 591 CLRRFSDSGDWFPHLLNGLKYSLSVVYYASLCAYRISHTRSRRN--VFIIFATLNGVCTS 648
           CL+ +   GD    L N +KY  ++   A +   R+    S  N  + +     +   + 
Sbjct: 204 CLKEYRAVGD-KSMLGNTVKYCSNLPILACVWYSRVHGGSSEWNQTLTMWLRLFHSSYSL 262

Query: 649 IWDIIMDWSLLQSGSRNWLLRDDLYLAGRKNWKTGAYSKRRKSVYYLAMIWDVAMRFQWV 708
            WD+ MDW +  S  R  L    L L                ++YY+ ++ D  +R+ WV
Sbjct: 263 FWDVKMDWFIDISSRR--LRSTKLALPT--------------TIYYVGILIDFIIRYWWV 306

Query: 709 VYAIAPATIQQSAITSFI-----LAALEVTRRFVWIIFRVENEHVANV 751
                 A    S+  +FI     L  LEV RR +W++F++E+E+V  +
Sbjct: 307 WVQWYGA----SSYFNFIFFDSELQYLEVFRRAIWVVFKLESEYVLKL 350

>AFR628C [3820] [Homologous to ScYJL198W (PHO90) - SH; ScYCR037C
           (PHO87) - SH] (1576713..1579322) [2610 bp, 869 aa]
          Length = 869

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 38/66 (57%), Gaps = 4/66 (6%)

Query: 208 NQIQHRLSDALIEFYLLLQLMKGYREVNVTGFRKIVKKFDKT--CGTR-ELVPFIEYAKS 264
           +Q +  L   +I+ Y+ L  +K Y E+N  GF KI KKFDKT  C  R +L+   E  K 
Sbjct: 227 SQKRSILKKKIIDLYVELSQLKSYIELNRIGFFKITKKFDKTLSCTVRSDLIESGELFKE 286

Query: 265 TYPIFQ 270
           TY +FQ
Sbjct: 287 TY-VFQ 291

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 22/29 (75%), Gaps = 1/29 (3%)

Query: 1  MKFAEHLRESAVPEWIDKYIDYKAGKKKL 29
          MKF+  L+ +AVPEW D Y++Y +G KKL
Sbjct: 1  MKFSHSLKYNAVPEWQDHYLNY-SGLKKL 28

>YCR037C (PHO87) [571] chr3 complement(194409..197180) Member of the
           phosphate permease family of membrane transporters,
           appears to play a supporting role in phosphate uptake
           under high phosphate growth conditions [2772 bp, 923 aa]
          Length = 923

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 66/131 (50%), Gaps = 15/131 (11%)

Query: 208 NQIQHRLSDALIEFYLLLQLMKGYREVNVTGFRKIVKKFDKTC--GTR-ELVPFIEYAKS 264
           +Q +  L   +I  Y+ L  +K + E+N  GF KI KK DK     TR EL+   E+ K 
Sbjct: 282 SQKKSLLKQTIINLYIDLCQLKSFIELNRMGFSKITKKSDKVLHMNTRQELIESEEFFKD 341

Query: 265 TYPIFQH---AEANARVVAHQMHDSALLGERS---SFATELN--VEDPLLSWEQQTTKWY 316
           TY IFQH   +  N+++       + L+G+     S   EL   + D ++ WE+  T  +
Sbjct: 342 TY-IFQHETLSSLNSKIAQLIEFYAVLMGQPGNVDSCKQELKSYLHDHIV-WERSNT--W 397

Query: 317 TDVLSSSSKDR 327
            D+L  SS++ 
Sbjct: 398 KDMLGLSSQNN 408

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 17/22 (77%)

Query: 1  MKFAEHLRESAVPEWIDKYIDY 22
          M+F+  L+ +AVPEW + Y+DY
Sbjct: 1  MRFSHFLKYNAVPEWQNHYLDY 22

>Kwal_33.13618
          Length = 891

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 35/56 (62%), Gaps = 4/56 (7%)

Query: 218 LIEFYLLLQLMKGYREVNVTGFRKIVKKFDKT--CGT-RELVPFIEYAKSTYPIFQ 270
           L++ Y+ L  +K + E+N  GF KI KKFDKT  C   R+L+   E+  +TY +FQ
Sbjct: 259 LVDLYVDLAQLKSFIELNRIGFLKITKKFDKTLDCNIRRDLIESGEFFNTTY-VFQ 313

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 1  MKFAEHLRESAVPEWIDKYIDYKAGKKKLKSCR 33
          MKF+  L+ +AVPEW + Y++Y   KK + S +
Sbjct: 1  MKFSHSLKYNAVPEWQEHYLNYSQLKKLIYSLQ 33

>Sklu_2202.8 YPL110C, Contig c2202 8829-12932
          Length = 1367

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 53/111 (47%), Gaps = 8/111 (7%)

Query: 1   MKFAEHLRESAVPEWIDKYIDYKAGKKKLKSCRNTIAASEVLINNVSSFASVPPSRESSM 60
           MKF +      VPEW  +Y++YK  KK +K    T        ++ S   + PP+R  + 
Sbjct: 1   MKFGKTFPNHQVPEWSHQYVNYKGLKKLIKQITQTQEKLHREQHDHSG-ETDPPARPRNT 59

Query: 61  SRYLSQNRSYTPVQQRFVQSFVEK--WVIDQELEKCNDFYLWELKRCGRRF 109
              L+ + +Y  +    V+S +    + +D+++EK ++FY  +     RR 
Sbjct: 60  ---LNIDENY--LNDSLVKSLLASFFFALDRDIEKVDNFYNMQFLEYNRRL 105

>ADL143W [1598] [Homologous to ScYGR233C (PHO81) - SH]
           complement(440265..443573) [3309 bp, 1102 aa]
          Length = 1102

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 57/116 (49%), Gaps = 23/116 (19%)

Query: 1   MKFAEHL--RESAVPEWIDKYIDYKAGKKKLKSCRNTIAASEVLINNVSSFASVPPSRE- 57
           MKF ++L  R+  +PE+   +IDYKA KK +K    ++ A           ASVP   E 
Sbjct: 1   MKFGKYLAGRQLELPEYNGYFIDYKALKKLIKQL--SVPA-----------ASVPGGSEL 47

Query: 58  --SSMSRYLSQNRSYTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCGRRFAV 111
             + M     ++ SY  +Q+     F   + +++ELEK ND+YL   K  G +  V
Sbjct: 48  PDALMLDTEDRSESYQRLQENKASFF---FRLERELEKVNDYYLE--KEAGLKVVV 98

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 63/142 (44%), Gaps = 10/142 (7%)

Query: 132 DSKYYGAVDRDETIQPITAGKDSTLRSRFFRVVQDLELVPSF--PRMAPFKRLLDQSPED 189
           D+      DR E+ Q +   K     S FFR+ ++LE V  +   + A  K ++D     
Sbjct: 49  DALMLDTEDRSESYQRLQENK----ASFFFRLERELEKVNDYYLEKEAGLKVVVDIIQSR 104

Query: 190 NNLSVSHGETFAPTTLSTNQIQHRLSDALIEFYLLLQLMKGYREVNVTGFRKIVKKFDKT 249
               +  G+  +  T S   I+    DA+ +    L  ++ Y E+N TGF K++KK+D  
Sbjct: 105 YRDYLKRGKLISKKTSSYRHIR----DAVKKVERDLTHLEHYVELNRTGFSKVLKKWDNR 160

Query: 250 CGTRELVPFIEYAKSTYPIFQH 271
             +     ++    S  P+F H
Sbjct: 161 SHSHTRDFYLATVVSVQPVFTH 182

>YJL012C (VTC4) [2892] chr10 complement(411149..413314) Subunit of
           the vacuolar transporter chaperone (Vtc) complex (Vtc1p,
           Vtc2p, Vtc3p, Vtc4p), required for vacuolar priming
           reactions, involved in vacuolar polyphosphate
           accumulation [2166 bp, 721 aa]
          Length = 721

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 56/121 (46%), Gaps = 18/121 (14%)

Query: 202 PTTLSTNQIQHRLSDALIEFYLLLQLMKGYREVNVTGFRKIVKKFDKTCGTRELVPFIEY 261
           PT L    ++  LSD + + + L +    +  +N TGF+KI+KK DK  G   L P  + 
Sbjct: 94  PTQLDFEILEEELSDIIADVHDLAK----FSRLNYTGFQKIIKKHDKKTGFI-LKPVFQV 148

Query: 262 AKSTYPIFQHAEANARVVAHQMHDSA------LLGERSSFATELNVEDPLLSWEQQTTKW 315
              + P F+       V   Q++D A      + G+ S+   + N       + +QTTK+
Sbjct: 149 RLDSKPFFKENYDELVVKISQLYDIARTSGRPIKGDSSAGGKQQN-------FVRQTTKY 201

Query: 316 Y 316
           +
Sbjct: 202 W 202

>Scas_480.6
          Length = 723

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 41/84 (48%), Gaps = 5/84 (5%)

Query: 202 PTTLSTNQIQHRLSDALIEFYLLLQLMKGYREVNVTGFRKIVKKFDKTCGTRELVPFIEY 261
           PT +    ++  LSD + + + L +    +  +N TGF+KI+KK DK  G   L P  + 
Sbjct: 94  PTEMDFEILEEELSDIIADVHDLAK----FSRLNYTGFQKIIKKHDKKTGFV-LKPIFQV 148

Query: 262 AKSTYPIFQHAEANARVVAHQMHD 285
              + P F+    +  V   Q++D
Sbjct: 149 RLDSKPFFKENYDDLVVKISQLYD 172

>Scas_595.9
          Length = 1148

 Score = 37.4 bits (85), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 68/140 (48%), Gaps = 18/140 (12%)

Query: 1   MKFAEHL--RESAVPEWIDKYIDYKAGKKKLKS--CRNTIAASEVLINNVSSFASVPPSR 56
           MKF ++L  R+  +P++   +IDYK+ KK +K      +I A   L  + + F  +    
Sbjct: 1   MKFGKYLESRQLELPDYNGHFIDYKSLKKLIKQLVVSPSILAGSSLAEDTTHF-DLDSID 59

Query: 57  ESSMSRYLSQNRSYTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCGRRFAVLQEQI 116
           E+ + + L +N+S          +F   + +D+ELEK N FY+ +      +F +L  + 
Sbjct: 60  ETIIYQRLQENKS----------TFF--FRLDRELEKINSFYMEKELDLTVKFNILNSKF 107

Query: 117 EKFEADQAQQSIADTDSKYY 136
           + +     QQ ++  +S  +
Sbjct: 108 QDY-CQVGQQIVSKKNSNSF 126

 Score = 34.3 bits (77), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 6/73 (8%)

Query: 216 DALIEFYLLLQLMKGYREVNVTGFRKIVKKFDKTCGTRELVPFIEYAKSTYPIFQHAEAN 275
           DA ++    L  ++ Y E+N TGF K +KK+DK   + E   ++    +  PIF      
Sbjct: 131 DAFLKLQTDLNELEQYIELNRTGFSKALKKWDKRSHSHEKEFYLATVVTVQPIF------ 184

Query: 276 ARVVAHQMHDSAL 288
            R    Q++D+ L
Sbjct: 185 TRNKVAQLNDATL 197

>CAGL0J07040g 675389..679126 similar to tr|Q02979 Saccharomyces
           cerevisiae YPL110c, start by similarity
          Length = 1245

 Score = 37.4 bits (85), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 55/256 (21%), Positives = 98/256 (38%), Gaps = 67/256 (26%)

Query: 1   MKFAEHLRESAVPEWIDKYIDYKAGKKKLKSCRNTIAASEVLINNVSSFASVP--PSRES 58
           MKF + L +  +PEW   Y++YK  KK LK             N+ +     P     E 
Sbjct: 1   MKFGKTLLKLRIPEWSHLYVNYKVLKKILKEITKVQDDLYQQENSANGEGDKPLWKKEED 60

Query: 59  SMS---RYLSQNRSYTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCGRRFAVLQEQ 115
            M+   +  ++N+    +QQ  +  F   + +D+++EK + FY         +F+  +++
Sbjct: 61  GMTSDRKTFAENKK---IQQLIISFF---FNLDRDIEKVDSFY-------NSQFSEYEKR 107

Query: 116 IEKFEADQAQQSIADTDSKYYGAVDRDETIQPITAGKDSTLRSRFFRVVQDLELVPSFPR 175
           ++K       Q +        G    ++ + P+  G                  +P  PR
Sbjct: 108 LQKLLQSSQFQDVTYLIENREG----EKELTPVGNGS-----------------IP--PR 144

Query: 176 MAPFKRLLDQSPEDNNLSVSHGETFAPTTLSTNQIQHRLSDALIEFYLLLQLMKGYREVN 235
            A    + D                       N++ + LS+   +F    + +K Y E+N
Sbjct: 145 YATPHHIDD----------------------VNEVYNILSELKTQF----RNLKNYSELN 178

Query: 236 VTGFRKIVKKFDKTCG 251
              F KI+KKFDK  G
Sbjct: 179 KRAFVKILKKFDKITG 194

>CAGL0G06952g complement(663828..665981) similar to sp|P47075
           Saccharomyces cerevisiae YJL012c VTC4, start by
           similarity
          Length = 717

 Score = 37.4 bits (85), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 5/84 (5%)

Query: 202 PTTLSTNQIQHRLSDALIEFYLLLQLMKGYREVNVTGFRKIVKKFDKTCGTRELVPFIEY 261
           P+ L    ++  LSD + + + L +    +  +N TGF+KI+KK DK  G   L P  + 
Sbjct: 94  PSELDFEILEEELSDVIADVHDLAK----FSRLNYTGFQKIIKKHDKKTGFI-LKPIFQV 148

Query: 262 AKSTYPIFQHAEANARVVAHQMHD 285
                P F+       V   QM+D
Sbjct: 149 RLDAKPFFKENYDELVVKISQMYD 172

>KLLA0C03454g 311611..314313 similar to sp|P25360 Saccharomyces
          cerevisiae YCR037c PHO87 member of the phosphate
          permease family, start by similarity
          Length = 900

 Score = 37.4 bits (85), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%)

Query: 1  MKFAEHLRESAVPEWIDKYIDYKAGKKKLKSCR 33
          MKF+  L+ +AVPEW D YIDY   KK + S +
Sbjct: 1  MKFSHSLKYNAVPEWQDYYIDYSHLKKLIYSLQ 33

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 208 NQIQHRLSDALIEFYLLLQLMKGYREVNVTGFRKIVKKFDK--TCGT-RELVPFIEY 261
           +Q +  L   +I+ Y+ L  +K + E+N  GF KI KKFDK  +C   R+L+   E+
Sbjct: 257 SQKRSILKKNVIDLYVDLAQLKSFIELNRIGFSKISKKFDKVLSCSIKRDLIESGEF 313

>Kwal_33.15385
          Length = 713

 Score = 36.6 bits (83), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 57/126 (45%), Gaps = 18/126 (14%)

Query: 197 GETFAPTTLSTNQIQHRLSDALIEFYLLLQLMKGYREVNVTGFRKIVKKFDKTCGTRELV 256
           G    P+ L    ++  LSD + + + L +    +  +N TGF+KI+KK DK      L 
Sbjct: 89  GSNVPPSELDFEILEEELSDIIADVHDLAK----FSRLNYTGFQKIIKKHDKRTKFI-LK 143

Query: 257 PFIEYAKSTYPIFQHAEANARVVAHQMHD------SALLGERSSFATELNVEDPLLSWEQ 310
           P  +    + P F+    +  V   Q++D      + + G+ SS   + N       + +
Sbjct: 144 PVFQVRLDSKPFFKENYDDLVVKISQLYDLVRTRGNPITGDSSSGGKQQN-------FIR 196

Query: 311 QTTKWY 316
           QTTK++
Sbjct: 197 QTTKYW 202

>CAGL0E03157g 291000..292505 highly similar to sp|P32582
           Saccharomyces cerevisiae YGR155w CYS4 cystathionine
           beta-synthase, hypothetical start
          Length = 501

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 63/261 (24%), Positives = 109/261 (41%), Gaps = 45/261 (17%)

Query: 12  VPEWIDK-YID--YKAGKK-KLKSCRNTIAASEVLINNVSSFASVPPSRESSMSRYLSQN 67
           +PE +D+  +D  YK   K   K  R  I+   VLI   S  A        +    LS++
Sbjct: 244 IPEVLDRSLVDVWYKTDDKPAFKYARQLISNEGVLIGGSSGSAFTALVEYCNDHPELSED 303

Query: 68  RSYTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCGRRFAVLQEQIEKFEADQAQQS 127
                +    ++S++ K+V D+ L K ND  LW+            E +++ + D+ ++ 
Sbjct: 304 DVLVAIFPDSIRSYLTKFVDDEWL-KTND--LWD-----------DEILKRVDFDEKKKP 349

Query: 128 IADTDSKYYGAVDRDETIQPITAGKDSTLRSRFFRVVQDLELVPSFPRMAPFKRLLDQSP 187
              TD  + GA  +D  ++P+ A KD+ L S    +++D                 DQ P
Sbjct: 350 A--TDDVFKGATVKDLHLKPVVAVKDNALVSDVISILRD--------------NAFDQLP 393

Query: 188 ---EDNNLSVSHGETFAPTTLSTNQIQHRLSDALIEFYLLLQLMKGYREV-----NVTGF 239
              +D  L+     +     LST ++ +  +D +   YL  + +  + EV     N +G 
Sbjct: 394 VLTQDGKLTGLVTLSQLLKKLSTGKVNN--TDTIKNLYLDFRKLNNFDEVSSYNENKSGK 451

Query: 240 RKIVKKFDKTCGTRELVPFIE 260
           +K V +F       EL  F E
Sbjct: 452 KKFV-QFTSESTLAELNKFFE 471

>CAGL0F02387g complement(229207..232065) similar to sp|P25360
           Saccharomyces cerevisiae YCR037c PHO87 or sp|P39535
           Saccharomyces cerevisiae YJL198w, start by similarity
          Length = 952

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 37/66 (56%), Gaps = 4/66 (6%)

Query: 208 NQIQHRLSDALIEFYLLLQLMKGYREVNVTGFRKIVKKFDKT--CGTR-ELVPFIEYAKS 264
           +Q +  L  ++I  Y+ L  +K + E+N  GF KI KK DK     TR EL+   E+ K 
Sbjct: 304 SQRKSILKQSIINLYVDLCQLKSFIELNRMGFSKITKKSDKVLLLNTREELIHSGEFFKD 363

Query: 265 TYPIFQ 270
           TY +FQ
Sbjct: 364 TY-VFQ 368

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 7/56 (12%)

Query: 1  MKFAEHLRESAVPEWIDKYIDYKAGKKKLKSCRNTIAASEVLINNVSSFASVPPSR 56
          M+F+  L+ +AVPEW + Y+DY     +LK+   T+   E+         + PP R
Sbjct: 1  MRFSHFLKYNAVPEWQNHYMDY----SELKNLIYTLQTDEL---KNGPIGNQPPER 49

>CAGL0F02145g 213561..216011 similar to sp|P43585 Saccharomyces
           cerevisiae YFL004w VTC2 or sp|P47075 Saccharomyces
           cerevisiae YJL012c VTC4, start by similarity
          Length = 816

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 44/92 (47%), Gaps = 9/92 (9%)

Query: 158 SRFFRVV-QDLELVPSFPRMAPFKRLLDQSPEDNNLSVSHGETFAPTTLSTNQIQHRLSD 216
           SRF   + ++LE V SF +M  +  ++D+    N L  S         L T Q Q  L +
Sbjct: 42  SRFTEALDKELEKVYSF-QMKTYHEIMDRL---NALEKSTNTEEGLQNLDTEQFQRTLEE 97

Query: 217 ALIEFYLLLQLMKGYREVNVTGFRKIVKKFDK 248
           +L E       +  +  +N TGF KIVKK DK
Sbjct: 98  SLSE----ANELDNFSRLNYTGFMKIVKKHDK 125

>KLLA0F22627g complement(2112336..2114525) similar to sp|P47075
           Saccharomyces cerevisiae YJL012c VTC4, start by
           similarity
          Length = 729

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 48/106 (45%), Gaps = 6/106 (5%)

Query: 181 RLLDQSPEDNNLSVSHGETFAPTT-LSTNQIQHRLSDALIEFYLLLQLMKGYREVNVTGF 239
           R + Q+ E  +++V   +T  P T L    ++  LSD + + + L +  +    +N TG 
Sbjct: 73  RRIKQAQEQVSVAVRSLDTNVPVTDLDFQILEEELSDIIADVHDLAKFAR----LNYTGL 128

Query: 240 RKIVKKFDKTCGTRELVPFIEYAKSTYPIFQHAEANARVVAHQMHD 285
           +KI+KK DK      L P  +      P F+       V   Q++D
Sbjct: 129 QKIIKKHDKNTNFI-LKPIFQVRMDAKPFFKENYDELVVKLSQLYD 173

>CAGL0L06622g complement(743602..747015) similar to sp|P17442
           Saccharomyces cerevisiae YGR233c PHO81 cyclin-dependent
           kinase inhibitor, start by similarity
          Length = 1137

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%)

Query: 228 MKGYREVNVTGFRKIVKKFDKTCGTRELVPFIEYAKSTYPIFQHAEA 274
           ++ Y E+N TGF K++KK+DK   + E   ++    S  PIF   E 
Sbjct: 141 LEQYVELNRTGFAKVLKKWDKRSHSNEKEFYLATVVSVQPIFTRTEV 187

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 61/130 (46%), Gaps = 27/130 (20%)

Query: 1   MKFAEHL--RESAVPEWIDKYIDYKAGKKKLKSC-------RNTIAASEVLINNVSSFAS 51
           MKF ++L  R+  + E+   +IDYKA KK +K          + + AS+ LIN    F  
Sbjct: 1   MKFGKYLEARQVELAEYNTHFIDYKALKKLMKQLATVPMINDDDLNASKNLINVDIDF-- 58

Query: 52  VPPSRESSMSRYLSQNRSYTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCGRRFAV 111
                E+S+ R L  N++          SF  K  +++ELEK N +Y+ +      +  V
Sbjct: 59  ----NEASVYRSLQANKA----------SFFFK--LERELEKVNLYYVDKESELKVKLDV 102

Query: 112 LQEQIEKFEA 121
           +  ++  + +
Sbjct: 103 IVSKMNDYRS 112

>Scas_634.15
          Length = 916

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 4/66 (6%)

Query: 208 NQIQHRLSDALIEFYLLLQLMKGYREVNVTGFRKIVKKFDKTCGTR---ELVPFIEYAKS 264
           +Q    L  ++   Y+ L  +K + E+N  GF KI KK DK        E++   E+ K 
Sbjct: 271 SQKTSLLKQSITNLYIDLCQLKSFIELNRLGFNKITKKCDKVLHLNIRDEMIQTEEFFKD 330

Query: 265 TYPIFQ 270
           TY IFQ
Sbjct: 331 TY-IFQ 335

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 17/22 (77%)

Query: 1  MKFAEHLRESAVPEWIDKYIDY 22
          M+F+  L+ +AVPEW + Y+DY
Sbjct: 1  MRFSHFLKYNAVPEWQNHYVDY 22

>CAGL0I08415g 820503..824429 some similarities with tr|Q06211
           Saccharomyces cerevisiae YPR164w KIM3 drug resistance,
           hypothetical start
          Length = 1308

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 605 LLNGLKYSLSVV--YYASLCAYRISHTRSRRNVFIIFATLNGVCTSIWDIIMDWSLLQSG 662
           L NG++ S+  +  YY     Y I HTR+    F+  + LN +    +D I +W LL+  
Sbjct: 802 LYNGIQVSVEGISTYYPK--NYTIRHTRNPNKQFLFLSKLNRMLIVNFD-IGEWELLKLR 858

Query: 663 SRNWLLRDDLYLAGRKN 679
           +   L  D  YL  + N
Sbjct: 859 NNKTLTLDKCYLTDKHN 875

>YJL198W (PHO90) [2728] chr10 (60843..63488) Phosphate
          transporter, low affinity, has strong similarity to
          Pho87p and Ynr013p, member of the phosphate permease
          family of membrane transporters [2646 bp, 881 aa]
          Length = 881

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 4/45 (8%)

Query: 1  MKFAEHLRESAVPEWIDKYIDYKAGKKKLKSCRNTIAASEVLINN 45
          M+F+  L+ +AVPEW + Y+DY     +LK+   T+   E+ + +
Sbjct: 1  MRFSHFLKYNAVPEWQNHYMDY----SELKNLIYTLQTDELQVGD 41

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 218 LIEFYLLLQLMKGYREVNVTGFRKIVKKFDKT--CGTR-ELVPFIEYAKSTY 266
           ++  Y+ L  +K + E+N  GF KI KK DK     TR EL+   ++ K TY
Sbjct: 246 IVNLYIDLCQLKSFIELNRIGFAKITKKSDKVLHLNTRTELIESEQFFKDTY 297

>Kwal_56.23410
          Length = 825

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 1  MKFAEHLRESAVPEWIDKYIDYKAGKKKLKS 31
          MKF   + E +VPEW    IDYK  K+ +K+
Sbjct: 1  MKFGSQIYEKSVPEWRLNNIDYKHLKEAVKT 31

>YPL019C (VTC3) [5418] chr16 complement(514507..517014) Subunit of
           the vacuolar transporter chaperone (Vtc) complex (Vtc1p,
           Vtc2p, Vtc3p, Vtc4p), required for the final step of
           vacuolar fusion, involved in vacuolar polyphosphate
           accumulation [2508 bp, 835 aa]
          Length = 835

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 53/136 (38%), Gaps = 37/136 (27%)

Query: 1   MKFAEHLRESAVPEWIDKYIDYKAGKKKLKSCRNTIAASEVLINNVSSFASVPPSRESSM 60
           M F   L     P W D YIDY+  KK LK                    SV     SS+
Sbjct: 1   MLFGIKLANDVYPPWKDSYIDYERLKKLLKE-------------------SVIHDGRSSV 41

Query: 61  SRYLSQNRSYTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCGRRFAVLQ------E 114
             +  +N S           FVE   +D+ELEK   F + +     R+   L+      E
Sbjct: 42  DSWSERNES----------DFVE--ALDKELEKVYTFQISKYNAVLRKLDDLEENTKSAE 89

Query: 115 QIEKFEADQAQQSIAD 130
           +I+K  ++Q + ++ +
Sbjct: 90  KIQKINSEQFKNTLEE 105

>Kwal_23.5060
          Length = 835

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 4/48 (8%)

Query: 201 APTTLSTNQIQHRLSDALIEFYLLLQLMKGYREVNVTGFRKIVKKFDK 248
           A  +L  N+ Q  L ++L E     Q +  +  VN TGF KIVKK DK
Sbjct: 98  AIKSLDFNKFQQVLEESLSE----AQELDNFCRVNFTGFIKIVKKHDK 141

>CAGL0K09086g 902244..903599 similar to tr|Q08685 Saccharomyces
           cerevisiae YOR250c CLP1 cleavage/polyadenylation factor
           IA subunit, hypothetical start
          Length = 451

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 3/50 (6%)

Query: 771 ESETEASVSSNHYAMSEMSFPTMAAPTPMYRGESTQKSTGSNGLLRTLSS 820
           E+ T  +V + H+A+ +M   T   P  M  GE   K+TG   L RTL S
Sbjct: 102 ENTTAHNVYNLHFALEKMRSSTFDGPRIMVVGE---KNTGKTALCRTLCS 148

>Scas_689.1
          Length = 691

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 24/42 (57%)

Query: 208 NQIQHRLSDALIEFYLLLQLMKGYREVNVTGFRKIVKKFDKT 249
           +Q +  L  +++  ++ L  +K + E+N  GF KI KK DK 
Sbjct: 39  SQKKSLLKQSIVNLFIDLSQLKSFIELNKMGFSKITKKGDKV 80

>Sklu_2390.5 , Contig c2390 12646-14778
          Length = 710

 Score = 30.4 bits (67), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 53/120 (44%), Gaps = 18/120 (15%)

Query: 203 TTLSTNQIQHRLSDALIEFYLLLQLMKGYREVNVTGFRKIVKKFDKTCGTRELVPFIEYA 262
           T L    ++  LSD + + + L +  +    +N TGF+KI+KK DK      L P  +  
Sbjct: 95  TELDFEILEEELSDIIADVHDLAKFAR----LNYTGFQKIIKKHDKKTKFI-LKPIFQVR 149

Query: 263 KSTYPIFQHAEANARVVAHQMHD------SALLGERSSFATELNVEDPLLSWEQQTTKWY 316
             + P F+       V   Q +D      + + G+ S+   + N       + +QTTK++
Sbjct: 150 LDSKPFFKENYDELVVKISQSYDLVRNKGNPIKGDSSAGGKQQN-------FVRQTTKYW 202

>Sklu_2390.4 YJL012C, Contig c2390 12646-14778
          Length = 710

 Score = 30.4 bits (67), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 53/120 (44%), Gaps = 18/120 (15%)

Query: 203 TTLSTNQIQHRLSDALIEFYLLLQLMKGYREVNVTGFRKIVKKFDKTCGTRELVPFIEYA 262
           T L    ++  LSD + + + L +  +    +N TGF+KI+KK DK      L P  +  
Sbjct: 95  TELDFEILEEELSDIIADVHDLAKFAR----LNYTGFQKIIKKHDKKTKFI-LKPIFQVR 149

Query: 263 KSTYPIFQHAEANARVVAHQMHD------SALLGERSSFATELNVEDPLLSWEQQTTKWY 316
             + P F+       V   Q +D      + + G+ S+   + N       + +QTTK++
Sbjct: 150 LDSKPFFKENYDELVVKISQSYDLVRNKGNPIKGDSSAGGKQQN-------FVRQTTKYW 202

>AGL020W [4291] [Homologous to ScYFL004W (VTC2) - SH; ScYPL019C
           (VTC3) - SH] complement(682963..685497) [2535 bp, 844
           aa]
          Length = 844

 Score = 30.4 bits (67), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 53/137 (38%), Gaps = 34/137 (24%)

Query: 113 QEQIEKFEADQAQQSIADTDSKYYGAVDRD-ETIQPITAGKDSTLRSRFFRVVQDLELVP 171
           +E   K + D  +   A  +S +  A+DR+ E +    +GK + +  +  R+ ++L+   
Sbjct: 42  KESKRKGKGDTDEHWTARNESNFVEALDRELEKVYSFQSGKYTEIMGKLERLEEELDGAD 101

Query: 172 SFPRMAPFKRLLDQSPEDNNLSVSHGETFAPTTLSTNQIQHRLSDALIEFYLLLQLMKGY 231
           +                               +L    I+  L  AL E     Q +  +
Sbjct: 102 AL-----------------------------QSLDLGHIREELEQALTE----AQELDRF 128

Query: 232 REVNVTGFRKIVKKFDK 248
             +N TGF KIVKK DK
Sbjct: 129 SRLNFTGFIKIVKKHDK 145

>YGR233C (PHO81) [2181] chr7 complement(954675..958211)
           Cyclin-dependent kinase (CDK) inhibitor for
           Pho80p-Pho85p cyclin-dependent protein kinase complex,
           positive regulator of phosphate pathway [3537 bp, 1178
           aa]
          Length = 1178

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%)

Query: 217 ALIEFYLLLQLMKGYREVNVTGFRKIVKKFDKTCGTRELVPFIEYAKSTYPIF 269
           A  +F   L+ ++ Y E+N TGF K +KK+DK   + +   ++    S  PIF
Sbjct: 126 AFKKFQKDLRNLEQYVELNKTGFSKALKKWDKRSQSHDKDFYLATVVSIQPIF 178

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.135    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 26,374,006
Number of extensions: 1103994
Number of successful extensions: 4383
Number of sequences better than 10.0: 66
Number of HSP's gapped: 4435
Number of HSP's successfully gapped: 91
Length of query: 844
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 734
Effective length of database: 12,788,129
Effective search space: 9386486686
Effective search space used: 9386486686
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 66 (30.0 bits)