Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Kwal_23.577924824512830.0
KLLA0F27489g29724510701e-148
Scas_715.4729724510591e-147
YER055C (HIS1)2972459951e-137
ADL081C2972449321e-127
CAGL0L00759g3062549001e-122
Kwal_27.1234756585710.43
YKL001C (MET14)20279661.2
KLLA0C10571g117730634.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kwal_23.5779
         (245 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kwal_23.5779                                                          498   0.0  
KLLA0F27489g 2544518..2545411 highly similar to sp|P00498 Saccha...   416   e-148
Scas_715.47                                                           412   e-147
YER055C (HIS1) [1484] chr5 complement(264891..265784) ATP phosph...   387   e-137
ADL081C [1660] [Homologous to ScYER055C (HIS1) - SH] (540943..54...   363   e-127
CAGL0L00759g 93848..94768 highly similar to sp|P00498 Saccharomy...   351   e-122
Kwal_27.12347                                                          32   0.43 
YKL001C (MET14) [3256] chr11 complement(438420..439028) Adenosin...    30   1.2  
KLLA0C10571g 906848..910381 similar to sp|P24276 Saccharomyces c...    29   4.8  

>Kwal_23.5779
          Length = 248

 Score =  498 bits (1283), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/245 (100%), Positives = 245/245 (100%)

Query: 1   MPIALIFLPAADIPMFVGEGKCDLGITGVDQVQESDVDVLLPMDLNFGSCKLQVQVPNAG 60
           MPIALIFLPAADIPMFVGEGKCDLGITGVDQVQESDVDVLLPMDLNFGSCKLQVQVPNAG
Sbjct: 1   MPIALIFLPAADIPMFVGEGKCDLGITGVDQVQESDVDVLLPMDLNFGSCKLQVQVPNAG 60

Query: 61  PYEKPEQLIGKTIVSSFTNLTKQYFAKLEGVPVEKITTKIRYVGGSVEASCALGIADAIV 120
           PYEKPEQLIGKTIVSSFTNLTKQYFAKLEGVPVEKITTKIRYVGGSVEASCALGIADAIV
Sbjct: 61  PYEKPEQLIGKTIVSSFTNLTKQYFAKLEGVPVEKITTKIRYVGGSVEASCALGIADAIV 120

Query: 121 DLVESGETMRAAGLKDIATVLETSAHLIESKNPKGDPELLQTIKSRIEGVMTAQKYVNCN 180
           DLVESGETMRAAGLKDIATVLETSAHLIESKNPKGDPELLQTIKSRIEGVMTAQKYVNCN
Sbjct: 121 DLVESGETMRAAGLKDIATVLETSAHLIESKNPKGDPELLQTIKSRIEGVMTAQKYVNCN 180

Query: 181 YNAPVTALEKVLKITPGRRAPTISKIDDEGWVAVSAMIDRKQKGTIMDDLKKNGAADIMV 240
           YNAPVTALEKVLKITPGRRAPTISKIDDEGWVAVSAMIDRKQKGTIMDDLKKNGAADIMV
Sbjct: 181 YNAPVTALEKVLKITPGRRAPTISKIDDEGWVAVSAMIDRKQKGTIMDDLKKNGAADIMV 240

Query: 241 FEISN 245
           FEISN
Sbjct: 241 FEISN 245

>KLLA0F27489g 2544518..2545411 highly similar to sp|P00498
           Saccharomyces cerevisiae YER055c HIS1 ATP
           phosphoribosyltransferase singleton, start by similarity
          Length = 297

 Score =  416 bits (1070), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 200/245 (81%), Positives = 224/245 (91%)

Query: 1   MPIALIFLPAADIPMFVGEGKCDLGITGVDQVQESDVDVLLPMDLNFGSCKLQVQVPNAG 60
           MP+ALIFLPAADIPMFVGEG+CDLGITGVDQV+ES+VDV LP+DL FG+CKLQVQVP AG
Sbjct: 50  MPVALIFLPAADIPMFVGEGRCDLGITGVDQVRESEVDVNLPIDLQFGTCKLQVQVPVAG 109

Query: 61  PYEKPEQLIGKTIVSSFTNLTKQYFAKLEGVPVEKITTKIRYVGGSVEASCALGIADAIV 120
            Y  PEQLIGKTIVSSF NLTK+YFA+LEGVP  ++ T+++YVGGSVEASCALG+ADAIV
Sbjct: 110 EYTSPEQLIGKTIVSSFVNLTKKYFAQLEGVPESEMVTRVKYVGGSVEASCALGVADAIV 169

Query: 121 DLVESGETMRAAGLKDIATVLETSAHLIESKNPKGDPELLQTIKSRIEGVMTAQKYVNCN 180
           DLVESGETMRAAGL  IATVL+TSAHLIESKNPKGD ELL+TIKSRIEGVMTAQKYV+C+
Sbjct: 170 DLVESGETMRAAGLTAIATVLDTSAHLIESKNPKGDVELLRTIKSRIEGVMTAQKYVSCS 229

Query: 181 YNAPVTALEKVLKITPGRRAPTISKIDDEGWVAVSAMIDRKQKGTIMDDLKKNGAADIMV 240
           YNAP   L ++LKITPGRRAPTIS+I+D GWVAVS+MI+RK KG IMDDLKKNGA DIMV
Sbjct: 230 YNAPENKLPELLKITPGRRAPTISQINDSGWVAVSSMIERKNKGDIMDDLKKNGAEDIMV 289

Query: 241 FEISN 245
           FEISN
Sbjct: 290 FEISN 294

>Scas_715.47
          Length = 297

 Score =  412 bits (1059), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 197/245 (80%), Positives = 224/245 (91%)

Query: 1   MPIALIFLPAADIPMFVGEGKCDLGITGVDQVQESDVDVLLPMDLNFGSCKLQVQVPNAG 60
           +PIALIFLPAADIPMFVGEG+CDLGITGVDQV+E+ +DV LP+DL FGSCKLQVQVP  G
Sbjct: 50  LPIALIFLPAADIPMFVGEGRCDLGITGVDQVREAKMDVDLPIDLKFGSCKLQVQVPVNG 109

Query: 61  PYEKPEQLIGKTIVSSFTNLTKQYFAKLEGVPVEKITTKIRYVGGSVEASCALGIADAIV 120
           PY KPEQLIGKTIVSSFTNLT++YFAKLEGVP EK+TTK++YVGGSVEASCALG+ADAIV
Sbjct: 110 PYTKPEQLIGKTIVSSFTNLTEEYFAKLEGVPAEKMTTKVKYVGGSVEASCALGVADAIV 169

Query: 121 DLVESGETMRAAGLKDIATVLETSAHLIESKNPKGDPELLQTIKSRIEGVMTAQKYVNCN 180
           DLVESGETMRAAGL DIATVLETSAH+IESKNP+ D +L++TIKSRIEGV+TAQ+YV CN
Sbjct: 170 DLVESGETMRAAGLIDIATVLETSAHVIESKNPRSDKDLIETIKSRIEGVITAQRYVCCN 229

Query: 181 YNAPVTALEKVLKITPGRRAPTISKIDDEGWVAVSAMIDRKQKGTIMDDLKKNGAADIMV 240
           YNAP   L ++L ITPGRR PTISKID +GWVAV++MI+R +KG IMD+LKK GAADIMV
Sbjct: 230 YNAPEDKLSQLLTITPGRRGPTISKIDSDGWVAVNSMIERSKKGEIMDELKKKGAADIMV 289

Query: 241 FEISN 245
           FEISN
Sbjct: 290 FEISN 294

>YER055C (HIS1) [1484] chr5 complement(264891..265784) ATP
           phosphoribosyltransferase, first step in histidine
           biosynthesis pathway [894 bp, 297 aa]
          Length = 297

 Score =  387 bits (995), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 186/245 (75%), Positives = 216/245 (88%)

Query: 1   MPIALIFLPAADIPMFVGEGKCDLGITGVDQVQESDVDVLLPMDLNFGSCKLQVQVPNAG 60
           +P+AL+FLPAADIP FVGEGKCDLGITGVDQV+ES+VDV L +DL FG+CKLQVQVP  G
Sbjct: 50  LPVALVFLPAADIPTFVGEGKCDLGITGVDQVRESNVDVDLAIDLQFGNCKLQVQVPVNG 109

Query: 61  PYEKPEQLIGKTIVSSFTNLTKQYFAKLEGVPVEKITTKIRYVGGSVEASCALGIADAIV 120
            Y+KPEQLIGKTIV+SF  L ++YFA LEG  VEK+TT+I++V GSVEASCALGI DAIV
Sbjct: 110 EYKKPEQLIGKTIVTSFVKLAEKYFADLEGTTVEKMTTRIKFVSGSVEASCALGIGDAIV 169

Query: 121 DLVESGETMRAAGLKDIATVLETSAHLIESKNPKGDPELLQTIKSRIEGVMTAQKYVNCN 180
           DLVESGETMRAAGL DIATVL TSA+LIESKNPK D  L+ TIKSRIEGVMTAQ++V+C 
Sbjct: 170 DLVESGETMRAAGLVDIATVLSTSAYLIESKNPKSDKSLIATIKSRIEGVMTAQRFVSCI 229

Query: 181 YNAPVTALEKVLKITPGRRAPTISKIDDEGWVAVSAMIDRKQKGTIMDDLKKNGAADIMV 240
           YNAP   L ++LK+TPGRRAPTISKIDDEGWVAVS+MI+RK KG ++D+LK+ GA+DIMV
Sbjct: 230 YNAPEDKLPELLKVTPGRRAPTISKIDDEGWVAVSSMIERKTKGVVLDELKRLGASDIMV 289

Query: 241 FEISN 245
           FEISN
Sbjct: 290 FEISN 294

>ADL081C [1660] [Homologous to ScYER055C (HIS1) - SH]
           (540943..541836) [894 bp, 297 aa]
          Length = 297

 Score =  363 bits (932), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 173/244 (70%), Positives = 203/244 (83%)

Query: 2   PIALIFLPAADIPMFVGEGKCDLGITGVDQVQESDVDVLLPMDLNFGSCKLQVQVPNAGP 61
           P+ALIFLPAADIP FVGEG+CDLGITGVDQV+ES V+V L  DL+FG C+LQVQVP  GP
Sbjct: 51  PVALIFLPAADIPTFVGEGRCDLGITGVDQVRESGVNVELLQDLDFGRCQLQVQVPAGGP 110

Query: 62  YEKPEQLIGKTIVSSFTNLTKQYFAKLEGVPVEKITTKIRYVGGSVEASCALGIADAIVD 121
           Y +PEQLIGKTIV+SFT L ++YFA+LEGV    +TT+++YVGGSVEA+CALG+ADAIVD
Sbjct: 111 YSQPEQLIGKTIVTSFTRLAREYFARLEGVDEAAMTTRVKYVGGSVEAACALGVADAIVD 170

Query: 122 LVESGETMRAAGLKDIATVLETSAHLIESKNPKGDPELLQTIKSRIEGVMTAQKYVNCNY 181
           LVESGETMRAAGL  I TVL TSAHLI S NPK    LL T+++RIEGV+ AQ YV C Y
Sbjct: 171 LVESGETMRAAGLTPIGTVLSTSAHLICSPNPKSSLALLDTVRARIEGVLAAQHYVYCTY 230

Query: 182 NAPVTALEKVLKITPGRRAPTISKIDDEGWVAVSAMIDRKQKGTIMDDLKKNGAADIMVF 241
           NA   AL  +L+ITPGRRAPTISK+DD+ W AVS+MI R++KG I+DDLK +GA DIMVF
Sbjct: 231 NAHADALPALLRITPGRRAPTISKLDDDNWYAVSSMIIRREKGRILDDLKASGAEDIMVF 290

Query: 242 EISN 245
           EISN
Sbjct: 291 EISN 294

>CAGL0L00759g 93848..94768 highly similar to sp|P00498 Saccharomyces
           cerevisiae YER055c HIS1, start by similarity
          Length = 306

 Score =  351 bits (900), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 174/254 (68%), Positives = 214/254 (84%), Gaps = 9/254 (3%)

Query: 1   MPIALIFLPAADIPMFVGEGKCDLGITGVDQVQESDVDVL-LPMDLNFGSCKLQVQVPNA 59
           +PIALIFLPAADIP FVGEGKCDLGITG+DQV+ES ++ + L MDL FG CKLQVQVP  
Sbjct: 50  LPIALIFLPAADIPTFVGEGKCDLGITGLDQVKESGIEEIDLLMDLGFGGCKLQVQVPEK 109

Query: 60  G-PYEKPEQLIGKTIVSSFTNLTKQYFAKLE----GVPVEKITTKIRYVGGSVEASCALG 114
              Y  P+QL+GKTIVSSF  L++ YF +LE    G PV+K++TKI+YVGGSVEASCALG
Sbjct: 110 DRKYTDPKQLVGKTIVSSFVKLSRDYFQQLEEEVLGKPVDKLSTKIKYVGGSVEASCALG 169

Query: 115 IADAIVDLVESGETMRAAGLKDIATVLETSAHLIESKNPKGDP---ELLQTIKSRIEGVM 171
           + DAIVDLVESGETMRAAGL DIATVLETSA+LI+++ P+ D    EL++ IKSRI+GV+
Sbjct: 170 VGDAIVDLVESGETMRAAGLIDIATVLETSAYLIQARRPQQDKSREELIEVIKSRIQGVL 229

Query: 172 TAQKYVNCNYNAPVTALEKVLKITPGRRAPTISKIDDEGWVAVSAMIDRKQKGTIMDDLK 231
           TAQ+YV C+YN P   L+++LK+TPGRRAPTISK+DD+GWVAV++MI+RK+K  IMD+LK
Sbjct: 230 TAQRYVCCSYNTPEGNLKELLKVTPGRRAPTISKLDDDGWVAVNSMIERKRKADIMDELK 289

Query: 232 KNGAADIMVFEISN 245
           + GA+DIMVFEISN
Sbjct: 290 RKGASDIMVFEISN 303

>Kwal_27.12347
          Length = 565

 Score = 32.0 bits (71), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 39/85 (45%), Gaps = 9/85 (10%)

Query: 93  VEKITTKIRYVGGSVEASCALGIADAIVDLVESGETMRAAGLKDIATVLET--------S 144
           V ++  K++Y+GG VE +  L  +     ++       A G+K      E         S
Sbjct: 333 VPELRFKLKYLGG-VEETFNLNFSRPGFQVIHQYYNFLALGMKGYRKAFERALFAARTFS 391

Query: 145 AHLIESKNPKGDPELLQTIKSRIEG 169
             L+ES   +G+ EL+ +I  RI+G
Sbjct: 392 YALLESDEFEGNFELISSIHERIDG 416

>YKL001C (MET14) [3256] chr11 complement(438420..439028)
           Adenosine-5'-phosphosulfate 3'-phosphotransferase
           (adenylylsulfate kinase), part of the sulfate
           assimilation pathway [609 bp, 202 aa]
          Length = 202

 Score = 30.0 bits (66), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 35/79 (44%), Gaps = 10/79 (12%)

Query: 110 SCALGIADAI----VDLVESGETMRAAGLKDIATVLETSAHLIESKNPKGDPELLQTIKS 165
           SCA+ I   I    VD   + E  + AGLK I   ++    + E ++PKG        K 
Sbjct: 95  SCAISITSFISPYRVDRDRARELHKEAGLKFIEIFVDVPLEVAEQRDPKG------LYKK 148

Query: 166 RIEGVMTAQKYVNCNYNAP 184
             EGV+     ++  Y AP
Sbjct: 149 AREGVIKEFTGISAPYEAP 167

>KLLA0C10571g 906848..910381 similar to sp|P24276 Saccharomyces
           cerevisiae YDR293c SSD1 involved in the tolerance to
           high concentration of Ca2+, start by similarity
          Length = 1177

 Score = 28.9 bits (63), Expect = 4.8,   Method: Composition-based stats.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 7   FLPAADIPMFVGEGKCDLGITGVDQVQESD 36
           +LP A+IP  + EGK   GI  V++   SD
Sbjct: 303 YLPQANIPQLIEEGKLVAGILRVNKKNRSD 332

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.134    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,445,199
Number of extensions: 298816
Number of successful extensions: 800
Number of sequences better than 10.0: 15
Number of HSP's gapped: 796
Number of HSP's successfully gapped: 15
Length of query: 245
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 146
Effective length of database: 13,168,927
Effective search space: 1922663342
Effective search space used: 1922663342
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)